ACIAD1521 / SwissProt Alignments

BLASTP 2.2.28+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: cce0a5865e2e1bdb8b4a550ad3831be2.SwissProt.fasta
           22 sequences; 9,583 total letters



Query= ACIAD1521

Length=139
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  Q4FQ60 Sec-independent protein translocase protein TatB [Psychr...  90.9    8e-26
  Q1Q8C2 Sec-independent protein translocase protein TatB [Psychr...  89.0    4e-25
  A3M1X6 Sec-independent protein translocase protein TatB [Acinet...  80.1    2e-22
  Q6FER0 Sec-independent protein translocase protein TatB [Acinet...  75.1    2e-20
  A5EVU3 Sec-independent protein translocase protein TatB [Dichel...  68.6    4e-18
  Q9PFU4 Sec-independent protein translocase protein TatB [Xylell...  67.8    6e-18
  Q87B79 Sec-independent protein translocase protein TatB [Xylell...  67.4    9e-18
  Q8PEX3 Sec-independent protein translocase protein TatB [Xantho...  66.2    4e-17
  Q3BMG2 Sec-independent protein translocase protein TatB [Xantho...  66.2    4e-17
  Q2NXS1 Sec-independent protein translocase protein TatB [Xantho...  66.2    4e-17
  Q87TH0 Sec-independent protein translocase protein TatB [Vibrio...  65.1    5e-17
  P57063 Sec-independent protein translocase protein TatB [Vibrio...  64.7    7e-17
  P69425 Sec-independent protein translocase protein TatB [Escher...  56.2    9e-14
  Q5NN67 Sec-independent protein translocase protein TatB [Zymomo...  38.5    2e-07
  P9WG99 Sec-independent protein translocase protein TatB [Mycoba...  38.1    2e-07
  Q9Z221 Polyamine-modulated factor 1-binding protein 1 [Rattus n...  39.3    3e-07
  O42184 CAP-Gly domain-containing linker protein 1 [Gallus gallus]   39.3    3e-07
  Q7Z3E2 Coiled-coil domain-containing protein 186 [Homo sapiens]     38.1    6e-07
  O94804 Serine/threonine-protein kinase 10 [Homo sapiens]            38.1    6e-07
  Q863A3 Myocilin [Macaca fascicularis]                               37.4    1e-06
  O33600 DNA double-strand break repair Rad50 ATPase [Sulfolobus ...  37.4    1e-06
  Q8BL66 Early endosome antigen 1 [Mus musculus]                      37.4    1e-06


> Q4FQ60 Sec-independent protein translocase protein TatB [Psychrobacter 
arcticus (strain DSM 17307 / VKM B-2377 / 273-4)]
Length=229

 Score = 90.9 bits (224),  Expect = 8e-26
 Identities = 45/101 (45%), Positives = 69/101 (68%), Gaps = 0/101 (0%)

Query  1    MFNISFGELLAFAIIALIILGPEKLPHTLRSVLLKYRAVKNQISKIQNDIENELDLIELK  60
            MF+I F ELL F +IALI+LGPEKLP   R+    Y  ++  +S +Q++IE ELDL E +
Sbjct  1    MFDIGFSELLLFGVIALIVLGPEKLPQAARTAGQWYAKIRRTVSTLQSEIEAELDLAETR  60

Query  61   RVMQEELQKIKQNEEQLKQQLALMQQEIENVQTSVSIERKT  101
            ++MQ+EL KI+Q E ++++++A M+  I+  + S S   KT
Sbjct  61   QLMQKELAKIRQTEAEMRREMAEMRGSIKEFEHSQSQNLKT  101


> Q1Q8C2 Sec-independent protein translocase protein TatB [Psychrobacter 
cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / 
VKM B-2378 / K5)]
Length=231

 Score = 89.0 bits (219),  Expect = 4e-25
 Identities = 43/108 (40%), Positives = 71/108 (66%), Gaps = 0/108 (0%)

Query  1    MFNISFGELLAFAIIALIILGPEKLPHTLRSVLLKYRAVKNQISKIQNDIENELDLIELK  60
            MF+I F ELL F +IALI+LGPEKLP   R+    Y  ++  +S +Q++IE ELDL E +
Sbjct  1    MFDIGFSELLLFGVIALIVLGPEKLPQAARTAGQWYAKIRRTVSTLQSEIEAELDLAETR  60

Query  61   RVMQEELQKIKQNEEQLKQQLALMQQEIENVQTSVSIERKTKARRIND  108
            + MQ+EL KI+Q E ++++++A M+  ++  ++S +   K     ++D
Sbjct  61   QQMQKELAKIRQTEAEMRREMAEMRGSMQEFESSKNQHLKASRDLVDD  108


> A3M1X6 Sec-independent protein translocase protein TatB [Acinetobacter 
baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 
/ NCDC KC755 / 5377)]
Length=145

 Score = 80.1 bits (196),  Expect = 2e-22
 Identities = 49/125 (39%), Positives = 71/125 (57%), Gaps = 6/125 (5%)

Query  1    MFNISFGELLAFAIIALIILGPEKLPHTLRSVLLKYRAVKNQISKIQNDIENELDLIELK  60
            M ++   ELL FAIIA+++LGPEKLP   R     Y  +K  I+ +QN+I+ EL L E +
Sbjct  1    MLDVGMTELLCFAIIAILVLGPEKLPEAARFAGRWYVRLKRYITNLQNEIDQELRLSEFR  60

Query  61   RVMQEELQKIKQNEEQLKQQLALMQQEIENVQTSVSIERKTKARRINDYIY--TRSQDEL  118
            + MQEEL +I+  E +++QQL     EI+  Q S S+E    A+     I+  T      
Sbjct  61   KEMQEELNRIEALERKVQQQL----DEIQKQQVSESLEVTETAKTTQKPIWKCTPISGHY  116

Query  119  KTPFL  123
            K P+L
Sbjct  117  KVPYL  121


> Q6FER0 Sec-independent protein translocase protein TatB [Acinetobacter 
baylyi (strain ATCC 33305 / BD413 / ADP1)]
Length=152

 Score = 75.1 bits (183),  Expect = 2e-20
 Identities = 40/99 (40%), Positives = 60/99 (61%), Gaps = 4/99 (4%)

Query  1   MFNISFGELLAFAIIALIILGPEKLPHTLRSVLLKYRAVKNQISKIQNDIENELDLIELK  60
           M ++ FGEL  F IIAL++LGP+KLP   R     Y  +K  IS IQN+I+ EL+L E +
Sbjct  1   MLDVGFGELFCFGIIALLVLGPDKLPVAARFAGRWYARIKRYISNIQNEIDRELNLSEFR  60

Query  61  RVMQEELQKIKQNEEQLKQQLALMQQEIENVQTSVSIER  99
           + MQ+EL ++   E+ ++ +L    +EIE   T    E+
Sbjct  61  KEMQDELDRLHTLEQTMQARL----KEIEKASTEKIAEQ  95


> A5EVU3 Sec-independent protein translocase protein TatB [Dichelobacter 
nodosus (strain VCS1703A)]
Length=144

 Score = 68.6 bits (166),  Expect = 4e-18
 Identities = 31/81 (38%), Positives = 56/81 (69%), Gaps = 0/81 (0%)

Query  1   MFNISFGELLAFAIIALIILGPEKLPHTLRSVLLKYRAVKNQISKIQNDIENELDLIELK  60
           MF I F EL+  AII ++++GP++LP  +R++ L  R ++  IS ++ DIE ELDL E++
Sbjct  1   MFEIGFWELVLVAIIGIVVVGPKRLPEVVRTLGLLLRKMRRTISSVRADIERELDLEEMR  60

Query  61  RVMQEELQKIKQNEEQLKQQL  81
           ++M +  + +K++ +QL Q +
Sbjct  61  KLMSDVDEPLKKHVDQLNQSI  81


> Q9PFU4 Sec-independent protein translocase protein TatB [Xylella 
fastidiosa (strain 9a5c)]
Length=140

 Score = 67.8 bits (164),  Expect = 6e-18
 Identities = 39/107 (36%), Positives = 59/107 (55%), Gaps = 5/107 (5%)

Query  1    MFNISFGELLAFAIIALIILGPEKLPHTLRSVLLKYRAVKNQISKIQNDIENELDLIELK  60
            MF+I F ELL  A++AL++LGPE+LP   R   L  R  + Q   I+ ++E EL+   LK
Sbjct  1    MFDIGFSELLLIAVVALVVLGPERLPKAARFAGLLVRRARTQWESIKQELERELEAEALK  60

Query  61   RVMQEELQKIKQNEEQLKQQLALMQQEIENVQTSVSIERKTKARRIN  107
            R ++   Q I   + QL+       Q+  N+Q S+SI  +   R I+
Sbjct  61   RNLENAQQVIHDAQAQLQS-----NQQDMNIQNSISILHEQTKRDIH  102


> Q87B79 Sec-independent protein translocase protein TatB [Xylella 
fastidiosa (strain Temecula1 / ATCC 700964)]
Length=138

 Score = 67.4 bits (163),  Expect = 9e-18
 Identities = 40/107 (37%), Positives = 61/107 (57%), Gaps = 5/107 (5%)

Query  1    MFNISFGELLAFAIIALIILGPEKLPHTLRSVLLKYRAVKNQISKIQNDIENELDLIELK  60
            MF+I F ELL  A++AL++LGPE+LP   R   L  R  + Q   I+ ++E EL+   LK
Sbjct  1    MFDIGFSELLLIAVVALVVLGPERLPKAARFAGLLVRRARTQWESIKQELERELEAEALK  60

Query  61   RVMQEELQKIKQNEEQLKQQLALMQQEIENVQTSVSIERKTKARRIN  107
            R +Q   Q I   + QL+      QQ+++ +Q S+SI  +   R I+
Sbjct  61   RNLQNAQQVIHDAQAQLQSN----QQDMD-IQNSISILHEQTKRDIH  102


> Q8PEX3 Sec-independent protein translocase protein TatB [Xanthomonas 
axonopodis pv. citri (strain 306)]
Length=208

 Score = 66.2 bits (160),  Expect = 4e-17
 Identities = 33/96 (34%), Positives = 56/96 (58%), Gaps = 0/96 (0%)

Query  1   MFNISFGELLAFAIIALIILGPEKLPHTLRSVLLKYRAVKNQISKIQNDIENELDLIELK  60
           MF+I  GEL   A++AL++LGPE+LP   R   L  R  + Q   ++ ++E EL+  ELK
Sbjct  1   MFDIGVGELTLIAVVALVVLGPERLPKAARFAGLWVRRARMQWDSVKQELERELEAEELK  60

Query  61  RVMQEELQKIKQNEEQLKQQLALMQQEIENVQTSVS  96
           R +Q+    +++ E+QL+ +   ++Q    +   VS
Sbjct  61  RSLQDVQASLREAEDQLRNKQQQVEQGARALHDDVS  96


> Q3BMG2 Sec-independent protein translocase protein TatB [Xanthomonas 
campestris pv. vesicatoria (strain 85-10)]
Length=208

 Score = 66.2 bits (160),  Expect = 4e-17
 Identities = 33/96 (34%), Positives = 55/96 (57%), Gaps = 0/96 (0%)

Query  1   MFNISFGELLAFAIIALIILGPEKLPHTLRSVLLKYRAVKNQISKIQNDIENELDLIELK  60
           MF+I  GEL   A++AL++LGPE+LP   R   L  R  + Q   ++ ++E EL+  ELK
Sbjct  1   MFDIGVGELTLIAVVALVVLGPERLPKAARFAGLWVRRARMQWDSVKQELERELEAEELK  60

Query  61  RVMQEELQKIKQNEEQLKQQLALMQQEIENVQTSVS  96
           R +Q+    +++ E+QL+     ++Q    +   VS
Sbjct  61  RSLQDVQASLREAEDQLRNTQQQVEQGARTLHDDVS  96


> Q2NXS1 Sec-independent protein translocase protein TatB [Xanthomonas 
oryzae pv. oryzae (strain MAFF 311018)]
Length=211

 Score = 66.2 bits (160),  Expect = 4e-17
 Identities = 33/96 (34%), Positives = 56/96 (58%), Gaps = 0/96 (0%)

Query  1   MFNISFGELLAFAIIALIILGPEKLPHTLRSVLLKYRAVKNQISKIQNDIENELDLIELK  60
           MF+I  GEL   A++AL++LGPE+LP   R   L  R  + Q   ++ ++E EL+  ELK
Sbjct  1   MFDIGVGELTLIAVVALVVLGPERLPKAARFAGLWVRRARMQWDSVKQELERELEAEELK  60

Query  61  RVMQEELQKIKQNEEQLKQQLALMQQEIENVQTSVS  96
           R +Q+    +++ E+QL+ +   ++Q    +   VS
Sbjct  61  RSLQDVQASLREAEDQLRNKQQQVEQGARALHDDVS  96


> Q87TH0 Sec-independent protein translocase protein TatB [Vibrio 
parahaemolyticus serotype O3:K6 (strain RIMD 2210633)]
Length=132

 Score = 65.1 bits (157),  Expect = 5e-17
 Identities = 37/105 (35%), Positives = 62/105 (59%), Gaps = 5/105 (5%)

Query  1    MFNISFGELLAFAIIALIILGPEKLPHTLRSVLLKYRAVKNQISKIQNDIENELDLIELK  60
            MF+I F EL+  +++ L++LGPE+LPH +RSV     A KN  + +++++ +EL + EL 
Sbjct  1    MFDIGFWELVLISVVGLVVLGPERLPHAIRSVSRFIGAAKNMANSVKDELSHELKVQEL-  59

Query  61   RVMQEELQKIKQ-NEEQLKQQLALMQQEIENVQTSVSIERKTKAR  104
               QE L+K +Q   E L  +L    +E++    SV+     KA+
Sbjct  60   ---QENLRKAEQMGMEDLSPELKSSVEELKKAAQSVNRPYADKAQ  101


> P57063 Sec-independent protein translocase protein TatB [Vibrio 
cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)]
Length=133

 Score = 64.7 bits (156),  Expect = 7e-17
 Identities = 33/93 (35%), Positives = 60/93 (65%), Gaps = 1/93 (1%)

Query  1   MFNISFGELLAFAIIALIILGPEKLPHTLRSVLLKYRAVKNQISKIQNDIENELDLIELK  60
           MF+I F EL+  AI+AL++LGPE+LPH +RSV     A K+  + +++++ +EL + EL+
Sbjct  1   MFDIGFWELVLIAIVALVVLGPERLPHAIRSVAKFVSAAKSMANSVKDELAHELKVQELQ  60

Query  61  RVMQEELQKIKQN-EEQLKQQLALMQQEIENVQ  92
             +++  Q   QN   +L++ +  ++Q  + VQ
Sbjct  61  ENLRKAEQMGMQNLSPELQKSVESLKQAAQEVQ  93


> P69425 Sec-independent protein translocase protein TatB [Escherichia 
coli (strain K12)]
Length=171

 Score = 56.2 bits (134),  Expect = 9e-14
 Identities = 41/143 (29%), Positives = 74/143 (52%), Gaps = 12/143 (8%)

Query  1    MFNISFGELLAFAIIALIILGPEKLPHTLRSVLLKYRAVKNQISKIQNDIENELDLIELK  60
            MF+I F ELL   II L++LGP++LP  +++V    RA+++  + +QN++  EL L E  
Sbjct  1    MFDIGFSELLLVFIIGLVVLGPQRLPVAVKTVAGWIRALRSLATTVQNELTQELKLQE--  58

Query  61   RVMQEELQKIKQNE-----EQLKQQLALMQQEIENVQTSVSIERKTKARRINDYIYTRSQ  115
               Q+ L+K+++        +LK  +  ++Q  E+++ S       KA   +D  +T   
Sbjct  59   --FQDSLKKVEKASLTNLTPELKASMDELRQAAESMKRSYVANDPEKA---SDEAHTIHN  113

Query  116  DELKTPFLAHFKTANKFSEDQAA  138
              +K    AH       ++ QA+
Sbjct  114  PVVKDNEAAHEGVTPAAAQTQAS  136


> Q5NN67 Sec-independent protein translocase protein TatB [Zymomonas 
mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)]
Length=152

 Score = 38.5 bits (88),  Expect = 2e-07
 Identities = 23/83 (28%), Positives = 47/83 (57%), Gaps = 4/83 (5%)

Query  1   MFNISFGELLAFAIIALIILGPEKLPHTLRSV---LLKYRAVKNQISKIQNDIENELDLI  57
           MF+++  ELL  A++AL+++GP+ LP  +R V   L K R +        +++  + ++ 
Sbjct  1   MFDVAPSELLLVAVVALVVIGPKDLPRAMRVVGRWLGKARKLSRHFRSGIDEMIRQSEME  60

Query  58  EL-KRVMQEELQKIKQNEEQLKQ  79
           ++ KR  +E  + + +N+ Q  Q
Sbjct  61  DMEKRWAEENAKLLAENQGQGNQ  83


> P9WG99 Sec-independent protein translocase protein TatB [Mycobacterium 
tuberculosis (strain ATCC 25618 / H37Rv)]
Length=131

 Score = 38.1 bits (87),  Expect = 2e-07
 Identities = 23/73 (32%), Positives = 40/73 (55%), Gaps = 7/73 (10%)

Query  3   NISFGELLAFAIIALIILGPEKLPHTLRSVLLKYRAVKNQI----SKIQNDIENELDLIE  58
           NI + E+L   ++ L++LGPE+LP  +R      R  ++ +    S+++ DI  E D + 
Sbjct  4   NIGWWEMLVLVMVGLVVLGPERLPGAIRWAASALRQARDYLSGVTSQLREDIGPEFDDL-  62

Query  59  LKRVMQEELQKIK  71
             R    ELQK++
Sbjct  63  --RGHLGELQKLR  73


> Q9Z221 Polyamine-modulated factor 1-binding protein 1 [Rattus 
norvegicus]
Length=971

 Score = 39.3 bits (90),  Expect = 3e-07
 Identities = 27/102 (26%), Positives = 50/102 (49%), Gaps = 15/102 (15%)

Query  23   EKLPHTLRSVLLKYRAVKNQISKIQNDIENELDLIELKR-----------VMQEELQKIK  71
            ++L H  +    K R + N +SK+Q+++     L+E KR            ++EE++ ++
Sbjct  546  DELLHGAKVSEQKQRELTNSLSKLQDELAETKRLLEEKREQLRKSKDQEKALEEEIEALR  605

Query  72   QN----EEQLKQQLALMQQEIENVQTSVSIERKTKARRINDY  109
            Q     E+  K+QL  +++E EN+Q  +S         IN Y
Sbjct  606  QESKKKEKMAKEQLRKLEEEKENLQAELSSCSSQLDSSINKY  647


 Score = 30.4 bits (67),  Expect = 3e-04
 Identities = 22/100 (22%), Positives = 46/100 (46%), Gaps = 3/100 (3%)

Query  35   KYRAVKNQISKIQNDIENELDLIELKRVMQEELQKIKQNEEQLKQQLALMQQEIENVQTS  94
            K   + NQ+ + Q   +++L ++  K   + +L++ ++    LK+ L   ++E   + + 
Sbjct  778  KLEEMGNQVLQWQRQHQSDLKMLAAK---ETQLREFQEEMTALKENLLADEKEPSLMPSK  834

Query  95   VSIERKTKARRINDYIYTRSQDELKTPFLAHFKTANKFSE  134
             + +   +  R ND I    +   K   LA+ K  NK  E
Sbjct  835  PAPKENYRHHRENDQIMCNVEQWAKEQKLANEKLGNKLRE  874


 Score = 29.6 bits (65),  Expect = 5e-04
 Identities = 17/66 (26%), Positives = 33/66 (50%), Gaps = 12/66 (18%)

Query  23   EKLPHTLRSVLLKYRAVKNQISKIQNDIENELDLIELKRVMQEELQKIKQNEEQLKQQLA  82
            EKL  T + +    + V+   SKI N+             ++ E+QK+K++ E+ ++QL 
Sbjct  394  EKLQSTTKELDANLQEVRQSTSKIDNE------------GLRSEIQKLKESLEEAREQLR  441

Query  83   LMQQEI  88
            +  Q +
Sbjct  442  VSDQNL  447


 Score = 25.0 bits (53),  Expect = 0.018
 Identities = 14/69 (20%), Positives = 35/69 (51%), Gaps = 0/69 (0%)

Query  51   ENELDLIELKRVMQEELQKIKQNEEQLKQQLALMQQEIENVQTSVSIERKTKARRINDYI  110
            +N+++    K+    +LQ++K+    L+Q+L +  QE++    S+   +    ++ +D +
Sbjct  29   DNQVEFKSNKQYHLRQLQQLKKKLLTLQQELEIRTQELQASYRSLLQYQSILEKQTSDLL  88

Query  111  YTRSQDELK  119
                  +LK
Sbjct  89   VLHHHCKLK  97


 Score = 23.5 bits (49),  Expect = 0.057
 Identities = 16/71 (23%), Positives = 40/71 (56%), Gaps = 7/71 (10%)

Query  50   IENELDLIELKRVMQE---ELQKIKQNEEQLKQQLALMQQEIENVQTSVSIERKTKARRI  106
            +E E +L +L+   +E    LQ+++Q+  ++  +   ++ EI+ ++ S  +E   +  R+
Sbjct  387  LEKETELEKLQSTTKELDANLQEVRQSTSKIDNEG--LRSEIQKLKES--LEEAREQLRV  442

Query  107  NDYIYTRSQDE  117
            +D   ++ +DE
Sbjct  443  SDQNLSQCKDE  453


 Score = 23.1 bits (48),  Expect = 0.077
 Identities = 17/66 (26%), Positives = 34/66 (52%), Gaps = 7/66 (11%)

Query  45   KIQNDIENELDLIELKRVMQEELQKIK----QNEEQLK---QQLALMQQEIENVQTSVSI  97
            K++N +  +    ++ + +Q +LQK++    + EE+ K   QQL  +  E+   Q  +S 
Sbjct  467  KLENCLLQDKRKDDVIKDLQSQLQKLQKESSETEEERKNNRQQLLELSSELNEGQRRLSS  526

Query  98   ERKTKA  103
              K K+
Sbjct  527  AEKEKS  532


 Score = 22.7 bits (47),  Expect = 0.10
 Identities = 15/88 (17%), Positives = 39/88 (44%), Gaps = 4/88 (5%)

Query  35   KYRAVKNQISKIQNDIEN-ELDLIELKRVMQEELQKIKQNE---EQLKQQLALMQQEIEN  90
            K +  K Q+ K++ + EN + +L      +   + K   ++   ++L  ++A  +  I  
Sbjct  611  KEKMAKEQLRKLEEEKENLQAELSSCSSQLDSSINKYNNSQKVIQELNTEIARQKDSIMI  670

Query  91   VQTSVSIERKTKARRINDYIYTRSQDEL  118
            +QT +    + +     + +   + +EL
Sbjct  671  LQTQLDSAIQKEKNCFQNMVSKETYEEL  698


 Score = 20.8 bits (42),  Expect = 0.44
 Identities = 19/97 (20%), Positives = 47/97 (48%), Gaps = 12/97 (12%)

Query  29   LRSVLLKYRAVKNQISKIQNDIENELDLIELKRVMQEELQKIKQNEEQ---LKQQLALMQ  85
            L + LL+ +   + I  +Q+ ++      +L++   E  ++ K N +Q   L  +L   Q
Sbjct  468  LENCLLQDKRKDDVIKDLQSQLQ------KLQKESSETEEERKNNRQQLLELSSELNEGQ  521

Query  86   QEIENVQTSVSIERKT---KARRINDYIYTRSQDELK  119
            + + + +   S+ +KT   + ++I++ ++     E K
Sbjct  522  RRLSSAEKEKSLLQKTLDEEEKKIDELLHGAKVSEQK  558


 Score = 20.4 bits (41),  Expect = 0.58
 Identities = 25/112 (22%), Positives = 46/112 (41%), Gaps = 28/112 (25%)

Query  23   EKLPHTLRSVLLKYRAVKNQISKIQNDIEN-ELDL----------------------IEL  59
            E+  + ++ + L+  AV  Q  KI  D+   ELDL                        L
Sbjct  285  EEYQNLVKDLRLELEAVSEQKKKIMKDMMKLELDLHGLREETSCVIEKKDKETVFLQYRL  344

Query  60   KRVMQE--ELQKIKQNEEQLKQQLALMQQEIENVQTSVS---IERKTKARRI  106
            + + Q+  E QK+   +++L Q       E+E   T V    +E++T+  ++
Sbjct  345  QDLQQQYTESQKLSLKKDKLLQDKDERLNELEKKLTQVQCLFLEKETELEKL  396


 Score = 19.2 bits (38),  Expect = 1.4
 Identities = 9/60 (15%), Positives = 29/60 (48%), Gaps = 4/60 (7%)

Query  36   YRAVKNQISKIQNDIENELDLI----ELKRVMQEELQKIKQNEEQLKQQLALMQQEIENV  91
            Y  +  +    Q+D+   L+ +       + +Q  LQ+ ++ + QL+ ++   ++ ++ +
Sbjct  695  YEELLRKSGTCQDDLTQALEKLTQATSETKSLQRNLQQTQERKAQLEDEIMAYEERMKKL  754


 Score = 18.9 bits (37),  Expect = 1.8
 Identities = 19/108 (18%), Positives = 44/108 (41%), Gaps = 26/108 (24%)

Query  18   IILGPEKLPHTLRSVLLKYRAVKNQISKIQNDIENELDLIELKRVMQE------------  65
            ++L  E+    LR+    Y A          D E   D+ ++ + +QE            
Sbjct  231  LVLEREEALIKLRADFASYTATHRHPPTSSEDCE---DITKILKYLQEQKDSQCLHVEEY  287

Query  66   ---------ELQKIKQNEEQLKQQLALMQQEIENV--QTSVSIERKTK  102
                     EL+ + + ++++ + +  ++ ++  +  +TS  IE+K K
Sbjct  288  QNLVKDLRLELEAVSEQKKKIMKDMMKLELDLHGLREETSCVIEKKDK  335


 Score = 16.9 bits (32),  Expect = 7.8
 Identities = 17/59 (29%), Positives = 30/59 (51%), Gaps = 10/59 (17%)

Query  20   LGPEKLPHTLRSVLLKYRAVKNQISKIQNDIENELDLIELKRVMQEELQKIKQNEEQLK  78
            L  EKL + LR  + KY      I+K+  + ++   L  +   +Q+E +K+K   E+ K
Sbjct  863  LANEKLGNKLREQV-KY------IAKLTGEKDH---LHNVMAHLQQENKKLKNEIEEKK  911


> O42184 CAP-Gly domain-containing linker protein 1 [Gallus gallus]
Length=1433

 Score = 39.3 bits (90),  Expect = 3e-07
 Identities = 27/104 (26%), Positives = 53/104 (51%), Gaps = 17/104 (16%)

Query  43   ISKIQNDIENELDLIELK------------RVMQEELQKIKQNEEQLKQQLALMQQEIEN  90
            ++++++ +E EL L++ K            R MQE + K+ Q EE    Q ALM  E+E 
Sbjct  826  VNQVKDSLEKELQLLKEKFTSAVDGAENAQRAMQETINKLNQKEE----QFALMSSELEQ  881

Query  91   VQTSVSI-ERKTKARRINDYIYTRSQDELKTPFLAHFKTANKFS  133
            +++++++ E K K R   +   T ++ +L+       K++   S
Sbjct  882  LKSNLTVMETKLKEREEREQQLTEAKVKLENDIAEIMKSSGDSS  925


 Score = 31.2 bits (69),  Expect = 2e-04
 Identities = 18/87 (21%), Positives = 45/87 (52%), Gaps = 2/87 (2%)

Query  35   KYRAVKNQISKIQNDIENELDLIELKRVMQ--EELQKIKQNEEQLKQQLALMQQEIENVQ  92
            ++  +K Q+ K++ D ENE+  ++LK+  +  + L++I+  + +L +     +Q +EN++
Sbjct  645  EFAELKTQMEKVKLDYENEMSNLKLKQENEKSQHLKEIEALKAKLLEVTEEKEQTLENLK  704

Query  93   TSVSIERKTKARRINDYIYTRSQDELK  119
              +          + D +    + E+K
Sbjct  705  AKLESVEDQHLVEMEDTLNKLQEAEIK  731


 Score = 27.7 bits (60),  Expect = 0.002
 Identities = 22/72 (31%), Positives = 41/72 (57%), Gaps = 13/72 (18%)

Query  39    VKNQISKI-QNDIENELDLIELKRVMQ------EELQK----IKQNEEQLKQQLALMQQE  87
             ++N++  + QN+++NE +L + K ++       EEL+K    +K    Q  QQLA +Q+ 
Sbjct  1110  LQNELDMLKQNNLKNEEELTKSKELLNLENKKVEELKKEFEALKLAAAQKSQQLAALQE-  1168

Query  88    IENVQTSVSIER  99
              ENV+ +  + R
Sbjct  1169  -ENVKLAEELGR  1179


 Score = 26.6 bits (57),  Expect = 0.006
 Identities = 19/98 (19%), Positives = 47/98 (48%), Gaps = 20/98 (20%)

Query  42    QISKIQNDIENELDLIELKRVMQEELQKIKQNEEQLKQQL---------------ALMQQ  86
             ++ + ++++ +   L E + V+  +L ++K+ E  LK+++               AL+ Q
Sbjct  1176  ELGRSRDEVTSHQKLEEERSVLNNQLLEMKKRESTLKKEIDEERASLQKSISDTSALITQ  1235

Query  87    ---EIENVQTSVSIER--KTKARRINDYIYTRSQDELK  119
                E+E ++  +++ R     A+ +   + T   D+LK
Sbjct  1236  KDEELEKLRNEITVLRGENASAKTLQSVVKTLESDKLK  1273


 Score = 26.2 bits (56),  Expect = 0.008
 Identities = 16/75 (21%), Positives = 34/75 (45%), Gaps = 5/75 (7%)

Query  29    LRSVLLKYRAVKNQISKIQNDIEN-----ELDLIELKRVMQEELQKIKQNEEQLKQQLAL  83
             L  + L+      +  ++Q ++E      E    E  +  QEEL+K++     +K+Q+  
Sbjct  942   LEQIQLELTKANEKAVQLQKNVEQTAQKAEQSQQETLKTHQEELKKMQDQLTDMKKQMET  1001

Query  84    MQQEIENVQTSVSIE  98
              Q + +++Q     E
Sbjct  1002  SQNQYKDLQAKYEKE  1016


 Score = 25.8 bits (55),  Expect = 0.010
 Identities = 17/85 (20%), Positives = 46/85 (54%), Gaps = 4/85 (5%)

Query  37    RAVKNQISKIQNDIENELD-LIELKRVMQEELQKIKQNEEQLKQQLALMQQEIENVQTSV  95
             R  + Q+ +IQ ++    +  ++L++ +++  QK +Q++++    L   Q+E++ +Q  +
Sbjct  936   RLKERQLEQIQLELTKANEKAVQLQKNVEQTAQKAEQSQQET---LKTHQEELKKMQDQL  992

Query  96    SIERKTKARRINDYIYTRSQDELKT  120
             +  +K      N Y   +++ E +T
Sbjct  993   TDMKKQMETSQNQYKDLQAKYEKET  1017


 Score = 24.6 bits (52),  Expect = 0.024
 Identities = 19/99 (19%), Positives = 43/99 (43%), Gaps = 2/99 (2%)

Query  23    EKLPHTLRSVLLKYRAVKNQISKIQNDIENELDLIELKRVMQEELQKIKQNEEQLKQQLA  82
             E+L     ++ L       Q++ +Q +     + +   R      QK+++    L  QL 
Sbjct  1143  EELKKEFEALKLAAAQKSQQLAALQEENVKLAEELGRSRDEVTSHQKLEEERSVLNNQLL  1202

Query  83    LMQQEIENVQTSVSIERKTKARRIND--YIYTRSQDELK  119
              M++    ++  +  ER +  + I+D   + T+  +EL+
Sbjct  1203  EMKKRESTLKKEIDEERASLQKSISDTSALITQKDEELE  1241


 Score = 23.5 bits (49),  Expect = 0.058
 Identities = 20/81 (25%), Positives = 41/81 (51%), Gaps = 6/81 (7%)

Query  13   AIIALIILGPEKLPHTLRSVLLKYRAVKNQISKIQNDIENELDLIELKRVMQEELQKIKQ  72
            A+ A ++   E+   TL ++  K  +V++Q      D  N+L   E+K V + ++ + K 
Sbjct  684  ALKAKLLEVTEEKEQTLENLKAKLESVEDQHLVEMEDTLNKLQEAEIK-VKELDVLQAKC  742

Query  73   NEE-----QLKQQLALMQQEI  88
            NE+      L QQ+   ++++
Sbjct  743  NEQTKLIGSLTQQIRASEEKL  763


 Score = 23.5 bits (49),  Expect = 0.058
 Identities = 14/49 (29%), Positives = 28/49 (57%), Gaps = 4/49 (8%)

Query  45   KIQNDIENELDLIELKRVMQEELQKIKQNEEQLKQQLALMQQEIENVQT  93
            +I+   E  LDL  L++   E   +I    ++L +QL   +++I+N++T
Sbjct  755  QIRASEEKLLDLAALQKANSEGKLEI----QKLSEQLQAAEKQIQNLET  799


 Score = 23.5 bits (49),  Expect = 0.058
 Identities = 16/72 (22%), Positives = 34/72 (47%), Gaps = 4/72 (6%)

Query  37    RAVKNQISKIQNDI----ENELDLIELKRVMQEELQKIKQNEEQLKQQLALMQQEIENVQ  92
             +     I+K   DI    +N LD  E  +  Q++  +++   E+LK+Q    + +    +
Sbjct  1015  KETSEMITKHDADIKGFKQNLLDAEEALKAAQKKNDELETQAEELKKQAEQAKADKRAEE  1074

Query  93    TSVSIERKTKAR  104
                ++E+ TK +
Sbjct  1075  VLQTMEKVTKEK  1086


 Score = 22.3 bits (46),  Expect = 0.14
 Identities = 19/79 (24%), Positives = 36/79 (46%), Gaps = 5/79 (6%)

Query  45   KIQNDIENEL----DLIELKRVMQEELQKIKQNEEQLKQQLALMQQEIENVQTSVSIERK  100
            K++NDI   +    D       M +EL+  ++  EQ++ +L    ++   +Q +V  +  
Sbjct  909  KLENDIAEIMKSSGDSSAQLMKMNDELRLKERQLEQIQLELTKANEKAVQLQKNVE-QTA  967

Query  101  TKARRINDYIYTRSQDELK  119
             KA +         Q+ELK
Sbjct  968  QKAEQSQQETLKTHQEELK  986


 Score = 21.6 bits (44),  Expect = 0.25
 Identities = 18/77 (23%), Positives = 37/77 (48%), Gaps = 4/77 (5%)

Query  44   SKIQNDIENELDLIELKRVMQEELQKIKQNEEQLKQQLALMQQEIENVQTSVSIERKTKA  103
            +K+ +  +   D+IEL    + +L+    + +Q  ++L +   +    QT+   E KT+ 
Sbjct  597  TKLDHANKENSDVIEL---WKSKLESAIASHQQAMEELKVSFNKGVGAQTAEFAELKTQM  653

Query  104  RRIN-DYIYTRSQDELK  119
             ++  DY    S  +LK
Sbjct  654  EKVKLDYENEMSNLKLK  670


 Score = 20.8 bits (42),  Expect = 0.44
 Identities = 12/58 (21%), Positives = 34/58 (59%), Gaps = 3/58 (5%)

Query  44   SKIQNDIENELDLIELKRVMQEELQKIKQNEEQLKQQLALMQQEIENVQTSVSIERKT  101
            SK  +D++  L L++    +QE   K+    ++ +++++ ++++ E+ + ++  E KT
Sbjct  526  SKHIDDVDTSLSLLQEISSLQE---KMAAAGKEHQREMSSLKEKFESSEEALRKEIKT  580


 Score = 19.6 bits (39),  Expect = 1.1
 Identities = 10/33 (30%), Positives = 19/33 (58%), Gaps = 0/33 (0%)

Query  63   MQEELQKIKQNEEQLKQQLALMQQEIENVQTSV  95
            +QE L++ +Q+ EQL  +  L + E+    + V
Sbjct  354  LQEALKEKQQHIEQLLAERDLERAEVAKATSHV  386


 Score = 19.2 bits (38),  Expect = 1.4
 Identities = 18/91 (20%), Positives = 34/91 (37%), Gaps = 8/91 (9%)

Query  22   PEKLPHTLRSVLLKYRAVK--------NQISKIQNDIENELDLIELKRVMQEELQKIKQN  73
            P K   T+R V+    A+K        + +S + + + ++     L         +    
Sbjct  291  PAKAKTTVRKVVATPAALKRSPSASSLSSLSSVASSVSSKPSRTGLLTETSSRYARKISG  350

Query  74   EEQLKQQLALMQQEIENVQTSVSIERKTKAR  104
               L++ L   QQ IE +     +ER   A+
Sbjct  351  TTALQEALKEKQQHIEQLLAERDLERAEVAK  381


 Score = 18.5 bits (36),  Expect = 2.5
 Identities = 13/57 (23%), Positives = 30/57 (53%), Gaps = 4/57 (7%)

Query  50   IENELDLIELKRVMQ----EELQKIKQNEEQLKQQLALMQQEIENVQTSVSIERKTK  102
            +E E  + +L+ +++    E+++ + Q EE+ ++   L  +  E   T   +E +TK
Sbjct  405  LEMEAKMDQLRAMVEAADREKVELLNQLEEEKRKVEDLQFRVEEESITKGDLETQTK  461


> Q7Z3E2 Coiled-coil domain-containing protein 186 [Homo sapiens]
Length=898

 Score = 38.1 bits (87),  Expect = 6e-07
 Identities = 21/71 (30%), Positives = 42/71 (59%), Gaps = 3/71 (4%)

Query  33   LLKYRAVKNQISKIQNDIENELDLIELKRVMQEELQKIKQNEEQLKQQLALMQQEIENVQ  92
            L KY+ +   I++ + +I+N LD ++    +QE+LQ+ KQ  E LK+++  +   I ++Q
Sbjct  519  LSKYKEI---INRQKAEIQNLLDKVKTADQLQEQLQRGKQEIENLKEEVESLNSLINDLQ  575

Query  93   TSVSIERKTKA  103
              +   RK ++
Sbjct  576  KDIEGSRKRES  586


 Score = 31.6 bits (70),  Expect = 1e-04
 Identities = 18/68 (26%), Positives = 42/68 (62%), Gaps = 2/68 (3%)

Query  29   LRSVLLKYRAVKNQISKIQNDIENELDLIELKRV-MQEELQKIKQNEEQLKQQLALMQQE  87
            LR++  K + ++++  + ++++    ++I  ++  +Q  L K+K   +QL++QL   +QE
Sbjct  498  LRTLRTKVKCLEDERLRTEDELSKYKEIINRQKAEIQNLLDKVK-TADQLQEQLQRGKQE  556

Query  88   IENVQTSV  95
            IEN++  V
Sbjct  557  IENLKEEV  564


 Score = 26.6 bits (57),  Expect = 0.006
 Identities = 21/97 (22%), Positives = 40/97 (41%), Gaps = 2/97 (2%)

Query  39   VKNQISKIQNDIENELDLIELKRVMQEELQKIKQNEEQLKQQLALMQQEIENVQTSVSIE  98
            +K  I + +   E  +D+   K  ++EEL+K  + E+Q    +  ++  IE +   V   
Sbjct  209  IKKLIKENKKHQELFVDICSEKDNLREELKKRTETEKQHMNTIKQLESRIEELNKEVKAS  268

Query  99   RKTKARRINDYIYTRSQDELKTPFLAHFKTANKFSED  135
            R     +  D     +  +L        + ANK  E+
Sbjct  269  RDQLIAQ--DVTAKNAVQQLHKEMAQRMEQANKKCEE  303


 Score = 23.1 bits (48),  Expect = 0.076
 Identities = 13/77 (17%), Positives = 35/77 (45%), Gaps = 0/77 (0%)

Query  39   VKNQISKIQNDIENELDLIELKRVMQEELQKIKQNEEQLKQQLALMQQEIENVQTSVSIE  98
            ++ Q+ + + +IEN  + +E    +  +LQK  +   + + +L L  + + +    +  E
Sbjct  546  LQEQLQRGKQEIENLKEEVESLNSLINDLQKDIEGSRKRESELLLFTERLTSKNAQLQSE  605

Query  99   RKTKARRINDYIYTRSQ  115
              +   + +    + SQ
Sbjct  606  SNSLQSQFDKVSCSESQ  622


 Score = 22.7 bits (47),  Expect = 0.10
 Identities = 17/56 (30%), Positives = 28/56 (50%), Gaps = 2/56 (4%)

Query  48   NDIENELDLIELKRVMQEELQKIKQNEEQLKQQLALMQQEIEN-VQTSVSIERKTK  102
            N +  EL L E+ R +Q  L+        LK+ L  +  EIE  ++    +E++TK
Sbjct  842  NGLTLELSL-EINRKLQAVLEDTLLKNITLKENLQTLGTEIERLIKHQHELEQRTK  896


 Score = 19.6 bits (39),  Expect = 1.0
 Identities = 7/40 (18%), Positives = 25/40 (63%), Gaps = 0/40 (0%)

Query  56   LIELKRVMQEELQKIKQNEEQLKQQLALMQQEIENVQTSV  95
            ++ L++    + +KI+  E+ +KQ +  ++++ + +Q+ +
Sbjct  765  IVRLQKAHARKNEKIEFMEDHIKQLVEEIRKKTKIIQSYI  804


 Score = 19.2 bits (38),  Expect = 1.4
 Identities = 12/46 (26%), Positives = 22/46 (48%), Gaps = 3/46 (7%)

Query  24   KLPHTLRSVLLKYRAVKNQISKIQNDIENELDLIELKRVMQEELQK  69
            KL   L   LLK   +K  +  +  +IE    LI+ +  +++  +K
Sbjct  855  KLQAVLEDTLLKNITLKENLQTLGTEIER---LIKHQHELEQRTKK  897


 Score = 18.5 bits (36),  Expect = 2.5
 Identities = 18/70 (26%), Positives = 37/70 (53%), Gaps = 5/70 (7%)

Query  52   NELDLIELKRVMQEELQK-IKQNEEQLKQQLALMQQEIENVQTSVSIERKTKARRINDYI  110
            NELD     RV + EL+K +++  +QL+   A + +E+E+++ +   E   + R +   +
Sbjct  450  NELDA--KLRVTKGELEKQMQEKSDQLEMHHAKI-KELEDLKRTFK-EGMDELRTLRTKV  505

Query  111  YTRSQDELKT  120
                 + L+T
Sbjct  506  KCLEDERLRT  515


> O94804 Serine/threonine-protein kinase 10 [Homo sapiens]
Length=968

 Score = 38.1 bits (87),  Expect = 6e-07
 Identities = 30/103 (29%), Positives = 54/103 (52%), Gaps = 6/103 (6%)

Query  23   EKLPHTLRSVLLKYRAVKNQISKIQNDIEN--ELDLIEL-KRVMQEELQKIKQNEEQLKQ  79
            E++    R  L + R ++ +  + Q  + N  EL L ++ KR  QE   K K  + +L+ 
Sbjct  556  EEMRFLRRQELRELRLLQKEEHRNQTQLSNKHELQLEQMHKRFEQEINAKKKFFDTELEN  615

Query  80   QLALMQQEIENVQTSVSIERKTKARRIN---DYIYTRSQDELK  119
                 +Q++E ++   ++ R+ +ARRI    D  YTR Q++LK
Sbjct  616  LERQQKQQVEKMEQDHAVRRREEARRIRLEQDRDYTRFQEQLK  658


 Score = 25.8 bits (55),  Expect = 0.010
 Identities = 13/46 (28%), Positives = 26/46 (57%), Gaps = 2/46 (4%)

Query  36   YRAVKNQISKIQNDIENELDLIELKRVMQEELQKIKQNEEQLKQQL  81
            Y   + Q+  ++ +++NE++  +L R  ++E  K K  E   K+QL
Sbjct  650  YTRFQEQLKLMKKEVKNEVE--KLPRQQRKESMKQKMEEHTQKKQL  693


 Score = 25.0 bits (53),  Expect = 0.018
 Identities = 21/91 (23%), Positives = 45/91 (49%), Gaps = 5/91 (5%)

Query  37   RAVKNQISKIQNDIENELDLIELKRVMQEELQKIKQNEEQLKQQLALMQQEIENVQTSVS  96
            R  K Q+ K++ D        E +R+  E+ +   + +EQLK    LM++E++N    + 
Sbjct  618  RQQKQQVEKMEQD-HAVRRREEARRIRLEQDRDYTRFQEQLK----LMKKEVKNEVEKLP  672

Query  97   IERKTKARRINDYIYTRSQDELKTPFLAHFK  127
             +++ ++ +     +T+ +  L   F+A  K
Sbjct  673  RQQRKESMKQKMEEHTQKKQLLDRDFVAKQK  703


 Score = 22.3 bits (46),  Expect = 0.14
 Identities = 12/48 (25%), Positives = 29/48 (60%), Gaps = 0/48 (0%)

Query  40   KNQISKIQNDIENELDLIELKRVMQEELQKIKQNEEQLKQQLALMQQE  87
            ++Q+ K Q   +  L   EL R  ++E +++++  +++ +QL + QQ+
Sbjct  754  RHQLVKQQLKDQYFLQRHELLRKHEKEREQMQRYNQRMIEQLKVRQQQ  801


 Score = 19.6 bits (39),  Expect = 1.0
 Identities = 7/24 (29%), Positives = 16/24 (67%), Gaps = 0/24 (0%)

Query  64   QEELQKIKQNEEQLKQQLALMQQE  87
            +E++++  Q EE+ ++   L QQ+
Sbjct  837  REKIKQFSQQEEKRQKSERLQQQQ  860


> Q863A3 Myocilin [Macaca fascicularis]
Length=491

 Score = 37.4 bits (85),  Expect = 1e-06
 Identities = 21/87 (24%), Positives = 45/87 (52%), Gaps = 1/87 (1%)

Query  21   GPEKLPHTLRSVLLKYRAVKNQISKIQNDIENEL-DLIELKRVMQEELQKIKQNEEQLKQ  79
            GP++ P  L+  L   R  ++Q+     ++E    +L+  K V++EE ++++Q  E L +
Sbjct  96   GPQETPEGLQRELGTLRRERDQLETQTRELETAYSNLLRDKSVLEEEKKRLRQENENLAR  155

Query  80   QLALMQQEIENVQTSVSIERKTKARRI  106
            +L    QE+  ++     + +  AR +
Sbjct  156  RLESSSQEVARLRRGQCPQTRDTARDV  182


> O33600 DNA double-strand break repair Rad50 ATPase [Sulfolobus 
acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 
15157 / NCIMB 11770)]
Length=886

 Score = 37.4 bits (85),  Expect = 1e-06
 Identities = 18/81 (22%), Positives = 51/81 (63%), Gaps = 1/81 (1%)

Query  28   TLRSVLLKYRAVKNQISKIQNDIENELDLIELKRVMQEELQKIKQNEEQLKQQLALMQQE  87
            + +S+L++  ++K+QI+ ++ND++ + + ++ K+ + EE +K  +  E+ K++L   +++
Sbjct  296  SFKSILVQIDSLKSQINVVENDLKRKKEKLKRKKEL-EEKEKQYEEIEKRKKELEEKEKQ  354

Query  88   IENVQTSVSIERKTKARRIND  108
             E ++  ++   K   R+ N+
Sbjct  355  YEEIEKRLTYVLKNIERQKNE  375


 Score = 25.4 bits (54),  Expect = 0.013
 Identities = 19/80 (24%), Positives = 38/80 (48%), Gaps = 1/80 (1%)

Query  36   YRAVKNQISKIQNDIENELDLIELKRVMQEELQKIKQNEEQLKQQLALMQQEIENVQTSV  95
            Y   K +   +  D+++ + L E  R    EL+K+K   E+LK+++  M+   E  +  +
Sbjct  585  YNDYKAKYQFLPADLKSLVSLEERIRRRISELEKLKIEYERLKEEITRMKGLKEEYE-KL  643

Query  96   SIERKTKARRINDYIYTRSQ  115
              E      RI++  Y+  +
Sbjct  644  KEEEDALLNRISELGYSEKR  663


 Score = 25.0 bits (53),  Expect = 0.018
 Identities = 20/80 (25%), Positives = 40/80 (50%), Gaps = 3/80 (4%)

Query  33   LLKYRAVKNQISKIQNDIENELDL-IELKRVMQEELQKIKQNEEQLKQQLALMQ--QEIE  89
            L + + ++ + +K+QN+I + L    E + + ++E + I  +EE LK    L +  QE E
Sbjct  509  LKELQRLEEEKNKLQNEILSLLSYHQEFENIAEKEKELIDYHEEYLKNSDILEEDIQEQE  568

Query  90   NVQTSVSIERKTKARRINDY  109
                 ++ +     +  NDY
Sbjct  569  QRLNELNSKLSELEKSYNDY  588


 Score = 24.6 bits (52),  Expect = 0.024
 Identities = 23/85 (27%), Positives = 40/85 (47%), Gaps = 17/85 (20%)

Query  23   EKLPHTLRSVLLKYRAVKNQIS-----KIQNDIENELDLIELKRVMQEE---------LQ  68
            E++   L  +L    A K +I      KI+N  E E ++ EL+  M EE         LQ
Sbjct  668  EEIIDKLSKILSGIEADKGKIKGSLEEKIKNIEEKERNIEELRNKMNEESKLNLGISKLQ  727

Query  69   KIKQ---NEEQLKQQLALMQQEIEN  90
            K+++   N+      + +++ +IEN
Sbjct  728  KLREVLDNKHLQSHIMNIVRNQIEN  752


 Score = 24.3 bits (51),  Expect = 0.032
 Identities = 17/74 (23%), Positives = 44/74 (59%), Gaps = 6/74 (8%)

Query  42   QISKIQNDIENELDLIELKRVMQEELQKIKQNEEQLKQQLA---LMQQEIENVQTSV-SI  97
            +I+K++   E+   +  L +V+ + ++ ++  ++ LK++ A    +++EIE ++  + +I
Sbjct  156  KINKLEMLRESNGPIHSLIKVLTDRIRSLQSIKDILKREEAEIDRLKKEIEEIKVKLENI  215

Query  98   ERKTKAR--RINDY  109
            ER+ K +   +N Y
Sbjct  216  EREAKEKEDELNQY  229


 Score = 22.7 bits (47),  Expect = 0.10
 Identities = 19/81 (23%), Positives = 39/81 (48%), Gaps = 4/81 (5%)

Query  35   KYRAVKNQISKIQNDIEN-ELDLIELKRVMQEELQKIKQNEEQLKQQLALMQQEIENVQT  93
            +Y+ ++  I K+   +   E D  ++K  ++E   KIK  EE+ +    L  +  E  + 
Sbjct  663  RYKQLEEIIDKLSKILSGIEADKGKIKGSLEE---KIKNIEEKERNIEELRNKMNEESKL  719

Query  94   SVSIERKTKARRINDYIYTRS  114
            ++ I +  K R + D  + +S
Sbjct  720  NLGISKLQKLREVLDNKHLQS  740


 Score = 21.9 bits (45),  Expect = 0.18
 Identities = 11/66 (17%), Positives = 35/66 (53%), Gaps = 3/66 (5%)

Query  29   LRSVLLKYRAVKNQISKIQNDIENELDLIELKRVMQEELQKIKQNEEQLKQQLALM---Q  85
            + S++ +   ++   +K+Q +++       +     +ELQ++++ + +L+ ++  +    
Sbjct  474  INSLIKEREELEATRNKLQLELQKRSKEKGIYEAKLKELQRLEEEKNKLQNEILSLLSYH  533

Query  86   QEIENV  91
            QE EN+
Sbjct  534  QEFENI  539


 Score = 20.8 bits (42),  Expect = 0.43
 Identities = 14/66 (21%), Positives = 34/66 (52%), Gaps = 4/66 (6%)

Query  24   KLPHTLRSVLLKYRAVKNQISKIQNDIENELDLIELKRVMQEELQKIKQNEEQLKQQLAL  83
            KL + + S+L  ++  +N   K +  I+   + ++   +++E++Q+    +EQ   +L  
Sbjct  521  KLQNEILSLLSYHQEFENIAEKEKELIDYHEEYLKNSDILEEDIQE----QEQRLNELNS  576

Query  84   MQQEIE  89
               E+E
Sbjct  577  KLSELE  582


 Score = 18.1 bits (35),  Expect = 3.3
 Identities = 11/33 (33%), Positives = 18/33 (55%), Gaps = 4/33 (12%)

Query  39   VKNQISKIQNDIENELDL----IELKRVMQEEL  67
            V+NQI    N++  + DL    +E+  V + EL
Sbjct  746  VRNQIENNVNEVIAKFDLSFSAVEIDFVGKSEL  778


> Q8BL66 Early endosome antigen 1 [Mus musculus]
Length=1411

 Score = 37.4 bits (85),  Expect = 1e-06
 Identities = 20/76 (26%), Positives = 45/76 (59%), Gaps = 5/76 (7%)

Query  23   EKLPHTLRSVLLKYRAVKNQISKIQNDI-ENELDLIELKRVMQEELQKIKQNEEQLKQQL  81
            EK   T + + ++  +VK ++S+ QN + + E D    ++ +Q  + ++KQ+ EQ K+Q+
Sbjct  920  EKEKETSQQLKIELNSVKGEVSQAQNTLKQKEKD----EQQLQGTINQLKQSAEQKKKQI  975

Query  82   ALMQQEIENVQTSVSI  97
              +Q E++N  +  ++
Sbjct  976  EALQGEVKNAVSQKTV  991


 Score = 25.4 bits (54),  Expect = 0.014
 Identities = 19/75 (25%), Positives = 39/75 (52%), Gaps = 4/75 (5%)

Query  35   KYRAVKNQISKIQNDIENELDL-IELKRVMQEELQKIKQNEEQLKQQLALMQQEIENVQT  93
            K +A    + K   +++++L +  E     QE+L+K  + E++  QQL +   E+ +V+ 
Sbjct  882  KGKAAVLDLEKACKELKHQLQVQAESALKEQEDLKKSLEKEKETSQQLKI---ELNSVKG  938

Query  94   SVSIERKTKARRIND  108
             VS  + T  ++  D
Sbjct  939  EVSQAQNTLKQKEKD  953


 Score = 24.6 bits (52),  Expect = 0.024
 Identities = 11/52 (21%), Positives = 30/52 (58%), Gaps = 3/52 (6%)

Query  38   AVKNQISKIQNDIENELDLIELKRVMQEELQKIKQNEEQLKQQLALMQQEIE  89
            A ++ + + Q ++  +    E  + ++EEL++++   + LK ++  +QQ+ E
Sbjct  355  ASESSLQRAQGELSEKA---EAAQKLREELREVESTRQHLKVEVKQLQQQRE  403


 Score = 23.5 bits (49),  Expect = 0.058
 Identities = 17/68 (25%), Positives = 36/68 (53%), Gaps = 4/68 (6%)

Query  37    RAVKNQISKIQNDIENELDLIELKRVMQEELQKIKQNEEQ--LKQQLALMQQE--IENVQ  92
             ++V+ +++  Q D+ +  + I  +    +ELQ  K + EQ   K++  L +Q   +E+ Q
Sbjct  1050  KSVEEKLTLAQEDLISNRNQIGNQNKSIQELQAAKASLEQDSAKKEALLKEQSKALEDAQ  1109

Query  93    TSVSIERK  100
                S++ K
Sbjct  1110  REKSVKEK  1117


 Score = 23.1 bits (48),  Expect = 0.078
 Identities = 21/91 (23%), Positives = 42/91 (46%), Gaps = 21/91 (23%)

Query  35   KYRAVKNQISKIQNDIENELDLIELKRVMQEE-----------------LQKIKQNEEQL  77
            K +A+++   + Q   + EL   EL R +QE+                 L+ IKQ   + 
Sbjct  746  KEQALQSLQQQRQLSTDLELRNAELSRELQEQEEVVSCTKLDLQNKSEILENIKQTLTKK  805

Query  78   KQQLALMQQEIENVQTSVSIERKTKARRIND  108
            +++  +++QE E     +S + KT+ + + D
Sbjct  806  EEENVVLKQEFE----KLSQDSKTQHKELGD  832


 Score = 22.7 bits (47),  Expect = 0.10
 Identities = 22/87 (25%), Positives = 42/87 (48%), Gaps = 14/87 (16%)

Query  20   LGPEKLPHTLRSVL---LKYRAVKNQIS-KIQNDIENELDLIELKRVMQEE---------  66
            L  EKL    + V    LK   ++ Q+  K+ N  E +  L + K+  QE+         
Sbjct  443  LSSEKLMEKEQQVADLQLKLSRLEEQLKEKVTNSTELQHQLEKSKQQHQEQQALQQSATA  502

Query  67   -LQKIKQNEEQLKQQLALMQQEIENVQ  92
             L++ + + EQ+ +Q+    Q+I+N++
Sbjct  503  KLREAQNDLEQVLRQIGDKDQKIQNLE  529


 Score = 21.2 bits (43),  Expect = 0.33
 Identities = 16/77 (21%), Positives = 40/77 (52%), Gaps = 4/77 (5%)

Query  25    LPHTLRSVLLKYRAVKNQISKIQNDIENELDLIELKRVMQEELQKIKQNEEQLKQQLALM  84
             L   L +V  ++++ + ++S+++   +   DL     V++  +Q  +     L ++    
Sbjct  1246  LNENLGTVKKEWQSSQRRVSELEKQTD---DLRGEIAVLEATVQNNQDERRALLERCLKG  1302

Query  85    QQEIENVQT-SVSIERK  100
             + EIE +QT ++ ++RK
Sbjct  1303  EGEIEKLQTKALELQRK  1319


 Score = 20.8 bits (42),  Expect = 0.44
 Identities = 13/68 (19%), Positives = 34/68 (50%), Gaps = 14/68 (21%)

Query  40   KNQISKIQNDIENELDLIELKRVMQEELQKIKQNEEQLKQQ--------------LALMQ  85
            ++ I+ ++ ++++    ++ ++   EEL+K  +  + L+QQ              L  ++
Sbjct  82   RDDITLLRQEVQDLQASLKEEKWYSEELKKELEKYQGLQQQEAKSDGLVTDSSAELQALE  141

Query  86   QEIENVQT  93
            Q++E  QT
Sbjct  142  QQLEEAQT  149


 Score = 20.4 bits (41),  Expect = 0.59
 Identities = 16/59 (27%), Positives = 28/59 (47%), Gaps = 3/59 (5%)

Query  33   LLKYRAVKNQISKIQNDIENELDLIELK---RVMQEELQKIKQNEEQLKQQLALMQQEI  88
            +LK   V+ Q       +E E +  +LK   + +Q E   ++    QL+ +LA   QE+
Sbjct  225  VLKKELVQVQTLMDNMTLERERESEKLKDECKKLQSEHAHLEATINQLRSELAKGPQEV  283


 Score = 19.6 bits (39),  Expect = 1.1
 Identities = 11/39 (28%), Positives = 20/39 (51%), Gaps = 1/39 (3%)

Query  49   DIENELDLIE-LKRVMQEELQKIKQNEEQLKQQLALMQQ  86
            D++N LD  +   +  Q+EL K+    +QL  +    Q+
Sbjct  664  DLQNHLDTAQHALQDKQQELNKVSVQLDQLTAKFQEKQE  702


 Score = 18.5 bits (36),  Expect = 2.5
 Identities = 13/63 (21%), Positives = 28/63 (44%), Gaps = 0/63 (0%)

Query  39   VKNQISKIQNDIENELDLIELKRVMQEELQKIKQNEEQLKQQLALMQQEIENVQTSVSIE  98
            ++++++K   ++   +  I+  +    EL +  QN  +  Q+  L    +E      S  
Sbjct  272  LRSELAKGPQEVAVYVQEIQKLKGSINELTQKNQNLTEKLQKKDLDYTHLEEKHNEESAS  331

Query  99   RKT  101
            RKT
Sbjct  332  RKT  334


 Score = 18.5 bits (36),  Expect = 2.5
 Identities = 13/69 (19%), Positives = 28/69 (41%), Gaps = 0/69 (0%)

Query  40   KNQISKIQNDIENELDLIELKRVMQEELQKIKQNEEQLKQQLALMQQEIENVQTSVSIER  99
            + Q++ +Q  +    + ++ K     ELQ   +  +Q  Q+   +QQ           + 
Sbjct  452  EQQVADLQLKLSRLEEQLKEKVTNSTELQHQLEKSKQQHQEQQALQQSATAKLREAQNDL  511

Query  100  KTKARRIND  108
            +   R+I D
Sbjct  512  EQVLRQIGD  520


 Score = 18.1 bits (35),  Expect = 3.3
 Identities = 13/58 (22%), Positives = 30/58 (52%), Gaps = 6/58 (10%)

Query  62   VMQEELQKIKQNEEQLKQQLALMQQEIENVQTSVSIERKTKARRINDYIYTRSQDELK  119
            ++++E+Q ++ + ++ K     +++E+E  Q     E K      +D + T S  EL+
Sbjct  87   LLRQEVQDLQASLKEEKWYSEELKKELEKYQGLQQQEAK------SDGLVTDSSAELQ  138


 Score = 18.1 bits (35),  Expect = 3.3
 Identities = 12/50 (24%), Positives = 26/50 (52%), Gaps = 4/50 (8%)

Query  51    ENELDLIELKRVMQEELQKIKQNEEQLKQQLALMQQEIENVQTSVSIERK  100
             E E++ ++ K +   ELQ+   N     Q+L    Q ++ ++ + ++ RK
Sbjct  1303  EGEIEKLQTKAL---ELQRKLDNTTAAVQELGRENQSLQ-IKHTQALNRK  1348


 Score = 17.7 bits (34),  Expect = 4.4
 Identities = 8/36 (22%), Positives = 21/36 (58%), Gaps = 0/36 (0%)

Query  46    IQNDIENELDLIELKRVMQEELQKIKQNEEQLKQQL  81
             +QN+ +    L+E     + E++K++    +L+++L
Sbjct  1285  VQNNQDERRALLERCLKGEGEIEKLQTKALELQRKL  1320


 Score = 16.9 bits (32),  Expect = 7.8
 Identities = 6/26 (23%), Positives = 16/26 (62%), Gaps = 0/26 (0%)

Query  55    DLIELKRVMQEELQKIKQNEEQLKQQ  80
             ++ E+K   ++E+ K+ +  +  KQ+
Sbjct  1128  EMEEIKCRQEKEITKLNEELKSHKQE  1153



Lambda      K        H        a         alpha
   0.322    0.136    0.357    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 818425


  Database: cce0a5865e2e1bdb8b4a550ad3831be2.SwissProt.fasta
    Posted date:  Sep 26, 2020  7:20 PM
  Number of letters in database: 9,583
  Number of sequences in database:  22



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40