ACIAD1520 / TrEMBL Alignments

BLASTP 2.2.28+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: d5e03a5fc20475142762ea630f8ae70b.TrEMBL.fasta
           28 sequences; 6,968 total letters



Query= ACIAD1520

Length=249
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  Q6FC37 Sec-independent protein translocase protein TatC [Acinet...   488    5e-179
  A0A2M8MMK0 Sec-independent protein translocase protein TatC [Ac...   485    4e-178
  A0A1Y3F7M1 Sec-independent protein translocase protein TatC [Ac...   484    8e-178
  A0A0M3FGH7 Sec-independent protein translocase protein TatC [Ac...   484    1e-177
  A0A1V2UTC4 Sec-independent protein translocase protein TatC [Ac...   484    1e-177
  A0A0Q5GH48 Sec-independent protein translocase protein TatC [Ac...   484    2e-177
  A0A1H8MER7 Sec-independent protein translocase protein TatC [Ac...   484    2e-177
  A0A0A8XDE4 Sec-independent protein translocase protein TatC [Ac...   484    2e-177
  D8JK03 Sec-independent protein translocase protein TatC [Acinet...   483    2e-177
  A0A204EU83 Sec-independent protein translocase protein TatC [Ac...   483    2e-177
  A0A241YIR3 Sec-independent protein translocase protein TatC [Ac...   483    2e-177
  A0A0R0RRD3 Sec-independent protein translocase protein TatC [Ac...   483    3e-177
  N8QT44 Sec-independent protein translocase protein TatC [Acinet...   482    7e-177
  N9EKD9 Sec-independent protein translocase protein TatC [Acinet...   482    7e-177
  N9QIE2 Sec-independent protein translocase protein TatC [Acinet...   482    7e-177
  A0A009KKF5 Sec-independent protein translocase protein TatC [Ac...   482    9e-177
  R8YTI7 Sec-independent protein translocase protein TatC [Acinet...   482    9e-177
  I6MGV2 TatC [Moraxella catarrhalis]                                  229    1e-77 
  F1XD69 TatC [Moraxella catarrhalis O35E]                             229    1e-77 
  Q9AKS0 Sec-independent protein translocase protein TatC [Pseudo...   224    3e-75 
  D2JVH2 Sec-independent protein translocase protein TatC [Vibrio...   214    1e-71 
  A6N9K3 Sec-independent protein translocase protein TatC [Entero...   213    4e-71 
  A1YYZ9 Sec-independent protein translocase protein TatC [Xantho...   202    7e-67 
  Q9AED6 Sec-independent protein translocase protein TatC [Legion...   164    4e-52 
  Q0Q0I3 Sec-independent protein translocase protein TatC [Heliop...   137    6e-42 
  Q32Q93 Sec-independent protein translocase protein TatC [Mycoli...   120    8e-35 
  A1YH70 TatC [Providencia stuartii]                                   109    9e-33 
  Q9F2H3 Sec-independent protein translocase protein TatC [Strept...   105    2e-29 


> Q6FC37 Sec-independent protein translocase protein TatC [Acinetobacter 
baylyi (strain ATCC 33305 / BD413 / ADP1)]
Length=248

 Score =  488 bits (1255),  Expect = 5e-179
 Identities = 248/248 (100%), Positives = 248/248 (100%), Gaps = 0/248 (0%)

Query  1    MTEHIVSESLTEMKYSEHLKELRKRLIYSIGIVLAIFLLLLPLAQKNYHFLAHPLISLLP  60
            MTEHIVSESLTEMKYSEHLKELRKRLIYSIGIVLAIFLLLLPLAQKNYHFLAHPLISLLP
Sbjct  1    MTEHIVSESLTEMKYSEHLKELRKRLIYSIGIVLAIFLLLLPLAQKNYHFLAHPLISLLP  60

Query  61   SNSTMIATDVMSTFLAPFKLNIYFSILLSIPFILYQFWQFVAPALYQKEKRFGIALVISS  120
            SNSTMIATDVMSTFLAPFKLNIYFSILLSIPFILYQFWQFVAPALYQKEKRFGIALVISS
Sbjct  61   SNSTMIATDVMSTFLAPFKLNIYFSILLSIPFILYQFWQFVAPALYQKEKRFGIALVISS  120

Query  121  NLLFYLGIVFAYTLILPLALKFFVLASPDNVLPMTDINSYLDFCLKLFLAFGLAFQIPVL  180
            NLLFYLGIVFAYTLILPLALKFFVLASPDNVLPMTDINSYLDFCLKLFLAFGLAFQIPVL
Sbjct  121  NLLFYLGIVFAYTLILPLALKFFVLASPDNVLPMTDINSYLDFCLKLFLAFGLAFQIPVL  180

Query  181  TYILIFIGLISIQQLEAHRKHIIVFFFFIAMFITPPDVFSMLALAVPMWLLFELGLWVTK  240
            TYILIFIGLISIQQLEAHRKHIIVFFFFIAMFITPPDVFSMLALAVPMWLLFELGLWVTK
Sbjct  181  TYILIFIGLISIQQLEAHRKHIIVFFFFIAMFITPPDVFSMLALAVPMWLLFELGLWVTK  240

Query  241  FTTQKNIH  248
            FTTQKNIH
Sbjct  241  FTTQKNIH  248


> A0A2M8MMK0 Sec-independent protein translocase protein TatC [Acinetobacter 
seifertii]
Length=248

 Score =  485 bits (1249),  Expect = 4e-178
 Identities = 246/248 (99%), Positives = 248/248 (100%), Gaps = 0/248 (0%)

Query  1    MTEHIVSESLTEMKYSEHLKELRKRLIYSIGIVLAIFLLLLPLAQKNYHFLAHPLISLLP  60
            MTEHIVSESLTEMKYSEHLKELRKRLIYSIGIVLAIFLLLLPLAQKNYHFLAHPLISLLP
Sbjct  1    MTEHIVSESLTEMKYSEHLKELRKRLIYSIGIVLAIFLLLLPLAQKNYHFLAHPLISLLP  60

Query  61   SNSTMIATDVMSTFLAPFKLNIYFSILLSIPFILYQFWQFVAPALYQKEKRFGIALVISS  120
            SNSTMIATDVMSTFLAPFKLNIYF+ILLSIPFILYQFWQFVAPALYQKEKRFGI+LVISS
Sbjct  61   SNSTMIATDVMSTFLAPFKLNIYFAILLSIPFILYQFWQFVAPALYQKEKRFGISLVISS  120

Query  121  NLLFYLGIVFAYTLILPLALKFFVLASPDNVLPMTDINSYLDFCLKLFLAFGLAFQIPVL  180
            NLLFYLGIVFAYTLILPLALKFFVLASPDNVLPMTDINSYLDFCLKLFLAFGLAFQIPVL
Sbjct  121  NLLFYLGIVFAYTLILPLALKFFVLASPDNVLPMTDINSYLDFCLKLFLAFGLAFQIPVL  180

Query  181  TYILIFIGLISIQQLEAHRKHIIVFFFFIAMFITPPDVFSMLALAVPMWLLFELGLWVTK  240
            TYILIFIGLISIQQLEAHRKHIIVFFFFIAMFITPPDVFSMLALAVPMWLLFELGLWVTK
Sbjct  181  TYILIFIGLISIQQLEAHRKHIIVFFFFIAMFITPPDVFSMLALAVPMWLLFELGLWVTK  240

Query  241  FTTQKNIH  248
            FTTQKNIH
Sbjct  241  FTTQKNIH  248


> A0A1Y3F7M1 Sec-independent protein translocase protein TatC [Acinetobacter 
seifertii]
Length=248

 Score =  484 bits (1247),  Expect = 8e-178
 Identities = 246/248 (99%), Positives = 247/248 (99%), Gaps = 0/248 (0%)

Query  1    MTEHIVSESLTEMKYSEHLKELRKRLIYSIGIVLAIFLLLLPLAQKNYHFLAHPLISLLP  60
            MTEHIVSESLTEMKYSEHLKELRKRLIYSIGIVLAIFLLLLPLAQKNYHFLAHPLISLLP
Sbjct  1    MTEHIVSESLTEMKYSEHLKELRKRLIYSIGIVLAIFLLLLPLAQKNYHFLAHPLISLLP  60

Query  61   SNSTMIATDVMSTFLAPFKLNIYFSILLSIPFILYQFWQFVAPALYQKEKRFGIALVISS  120
             NSTMIATDVMSTFLAPFKLNIYF+ILLSIPFILYQFWQFVAPALYQKEKRFGIALVISS
Sbjct  61   RNSTMIATDVMSTFLAPFKLNIYFAILLSIPFILYQFWQFVAPALYQKEKRFGIALVISS  120

Query  121  NLLFYLGIVFAYTLILPLALKFFVLASPDNVLPMTDINSYLDFCLKLFLAFGLAFQIPVL  180
            NLLFYLGIVFAYTLILPLALKFFVLASPDNVLPMTDINSYLDFCLKLFLAFGLAFQIPVL
Sbjct  121  NLLFYLGIVFAYTLILPLALKFFVLASPDNVLPMTDINSYLDFCLKLFLAFGLAFQIPVL  180

Query  181  TYILIFIGLISIQQLEAHRKHIIVFFFFIAMFITPPDVFSMLALAVPMWLLFELGLWVTK  240
            TYILIFIGLISIQQLEAHRKHIIVFFFFIAMFITPPDVFSMLALAVPMWLLFELGLWVTK
Sbjct  181  TYILIFIGLISIQQLEAHRKHIIVFFFFIAMFITPPDVFSMLALAVPMWLLFELGLWVTK  240

Query  241  FTTQKNIH  248
            FTTQKNIH
Sbjct  241  FTTQKNIH  248


> A0A0M3FGH7 Sec-independent protein translocase protein TatC [Acinetobacter 
baumannii]
Length=248

 Score =  484 bits (1246),  Expect = 1e-177
 Identities = 244/248 (98%), Positives = 248/248 (100%), Gaps = 0/248 (0%)

Query  1    MTEHIVSESLTEMKYSEHLKELRKRLIYSIGIVLAIFLLLLPLAQKNYHFLAHPLISLLP  60
            MTEHIVSESLTEMKYSEHLKELRKRLIYSIGIVLAIFLLLLPLAQKNYHFLAHPLISLLP
Sbjct  1    MTEHIVSESLTEMKYSEHLKELRKRLIYSIGIVLAIFLLLLPLAQKNYHFLAHPLISLLP  60

Query  61   SNSTMIATDVMSTFLAPFKLNIYFSILLSIPFILYQFWQFVAPALYQKEKRFGIALVISS  120
            SNSTMIATDVMSTFLAPFKLNIYF+ILLSIPFILYQFWQFVAPALYQKEKRFGIAL++SS
Sbjct  61   SNSTMIATDVMSTFLAPFKLNIYFAILLSIPFILYQFWQFVAPALYQKEKRFGIALMLSS  120

Query  121  NLLFYLGIVFAYTLILPLALKFFVLASPDNVLPMTDINSYLDFCLKLFLAFGLAFQIPVL  180
            NLLFYLGIVFAYTLILPLALKFFVLASPDNVLPMTDINSYLDFCLKLFLAFGLAFQIPVL
Sbjct  121  NLLFYLGIVFAYTLILPLALKFFVLASPDNVLPMTDINSYLDFCLKLFLAFGLAFQIPVL  180

Query  181  TYILIFIGLISIQQLEAHRKHIIVFFFFIAMFITPPDVFSMLALAVPMWLLFELGLWVTK  240
            TYILIFIGLISIQQLEAHRKHIIVFFFFIAMFITPPDVFSMLALAVPMWLLFELGLW+TK
Sbjct  181  TYILIFIGLISIQQLEAHRKHIIVFFFFIAMFITPPDVFSMLALAVPMWLLFELGLWITK  240

Query  241  FTTQKNIH  248
            FTTQKNIH
Sbjct  241  FTTQKNIH  248


> A0A1V2UTC4 Sec-independent protein translocase protein TatC [Acinetobacter 
genomosp. 33YU]
Length=248

 Score =  484 bits (1246),  Expect = 1e-177
 Identities = 245/248 (99%), Positives = 247/248 (99%), Gaps = 0/248 (0%)

Query  1    MTEHIVSESLTEMKYSEHLKELRKRLIYSIGIVLAIFLLLLPLAQKNYHFLAHPLISLLP  60
            MTEHIVSESLTEMKYSEHLKELRKRLIYSIGIVLAIFLLLLPLAQKNYHFLAHPLISLLP
Sbjct  1    MTEHIVSESLTEMKYSEHLKELRKRLIYSIGIVLAIFLLLLPLAQKNYHFLAHPLISLLP  60

Query  61   SNSTMIATDVMSTFLAPFKLNIYFSILLSIPFILYQFWQFVAPALYQKEKRFGIALVISS  120
            SNSTMIATDVMSTFLAPFKLNIYF+ILLSIPFILYQFWQFVAPALYQKEKRFGIALV+SS
Sbjct  61   SNSTMIATDVMSTFLAPFKLNIYFAILLSIPFILYQFWQFVAPALYQKEKRFGIALVLSS  120

Query  121  NLLFYLGIVFAYTLILPLALKFFVLASPDNVLPMTDINSYLDFCLKLFLAFGLAFQIPVL  180
            N LFYLGIVFAYTLILPLALKFFVLASPDNVLPMTDINSYLDFCLKLFLAFGLAFQIPVL
Sbjct  121  NFLFYLGIVFAYTLILPLALKFFVLASPDNVLPMTDINSYLDFCLKLFLAFGLAFQIPVL  180

Query  181  TYILIFIGLISIQQLEAHRKHIIVFFFFIAMFITPPDVFSMLALAVPMWLLFELGLWVTK  240
            TYILIFIGLISIQQLEAHRKHIIVFFFFIAMFITPPDVFSMLALAVPMWLLFELGLWVTK
Sbjct  181  TYILIFIGLISIQQLEAHRKHIIVFFFFIAMFITPPDVFSMLALAVPMWLLFELGLWVTK  240

Query  241  FTTQKNIH  248
            FTTQKNIH
Sbjct  241  FTTQKNIH  248


> A0A0Q5GH48 Sec-independent protein translocase protein TatC [Acinetobacter 
sp. Leaf130]
Length=248

 Score =  484 bits (1245),  Expect = 2e-177
 Identities = 245/248 (99%), Positives = 247/248 (99%), Gaps = 0/248 (0%)

Query  1    MTEHIVSESLTEMKYSEHLKELRKRLIYSIGIVLAIFLLLLPLAQKNYHFLAHPLISLLP  60
            MTEHIVSESLTEMKYSEHLKELRKRLIYSIG VLAIFLLLLPLAQKNYHFLAHPLISLLP
Sbjct  1    MTEHIVSESLTEMKYSEHLKELRKRLIYSIGAVLAIFLLLLPLAQKNYHFLAHPLISLLP  60

Query  61   SNSTMIATDVMSTFLAPFKLNIYFSILLSIPFILYQFWQFVAPALYQKEKRFGIALVISS  120
            SNSTMIATDVMSTFLAPFKLNIYF+ILLSIPFILYQFWQFVAPALYQKEKRFGIALV+SS
Sbjct  61   SNSTMIATDVMSTFLAPFKLNIYFAILLSIPFILYQFWQFVAPALYQKEKRFGIALVLSS  120

Query  121  NLLFYLGIVFAYTLILPLALKFFVLASPDNVLPMTDINSYLDFCLKLFLAFGLAFQIPVL  180
            NLLFYLGIVFAYTLILPLALKFFVLASPDNVLPMTDINSYLDFCLKLFLAFGLAFQIPVL
Sbjct  121  NLLFYLGIVFAYTLILPLALKFFVLASPDNVLPMTDINSYLDFCLKLFLAFGLAFQIPVL  180

Query  181  TYILIFIGLISIQQLEAHRKHIIVFFFFIAMFITPPDVFSMLALAVPMWLLFELGLWVTK  240
            TYILIFIGLISIQQLEAHRKHIIVFFFFIAMFITPPDVFSMLALAVPMWLLFELGLWVTK
Sbjct  181  TYILIFIGLISIQQLEAHRKHIIVFFFFIAMFITPPDVFSMLALAVPMWLLFELGLWVTK  240

Query  241  FTTQKNIH  248
            FTTQKNIH
Sbjct  241  FTTQKNIH  248


> A0A1H8MER7 Sec-independent protein translocase protein TatC [Acinetobacter 
sp. yr461]
Length=248

 Score =  484 bits (1245),  Expect = 2e-177
 Identities = 245/248 (99%), Positives = 247/248 (99%), Gaps = 0/248 (0%)

Query  1    MTEHIVSESLTEMKYSEHLKELRKRLIYSIGIVLAIFLLLLPLAQKNYHFLAHPLISLLP  60
            MTEHIVSESLTEMKYSEHLKELRKRLIYSIG VLAIFLLLLPLAQKNYHFLAHPLISLLP
Sbjct  1    MTEHIVSESLTEMKYSEHLKELRKRLIYSIGAVLAIFLLLLPLAQKNYHFLAHPLISLLP  60

Query  61   SNSTMIATDVMSTFLAPFKLNIYFSILLSIPFILYQFWQFVAPALYQKEKRFGIALVISS  120
            SNSTMIATDVMSTFLAPFKLNIYF+ILLSIPFILYQFWQFVAPALYQKEKRFGIALV+SS
Sbjct  61   SNSTMIATDVMSTFLAPFKLNIYFAILLSIPFILYQFWQFVAPALYQKEKRFGIALVLSS  120

Query  121  NLLFYLGIVFAYTLILPLALKFFVLASPDNVLPMTDINSYLDFCLKLFLAFGLAFQIPVL  180
            NLLFYLGIVFAYTLILPLALKFFVLASPDNVLPMTDINSYLDFCLKLFLAFGLAFQIPVL
Sbjct  121  NLLFYLGIVFAYTLILPLALKFFVLASPDNVLPMTDINSYLDFCLKLFLAFGLAFQIPVL  180

Query  181  TYILIFIGLISIQQLEAHRKHIIVFFFFIAMFITPPDVFSMLALAVPMWLLFELGLWVTK  240
            TYILIFIGLISIQQLEAHRKHIIVFFFFIAMFITPPDVFSMLALAVPMWLLFELGLWVTK
Sbjct  181  TYILIFIGLISIQQLEAHRKHIIVFFFFIAMFITPPDVFSMLALAVPMWLLFELGLWVTK  240

Query  241  FTTQKNIH  248
            FTTQKNIH
Sbjct  241  FTTQKNIH  248


> A0A0A8XDE4 Sec-independent protein translocase protein TatC [Acinetobacter 
calcoaceticus]
Length=248

 Score =  484 bits (1245),  Expect = 2e-177
 Identities = 245/248 (99%), Positives = 247/248 (99%), Gaps = 0/248 (0%)

Query  1    MTEHIVSESLTEMKYSEHLKELRKRLIYSIGIVLAIFLLLLPLAQKNYHFLAHPLISLLP  60
            MTEHIVSESLTEMKYSEHLKELRKRLIYSIG VLAIFLLLLPLAQKNYHFLAHPLISLLP
Sbjct  1    MTEHIVSESLTEMKYSEHLKELRKRLIYSIGAVLAIFLLLLPLAQKNYHFLAHPLISLLP  60

Query  61   SNSTMIATDVMSTFLAPFKLNIYFSILLSIPFILYQFWQFVAPALYQKEKRFGIALVISS  120
            SNSTMIATDVMSTFLAPFKLNIYF+ILLSIPFILYQFWQFVAPALYQKEKRFGIALV+SS
Sbjct  61   SNSTMIATDVMSTFLAPFKLNIYFAILLSIPFILYQFWQFVAPALYQKEKRFGIALVLSS  120

Query  121  NLLFYLGIVFAYTLILPLALKFFVLASPDNVLPMTDINSYLDFCLKLFLAFGLAFQIPVL  180
            NLLFYLGIVFAYTLILPLALKFFVLASPDNVLPMTDINSYLDFCLKLFLAFGLAFQIPVL
Sbjct  121  NLLFYLGIVFAYTLILPLALKFFVLASPDNVLPMTDINSYLDFCLKLFLAFGLAFQIPVL  180

Query  181  TYILIFIGLISIQQLEAHRKHIIVFFFFIAMFITPPDVFSMLALAVPMWLLFELGLWVTK  240
            TYILIFIGLISIQQLEAHRKHIIVFFFFIAMFITPPDVFSMLALAVPMWLLFELGLWVTK
Sbjct  181  TYILIFIGLISIQQLEAHRKHIIVFFFFIAMFITPPDVFSMLALAVPMWLLFELGLWVTK  240

Query  241  FTTQKNIH  248
            FTTQKNIH
Sbjct  241  FTTQKNIH  248


> D8JK03 Sec-independent protein translocase protein TatC [Acinetobacter 
oleivorans (strain JCM 16667 / KCTC 23045 / DR1)]
Length=248

 Score =  483 bits (1244),  Expect = 2e-177
 Identities = 245/248 (99%), Positives = 247/248 (99%), Gaps = 0/248 (0%)

Query  1    MTEHIVSESLTEMKYSEHLKELRKRLIYSIGIVLAIFLLLLPLAQKNYHFLAHPLISLLP  60
            M EHIVSESLTEMKYSEHLKELRKRLIYSIGIVLAIFLLLLPLAQKNYHFLAHPLISLLP
Sbjct  1    MMEHIVSESLTEMKYSEHLKELRKRLIYSIGIVLAIFLLLLPLAQKNYHFLAHPLISLLP  60

Query  61   SNSTMIATDVMSTFLAPFKLNIYFSILLSIPFILYQFWQFVAPALYQKEKRFGIALVISS  120
            SNSTMIATDVMSTFLAPFKLNIYF+ILLSIPFILYQFWQFVAPALYQKEKRFGIALV+SS
Sbjct  61   SNSTMIATDVMSTFLAPFKLNIYFAILLSIPFILYQFWQFVAPALYQKEKRFGIALVLSS  120

Query  121  NLLFYLGIVFAYTLILPLALKFFVLASPDNVLPMTDINSYLDFCLKLFLAFGLAFQIPVL  180
            NLLFYLGIVFAYTLILPLALKFFVLASPDNVLPMTDINSYLDFCLKLFLAFGLAFQIPVL
Sbjct  121  NLLFYLGIVFAYTLILPLALKFFVLASPDNVLPMTDINSYLDFCLKLFLAFGLAFQIPVL  180

Query  181  TYILIFIGLISIQQLEAHRKHIIVFFFFIAMFITPPDVFSMLALAVPMWLLFELGLWVTK  240
            TYILIFIGLISIQQLEAHRKHIIVFFFFIAMFITPPDVFSMLALAVPMWLLFELGLWVTK
Sbjct  181  TYILIFIGLISIQQLEAHRKHIIVFFFFIAMFITPPDVFSMLALAVPMWLLFELGLWVTK  240

Query  241  FTTQKNIH  248
            FTTQKNIH
Sbjct  241  FTTQKNIH  248


> A0A204EU83 Sec-independent protein translocase protein TatC [Acinetobacter 
baumannii]
Length=248

 Score =  483 bits (1244),  Expect = 2e-177
 Identities = 245/248 (99%), Positives = 247/248 (99%), Gaps = 0/248 (0%)

Query  1    MTEHIVSESLTEMKYSEHLKELRKRLIYSIGIVLAIFLLLLPLAQKNYHFLAHPLISLLP  60
            MTEHIVSESLTEMKYSEHLKELRKRLIYSIGIVLAIFLLLLPLAQKNYHFLAHPLISLLP
Sbjct  1    MTEHIVSESLTEMKYSEHLKELRKRLIYSIGIVLAIFLLLLPLAQKNYHFLAHPLISLLP  60

Query  61   SNSTMIATDVMSTFLAPFKLNIYFSILLSIPFILYQFWQFVAPALYQKEKRFGIALVISS  120
            SNSTMIATDVMSTFLAPFKLNIYF+ILLSIPFILYQFWQFVAPALYQKEKRFGIALV+SS
Sbjct  61   SNSTMIATDVMSTFLAPFKLNIYFAILLSIPFILYQFWQFVAPALYQKEKRFGIALVLSS  120

Query  121  NLLFYLGIVFAYTLILPLALKFFVLASPDNVLPMTDINSYLDFCLKLFLAFGLAFQIPVL  180
            NLLFYLGIVFAYTLILPLALKFFVLASPDNVLPMTDINSYLDFCLKLFLAFGLAFQIPVL
Sbjct  121  NLLFYLGIVFAYTLILPLALKFFVLASPDNVLPMTDINSYLDFCLKLFLAFGLAFQIPVL  180

Query  181  TYILIFIGLISIQQLEAHRKHIIVFFFFIAMFITPPDVFSMLALAVPMWLLFELGLWVTK  240
            TYILIFIGLISIQQLEAHRKHIIVFFFFIAMFITPPDVFSMLALAVPMWLLFELGLWVTK
Sbjct  181  TYILIFIGLISIQQLEAHRKHIIVFFFFIAMFITPPDVFSMLALAVPMWLLFELGLWVTK  240

Query  241  FTTQKNIH  248
            FT QKNIH
Sbjct  241  FTMQKNIH  248


> A0A241YIR3 Sec-independent protein translocase protein TatC [Acinetobacter 
nosocomialis]
Length=248

 Score =  483 bits (1244),  Expect = 2e-177
 Identities = 245/248 (99%), Positives = 247/248 (99%), Gaps = 0/248 (0%)

Query  1    MTEHIVSESLTEMKYSEHLKELRKRLIYSIGIVLAIFLLLLPLAQKNYHFLAHPLISLLP  60
            MTEHIVSESLTEMKYSEHLKELRKRLIYSI IVLAIFLLLLPLAQKNYHFLAHPLISLLP
Sbjct  1    MTEHIVSESLTEMKYSEHLKELRKRLIYSISIVLAIFLLLLPLAQKNYHFLAHPLISLLP  60

Query  61   SNSTMIATDVMSTFLAPFKLNIYFSILLSIPFILYQFWQFVAPALYQKEKRFGIALVISS  120
            SNSTMIATDVMSTFLAPFKLNIYF+ILLSIPFILYQFWQFVAPALYQKEKRFGIALV+SS
Sbjct  61   SNSTMIATDVMSTFLAPFKLNIYFAILLSIPFILYQFWQFVAPALYQKEKRFGIALVLSS  120

Query  121  NLLFYLGIVFAYTLILPLALKFFVLASPDNVLPMTDINSYLDFCLKLFLAFGLAFQIPVL  180
            NLLFYLGIVFAYTLILPLALKFFVLASPDNVLPMTDINSYLDFCLKLFLAFGLAFQIPVL
Sbjct  121  NLLFYLGIVFAYTLILPLALKFFVLASPDNVLPMTDINSYLDFCLKLFLAFGLAFQIPVL  180

Query  181  TYILIFIGLISIQQLEAHRKHIIVFFFFIAMFITPPDVFSMLALAVPMWLLFELGLWVTK  240
            TYILIFIGLISIQQLEAHRKHIIVFFFFIAMFITPPDVFSMLALAVPMWLLFELGLWVTK
Sbjct  181  TYILIFIGLISIQQLEAHRKHIIVFFFFIAMFITPPDVFSMLALAVPMWLLFELGLWVTK  240

Query  241  FTTQKNIH  248
            FTTQKNIH
Sbjct  241  FTTQKNIH  248


> A0A0R0RRD3 Sec-independent protein translocase protein TatC [Acinetobacter 
pittii]
Length=248

 Score =  483 bits (1243),  Expect = 3e-177
 Identities = 244/248 (98%), Positives = 247/248 (99%), Gaps = 0/248 (0%)

Query  1    MTEHIVSESLTEMKYSEHLKELRKRLIYSIGIVLAIFLLLLPLAQKNYHFLAHPLISLLP  60
            MTEHIVSESLTEMKYSEHLKELRKRLIYSI IVLAIFLLLLPLAQKNYHFLAHPLISLLP
Sbjct  1    MTEHIVSESLTEMKYSEHLKELRKRLIYSISIVLAIFLLLLPLAQKNYHFLAHPLISLLP  60

Query  61   SNSTMIATDVMSTFLAPFKLNIYFSILLSIPFILYQFWQFVAPALYQKEKRFGIALVISS  120
            SNSTMIATDVMSTFLAPFKLNIYF+ILLSIPFILYQFWQFVAPALYQKEKRFGIALV+SS
Sbjct  61   SNSTMIATDVMSTFLAPFKLNIYFAILLSIPFILYQFWQFVAPALYQKEKRFGIALVLSS  120

Query  121  NLLFYLGIVFAYTLILPLALKFFVLASPDNVLPMTDINSYLDFCLKLFLAFGLAFQIPVL  180
            NLLFYLGIVFAYTLILPLALKFFVLASPDNVLPMTDINSYLDFCLKLFLAFGLAFQIPVL
Sbjct  121  NLLFYLGIVFAYTLILPLALKFFVLASPDNVLPMTDINSYLDFCLKLFLAFGLAFQIPVL  180

Query  181  TYILIFIGLISIQQLEAHRKHIIVFFFFIAMFITPPDVFSMLALAVPMWLLFELGLWVTK  240
            TYILIFIGLISIQQLEAHRKHIIVFFFFIAMFITPPDVFSMLALAVPMWLLFELGLW+TK
Sbjct  181  TYILIFIGLISIQQLEAHRKHIIVFFFFIAMFITPPDVFSMLALAVPMWLLFELGLWITK  240

Query  241  FTTQKNIH  248
            FTTQKNIH
Sbjct  241  FTTQKNIH  248


> N8QT44 Sec-independent protein translocase protein TatC [Acinetobacter 
seifertii]
Length=248

 Score =  482 bits (1241),  Expect = 7e-177
 Identities = 244/248 (98%), Positives = 246/248 (99%), Gaps = 0/248 (0%)

Query  1    MTEHIVSESLTEMKYSEHLKELRKRLIYSIGIVLAIFLLLLPLAQKNYHFLAHPLISLLP  60
            MTEHIV ESLTEMKYSEHLKELRKRLIYSIGIVLAIFLLLLPLAQKNYHFLAHPLISLLP
Sbjct  1    MTEHIVRESLTEMKYSEHLKELRKRLIYSIGIVLAIFLLLLPLAQKNYHFLAHPLISLLP  60

Query  61   SNSTMIATDVMSTFLAPFKLNIYFSILLSIPFILYQFWQFVAPALYQKEKRFGIALVISS  120
            SNSTMIATDVMSTFLAPFKLNIYF+ILLSIPFILYQFWQFVAPALYQKEKRFGIALV+SS
Sbjct  61   SNSTMIATDVMSTFLAPFKLNIYFAILLSIPFILYQFWQFVAPALYQKEKRFGIALVLSS  120

Query  121  NLLFYLGIVFAYTLILPLALKFFVLASPDNVLPMTDINSYLDFCLKLFLAFGLAFQIPVL  180
            NLLFYLGIVFAYTLILPLALKFFVLASPDNVLPMTDINSYLDFCLKLFLAFGL FQIPVL
Sbjct  121  NLLFYLGIVFAYTLILPLALKFFVLASPDNVLPMTDINSYLDFCLKLFLAFGLVFQIPVL  180

Query  181  TYILIFIGLISIQQLEAHRKHIIVFFFFIAMFITPPDVFSMLALAVPMWLLFELGLWVTK  240
            TYILIFIGLISIQQLEAHRKHIIVFFFFIAMFITPPDVFSMLALAVPMWLLFELGLWVTK
Sbjct  181  TYILIFIGLISIQQLEAHRKHIIVFFFFIAMFITPPDVFSMLALAVPMWLLFELGLWVTK  240

Query  241  FTTQKNIH  248
            FTTQKNIH
Sbjct  241  FTTQKNIH  248


> N9EKD9 Sec-independent protein translocase protein TatC [Acinetobacter 
calcoaceticus ANC 3680]
Length=248

 Score =  482 bits (1241),  Expect = 7e-177
 Identities = 244/248 (98%), Positives = 246/248 (99%), Gaps = 0/248 (0%)

Query  1    MTEHIVSESLTEMKYSEHLKELRKRLIYSIGIVLAIFLLLLPLAQKNYHFLAHPLISLLP  60
            MTEHIVSESLTEMKYSEHLKELRKRLIYSIG VLAIFLLLLPLAQKNYHFLAHPLISLLP
Sbjct  1    MTEHIVSESLTEMKYSEHLKELRKRLIYSIGAVLAIFLLLLPLAQKNYHFLAHPLISLLP  60

Query  61   SNSTMIATDVMSTFLAPFKLNIYFSILLSIPFILYQFWQFVAPALYQKEKRFGIALVISS  120
            SNSTMIATDVMSTFLAPFKLNIYF+ILLSIPFILYQFWQFVAPALYQKEKRFGIALV+SS
Sbjct  61   SNSTMIATDVMSTFLAPFKLNIYFAILLSIPFILYQFWQFVAPALYQKEKRFGIALVLSS  120

Query  121  NLLFYLGIVFAYTLILPLALKFFVLASPDNVLPMTDINSYLDFCLKLFLAFGLAFQIPVL  180
            NLLFYLGIVFAYTLILPLALKFFVLASPDNVLPMTDINSYLDFCLKLFLAFGLAFQIPV 
Sbjct  121  NLLFYLGIVFAYTLILPLALKFFVLASPDNVLPMTDINSYLDFCLKLFLAFGLAFQIPVF  180

Query  181  TYILIFIGLISIQQLEAHRKHIIVFFFFIAMFITPPDVFSMLALAVPMWLLFELGLWVTK  240
            TYILIFIGLISIQQLEAHRKHIIVFFFFIAMFITPPDVFSMLALAVPMWLLFELGLWVTK
Sbjct  181  TYILIFIGLISIQQLEAHRKHIIVFFFFIAMFITPPDVFSMLALAVPMWLLFELGLWVTK  240

Query  241  FTTQKNIH  248
            FTTQKNIH
Sbjct  241  FTTQKNIH  248


> N9QIE2 Sec-independent protein translocase protein TatC [Acinetobacter 
sp. NIPH 542]
Length=248

 Score =  482 bits (1241),  Expect = 7e-177
 Identities = 244/248 (98%), Positives = 246/248 (99%), Gaps = 0/248 (0%)

Query  1    MTEHIVSESLTEMKYSEHLKELRKRLIYSIGIVLAIFLLLLPLAQKNYHFLAHPLISLLP  60
            MTEHIVSESLTEMKYSEHLKELRKRLIYSI IVLAIFLLLLPLAQKNYHFLAHPLISLLP
Sbjct  1    MTEHIVSESLTEMKYSEHLKELRKRLIYSISIVLAIFLLLLPLAQKNYHFLAHPLISLLP  60

Query  61   SNSTMIATDVMSTFLAPFKLNIYFSILLSIPFILYQFWQFVAPALYQKEKRFGIALVISS  120
            SNSTMIATDVMSTFLAPFKLNIYF+ILLSIPFILYQFWQFVAPALYQKEKRFGIALV SS
Sbjct  61   SNSTMIATDVMSTFLAPFKLNIYFAILLSIPFILYQFWQFVAPALYQKEKRFGIALVFSS  120

Query  121  NLLFYLGIVFAYTLILPLALKFFVLASPDNVLPMTDINSYLDFCLKLFLAFGLAFQIPVL  180
            NLLFYLGIVFAYTLILPLALKFFVLASPDNVLPMTDINSYLDFCLKLFLAFGLAFQIPVL
Sbjct  121  NLLFYLGIVFAYTLILPLALKFFVLASPDNVLPMTDINSYLDFCLKLFLAFGLAFQIPVL  180

Query  181  TYILIFIGLISIQQLEAHRKHIIVFFFFIAMFITPPDVFSMLALAVPMWLLFELGLWVTK  240
            TYILIFIGLISIQQLEAHRKHIIVFFFFIAMFITPPDVFSMLALA+PMWLLFELGLWVTK
Sbjct  181  TYILIFIGLISIQQLEAHRKHIIVFFFFIAMFITPPDVFSMLALAIPMWLLFELGLWVTK  240

Query  241  FTTQKNIH  248
            FTTQKNIH
Sbjct  241  FTTQKNIH  248


> A0A009KKF5 Sec-independent protein translocase protein TatC [Acinetobacter 
baumannii 1419130]
Length=248

 Score =  482 bits (1240),  Expect = 9e-177
 Identities = 243/248 (98%), Positives = 248/248 (100%), Gaps = 0/248 (0%)

Query  1    MTEHIVSESLTEMKYSEHLKELRKRLIYSIGIVLAIFLLLLPLAQKNYHFLAHPLISLLP  60
            MTEHIVSESLTEMKYSEHLKELRKRLIYSIGIVLAIFLLLLPLAQKNYHFLA+PLISLLP
Sbjct  1    MTEHIVSESLTEMKYSEHLKELRKRLIYSIGIVLAIFLLLLPLAQKNYHFLAYPLISLLP  60

Query  61   SNSTMIATDVMSTFLAPFKLNIYFSILLSIPFILYQFWQFVAPALYQKEKRFGIALVISS  120
            SNSTMIATDVMSTFLAPFKLNIYF+ILLSIPFILYQFWQFVAPALYQKEKRFGIAL++SS
Sbjct  61   SNSTMIATDVMSTFLAPFKLNIYFAILLSIPFILYQFWQFVAPALYQKEKRFGIALMLSS  120

Query  121  NLLFYLGIVFAYTLILPLALKFFVLASPDNVLPMTDINSYLDFCLKLFLAFGLAFQIPVL  180
            NLLFYLGIVFAYTLILPLALKFFVLASPDNVLPMTDINSYLDFCLKLFLAFGLAFQIPVL
Sbjct  121  NLLFYLGIVFAYTLILPLALKFFVLASPDNVLPMTDINSYLDFCLKLFLAFGLAFQIPVL  180

Query  181  TYILIFIGLISIQQLEAHRKHIIVFFFFIAMFITPPDVFSMLALAVPMWLLFELGLWVTK  240
            TYILIFIGLISIQQLEAHRKHIIVFFFFIAMFITPPDVFSMLALAVPMWLLFELGLW+TK
Sbjct  181  TYILIFIGLISIQQLEAHRKHIIVFFFFIAMFITPPDVFSMLALAVPMWLLFELGLWITK  240

Query  241  FTTQKNIH  248
            FTTQKNIH
Sbjct  241  FTTQKNIH  248


> R8YTI7 Sec-independent protein translocase protein TatC [Acinetobacter 
lactucae]
Length=248

 Score =  482 bits (1240),  Expect = 9e-177
 Identities = 244/248 (98%), Positives = 246/248 (99%), Gaps = 0/248 (0%)

Query  1    MTEHIVSESLTEMKYSEHLKELRKRLIYSIGIVLAIFLLLLPLAQKNYHFLAHPLISLLP  60
            MTEHIVSESLTEMKYSEHLKELRKRLIYSIGIVLAIFLLLLPLAQKNYHFLAHPLISLLP
Sbjct  1    MTEHIVSESLTEMKYSEHLKELRKRLIYSIGIVLAIFLLLLPLAQKNYHFLAHPLISLLP  60

Query  61   SNSTMIATDVMSTFLAPFKLNIYFSILLSIPFILYQFWQFVAPALYQKEKRFGIALVISS  120
            SNSTMIATDVMSTFLAPFKLNIYF+ILLSIPFILYQFWQFVAPALYQKEKRF IALV+SS
Sbjct  61   SNSTMIATDVMSTFLAPFKLNIYFAILLSIPFILYQFWQFVAPALYQKEKRFSIALVLSS  120

Query  121  NLLFYLGIVFAYTLILPLALKFFVLASPDNVLPMTDINSYLDFCLKLFLAFGLAFQIPVL  180
            NLLFYLGIVFAYTLILPLALKFFVLASPDNVLPMTDINSYLDFCLKLFLAFGLAFQIPVL
Sbjct  121  NLLFYLGIVFAYTLILPLALKFFVLASPDNVLPMTDINSYLDFCLKLFLAFGLAFQIPVL  180

Query  181  TYILIFIGLISIQQLEAHRKHIIVFFFFIAMFITPPDVFSMLALAVPMWLLFELGLWVTK  240
            TYILIFIGLISIQQLE HRKHIIVFFFFIAMFITPPDVFSMLALAVPMWLLFELGLWVTK
Sbjct  181  TYILIFIGLISIQQLEVHRKHIIVFFFFIAMFITPPDVFSMLALAVPMWLLFELGLWVTK  240

Query  241  FTTQKNIH  248
            FTTQKNIH
Sbjct  241  FTTQKNIH  248


> I6MGV2 TatC [Moraxella catarrhalis]
Length=247

 Score =  229 bits (585),  Expect = 1e-77
 Identities = 116/229 (51%), Positives = 161/229 (70%), Gaps = 0/229 (0%)

Query  12   EMKYSEHLKELRKRLIYSIGIVLAIFLLLLPLAQKNYHFLAHPLISLLPSNSTMIATDVM  71
            ++    H  ELR R I     VL +FL L+  +++ Y  +++PL++LLP+ S++IATDV 
Sbjct  10   DVSLMSHFIELRGRFIRIFLAVLVVFLALVGFSRELYDLISNPLVALLPNESSLIATDVA  69

Query  72   STFLAPFKLNIYFSILLSIPFILYQFWQFVAPALYQKEKRFGIALVISSNLLFYLGIVFA  131
            S FLAP +L  + ++ +++PFIL Q W F++P LY  EKR  + L+ SS  LFYLG+ FA
Sbjct  70   SGFLAPIRLTFFTALFITVPFILMQIWGFISPGLYHHEKRTALPLLFSSIALFYLGVTFA  129

Query  132  YTLILPLALKFFVLASPDNVLPMTDINSYLDFCLKLFLAFGLAFQIPVLTYILIFIGLIS  191
            Y ++L  ALKFFV+ +PDNVLPMTDI+SYL+F +KL L FG+ F+IPV+T IL+ + L+S
Sbjct  130  YFIVLVPALKFFVVFAPDNVLPMTDIDSYLNFVIKLLLVFGVMFEIPVVTLILVLMRLVS  189

Query  192  IQQLEAHRKHIIVFFFFIAMFITPPDVFSMLALAVPMWLLFELGLWVTK  240
            I  L   R++IIV  F +A  ITPPD  SML LA+PM LLFELGL + K
Sbjct  190  IASLTNKRRYIIVGCFAVAAVITPPDGASMLMLAIPMCLLFELGLIMAK  238


 Score = 28.1 bits (61),  Expect = 0.003
 Identities = 30/130 (23%), Positives = 56/130 (43%), Gaps = 30/130 (23%)

Query  27   IYSIGIVLAIFLLLLPLAQKNYHFLAHPLISLLPSNSTMIATDVMSTFLAPFKLNIYFSI  86
            ++ +G+  A F++L+P  +    F+     ++LP       TD+ S      KL + F +
Sbjct  121  LFYLGVTFAYFIVLVPALK---FFVVFAPDNVLPM------TDIDSYLNFVIKLLLVFGV  171

Query  87   LLSIPFI--LYQFWQFVAPALYQKEKR------FGIALVISSN-------------LLFY  125
            +  IP +  +    + V+ A    ++R      F +A VI+               LLF 
Sbjct  172  MFEIPVVTLILVLMRLVSIASLTNKRRYIIVGCFAVAAVITPPDGASMLMLAIPMCLLFE  231

Query  126  LGIVFAYTLI  135
            LG++ A  L+
Sbjct  232  LGLIMAKLLV  241


> F1XD69 TatC [Moraxella catarrhalis O35E]
Length=247

 Score =  229 bits (585),  Expect = 1e-77
 Identities = 116/229 (51%), Positives = 161/229 (70%), Gaps = 0/229 (0%)

Query  12   EMKYSEHLKELRKRLIYSIGIVLAIFLLLLPLAQKNYHFLAHPLISLLPSNSTMIATDVM  71
            ++    H  ELR R I     VL +FL L+  +++ Y  +++PL++LLP+ S++IATDV 
Sbjct  10   DVSLMSHFIELRGRFIRIFLAVLVVFLALVGFSRELYDLISNPLVALLPNESSLIATDVA  69

Query  72   STFLAPFKLNIYFSILLSIPFILYQFWQFVAPALYQKEKRFGIALVISSNLLFYLGIVFA  131
            S FLAP +L  + ++ +++PFIL Q W F++P LY  EKR  + L+ SS  LFYLG+ FA
Sbjct  70   SGFLAPIRLTFFTALFITVPFILMQIWGFISPGLYHHEKRTALPLLFSSIALFYLGVTFA  129

Query  132  YTLILPLALKFFVLASPDNVLPMTDINSYLDFCLKLFLAFGLAFQIPVLTYILIFIGLIS  191
            Y ++L  ALKFFV+ +PDNVLPMTDI+SYL+F +KL L FG+ F+IPV+T IL+ + L+S
Sbjct  130  YFIVLVPALKFFVVFAPDNVLPMTDIDSYLNFVIKLLLVFGVMFEIPVVTLILVLMRLVS  189

Query  192  IQQLEAHRKHIIVFFFFIAMFITPPDVFSMLALAVPMWLLFELGLWVTK  240
            I  L   R++IIV  F +A  ITPPD  SML LA+PM LLFELGL + K
Sbjct  190  IASLTNKRRYIIVGCFAVAAVITPPDGASMLMLAIPMCLLFELGLIMAK  238


 Score = 28.1 bits (61),  Expect = 0.003
 Identities = 30/130 (23%), Positives = 56/130 (43%), Gaps = 30/130 (23%)

Query  27   IYSIGIVLAIFLLLLPLAQKNYHFLAHPLISLLPSNSTMIATDVMSTFLAPFKLNIYFSI  86
            ++ +G+  A F++L+P  +    F+     ++LP       TD+ S      KL + F +
Sbjct  121  LFYLGVTFAYFIVLVPALK---FFVVFAPDNVLPM------TDIDSYLNFVIKLLLVFGV  171

Query  87   LLSIPFI--LYQFWQFVAPALYQKEKR------FGIALVISSN-------------LLFY  125
            +  IP +  +    + V+ A    ++R      F +A VI+               LLF 
Sbjct  172  MFEIPVVTLILVLMRLVSIASLTNKRRYIIVGCFAVAAVITPPDGASMLMLAIPMCLLFE  231

Query  126  LGIVFAYTLI  135
            LG++ A  L+
Sbjct  232  LGLIMAKLLV  241


> Q9AKS0 Sec-independent protein translocase protein TatC [Pseudomonas 
stutzeri]
Length=267

 Score =  224 bits (571),  Expect = 3e-75
 Identities = 110/237 (46%), Positives = 154/237 (65%), Gaps = 0/237 (0%)

Query  12   EMKYSEHLKELRKRLIYSIGIVLAIFLLLLPLAQKNYHFLAHPLISLLPSNSTMIATDVM  71
            EM    HL ELRKRL++ +  +  +F  L   +Q+ Y  +A PL + LP  +TMIAT V 
Sbjct  10   EMPLVAHLTELRKRLLHCVVAIGLLFAGLFYFSQQIYALVAAPLRAYLPEGATMIATGVA  69

Query  72   STFLAPFKLNIYFSILLSIPFILYQFWQFVAPALYQKEKRFGIALVISSNLLFYLGIVFA  131
            S FL PFKL +  ++ LS+P IL+Q W F+AP LY+ EKR  + L++SS  LFY G+ FA
Sbjct  70   SPFLTPFKLTLMVALFLSMPVILHQIWGFIAPGLYKHEKRIAVPLLVSSIFLFYAGMAFA  129

Query  132  YTLILPLALKFFVLASPDNVLPMTDINSYLDFCLKLFLAFGLAFQIPVLTYILIFIGLIS  191
            Y ++ P+   FF   +P+ V  MTDI  YLDF L LF AFG+AF+IPV T++LI++G++ 
Sbjct  130  YFVVFPIMFGFFASVTPEGVAMMTDIGQYLDFVLTLFFAFGVAFEIPVATFLLIWVGIVD  189

Query  192  IQQLEAHRKHIIVFFFFIAMFITPPDVFSMLALAVPMWLLFELGLWVTKFTTQKNIH  248
            +  L   R ++IV  F + M +TPPDVFS   LAVPMWLLFE G+   +   +++ H
Sbjct  190  VATLRKSRPYVIVGCFAVGMVLTPPDVFSQALLAVPMWLLFEAGVICGRLIKKRDEH  246


> D2JVH2 Sec-independent protein translocase protein TatC [Vibrio 
alginolyticus]
Length=250

 Score =  214 bits (546),  Expect = 1e-71
 Identities = 108/229 (47%), Positives = 150/229 (66%), Gaps = 0/229 (0%)

Query  18   HLKELRKRLIYSIGIVLAIFLLLLPLAQKNYHFLAHPLISLLPSNSTMIATDVMSTFLAP  77
            HL ELR RL+ SI  VL +F+ L+  +   Y F++ PL+  LP  +TMIATDV S F  P
Sbjct  13   HLLELRNRLLRSILAVLVVFVGLIYFSNHIYEFVSAPLVERLPEGATMIATDVASPFFTP  72

Query  78   FKLNIYFSILLSIPFILYQFWQFVAPALYQKEKRFGIALVISSNLLFYLGIVFAYTLILP  137
             KL +  S+ +++PFILYQ W FVAP LY+ E+R  + L+ SS+LLFY G+ FAY ++ P
Sbjct  73   LKLTLIASVFIAVPFILYQVWAFVAPGLYKHERRLIMPLLFSSSLLFYCGVAFAYFVVFP  132

Query  138  LALKFFVLASPDNVLPMTDINSYLDFCLKLFLAFGLAFQIPVLTYILIFIGLISIQQLEA  197
            L   FF   S   V   TDI+SYLDF L LF+AFG+AF++PV   +L + G  + + L  
Sbjct  133  LVFGFFTAISLGGVEFATDISSYLDFVLALFMAFGIAFEVPVAIILLCWTGATTPEDLRQ  192

Query  198  HRKHIIVFFFFIAMFITPPDVFSMLALAVPMWLLFELGLWVTKFTTQKN  246
             R +IIV  F + M +TPPD+ S   LA+PM LLFE+GL+  +F T+++
Sbjct  193  KRPYIIVAAFVVGMVLTPPDMISQTLLAIPMCLLFEVGLFFARFYTRRS  241


> A6N9K3 Sec-independent protein translocase protein TatC [Enterobacter 
cloacae]
Length=256

 Score =  213 bits (543),  Expect = 4e-71
 Identities = 106/228 (46%), Positives = 150/228 (66%), Gaps = 0/228 (0%)

Query  18   HLKELRKRLIYSIGIVLAIFLLLLPLAQKNYHFLAHPLISLLPSNSTMIATDVMSTFLAP  77
            HL ELRKRL+  I  V  IFL L+  A   Y  ++ PLI  +P  +TMIATDV S F  P
Sbjct  12   HLIELRKRLLNCIIAVFVIFLCLVYFANDIYQVVSAPLIKQMPLGATMIATDVASPFFTP  71

Query  78   FKLNIYFSILLSIPFILYQFWQFVAPALYQKEKRFGIALVISSNLLFYLGIVFAYTLILP  137
             KL  + S++ S P +LYQ W FVAPALY+ E++  I L++SS+LLFY+G+ FAY ++ P
Sbjct  72   IKLTFWVSLIASAPILLYQIWAFVAPALYKHERKLVIPLLVSSSLLFYIGMAFAYFVVFP  131

Query  138  LALKFFVLASPDNVLPMTDINSYLDFCLKLFLAFGLAFQIPVLTYILIFIGLISIQQLEA  197
            LA  F    +P+ V   TDI SYL F + LF+AFG+AF++PV   +L ++G+ + + L  
Sbjct  132  LAFGFLTHTAPEGVQVSTDIASYLSFVMALFMAFGVAFEVPVAIVLLCWVGVTTPEDLRK  191

Query  198  HRKHIIVFFFFIAMFITPPDVFSMLALAVPMWLLFELGLWVTKFTTQK  245
             R +I+V  F + M +TPPDVFS   LA+PM+ LFE+G++ ++F   K
Sbjct  192  KRPYILVGAFVVGMLLTPPDVFSQTLLAIPMYCLFEVGVFFSRFYVGK  239


> A1YYZ9 Sec-independent protein translocase protein TatC [Xanthomonas 
oryzae pv. oryzae]
Length=251

 Score =  202 bits (514),  Expect = 7e-67
 Identities = 103/242 (43%), Positives = 146/242 (60%), Gaps = 0/242 (0%)

Query  5    IVSESLTEMKYSEHLKELRKRLIYSIGIVLAIFLLLLPLAQKNYHFLAHPLISLLPSNST  64
            +  ++  E    EHL ELR RL+ ++  +  + L LLP ++  Y +LA PLIS LP   T
Sbjct  3    LFDDAQAESSLIEHLVELRARLVRALIGLGVVLLTLLPFSRAIYSWLAAPLISQLPLGQT  62

Query  65   MIATDVMSTFLAPFKLNIYFSILLSIPFILYQFWQFVAPALYQKEKRFGIALVISSNLLF  124
            MIA +    F AP KL  + ++  S+P++LYQ W FVAP LYQ+EK+    L+ S+  LF
Sbjct  63   MIAMNPAGAFFAPLKLTFFVAVFFSVPWLLYQAWAFVAPGLYQREKKLAFPLLASAVALF  122

Query  125  YLGIVFAYTLILPLALKFFVLASPDNVLPMTDINSYLDFCLKLFLAFGLAFQIPVLTYIL  184
            Y+G  FAY L+LP    F     PD +    D NSYLDF L +F AFG +F++PV   IL
Sbjct  123  YIGCAFAYFLVLPAVFHFLTTFKPDVIAITPDANSYLDFVLAIFFAFGASFELPVALVIL  182

Query  185  IFIGLISIQQLEAHRKHIIVFFFFIAMFITPPDVFSMLALAVPMWLLFELGLWVTKFTTQ  244
            + +G ++ +QL   R + IV  F +A  +TPPDV S L LA+PM LL+ELG+  ++    
Sbjct  183  VLLGWVTPKQLSEGRGYAIVGIFILAAVLTPPDVVSQLMLALPMCLLYELGIMASRAVAP  242

Query  245  KN  246
            K+
Sbjct  243  KD  244


> Q9AED6 Sec-independent protein translocase protein TatC [Legionella 
pneumophila]
Length=238

 Score =  164 bits (414),  Expect = 4e-52
 Identities = 84/219 (38%), Positives = 132/219 (60%), Gaps = 0/219 (0%)

Query  18   HLKELRKRLIYSIGIVLAIFLLLLPLAQKNYHFLAHPLISLLPSNSTMIATDVMSTFLAP  77
            HL ELR+R IY++    A+ LL   ++ + +H L  PL+  LP+   +IAT + S+   P
Sbjct  4    HLIELRQRAIYTLLWFGALALLFFFISDQLFHLLVKPLLRSLPNQEGLIATQITSSVFTP  63

Query  78   FKLNIYFSILLSIPFILYQFWQFVAPALYQKEKRFGIALVISSNLLFYLGIVFAYTLILP  137
             KL +  ++LL+ PF L Q W+F+ P LY+ E+      +I S LLF  G +F + L+LP
Sbjct  64   LKLAVDTALLLTAPFALLQLWRFMRPGLYKNEQEQIRGTIILSLLLFVFGALFCFYLVLP  123

Query  138  LALKFFVLASPDNVLPMTDINSYLDFCLKLFLAFGLAFQIPVLTYILIFIGLISIQQLEA  197
               +FF  A P+ V  M D+   +DF  ++ L FG +FQ+P++  +L+     +++ L  
Sbjct  124  YMFQFFAQALPEGVRLMPDMAYAIDFITRMLLLFGFSFQVPLICLVLVKTHFTTVETLIK  183

Query  198  HRKHIIVFFFFIAMFITPPDVFSMLALAVPMWLLFELGL  236
             R ++IV  F I M +TPPDVFS +ALA+P+ LL+E G+
Sbjct  184  IRPYVIVGAFIIGMLLTPPDVFSQVALALPLCLLYEAGI  222


 Score = 17.3 bits (33),  Expect = 7.8
 Identities = 6/10 (60%), Positives = 8/10 (80%), Gaps = 0/10 (0%)

Query  26   LIYSIGIVLA  35
            L+Y  GI+LA
Sbjct  216  LLYEAGIILA  225


> Q0Q0I3 Sec-independent protein translocase protein TatC [Heliophilum 
fasciatum]
Length=256

 Score =  137 bits (346),  Expect = 6e-42
 Identities = 81/239 (34%), Positives = 131/239 (55%), Gaps = 16/239 (7%)

Query  13   MKYSEHLKELRKRLIYSIGIVLAIFLLLLPLAQKNYH-----FLAHPLISLLPSNSTMIA  67
            M   +HL+ELR  LI+S+     + LLL  ++  N+H      L  PL  L      + A
Sbjct  19   MPLMDHLEELRSVLIFSL-----VALLLGAISAYNFHQELIALLIRPLTELEIKPVIVRA  73

Query  68   TDVMSTFLAPFKLNIYFSILLSIPFILYQFWQFVAPALYQKEKRFGIALVISSNLLFYLG  127
            T+    F A  K++ +  ++++ P IL++ W F+ PALY  E+R+       S LLF  G
Sbjct  74   TE---GFFAALKVSAFAGLVIASPAILWKIWSFIVPALYSHERRYVYIFFPFSVLLFLSG  130

Query  128  IVFAYTLILPLALKFFVLASPDNVLPMTDINSYLDFCLKLFLAFGLAFQIPVLTYILIFI  187
            + F+Y  + PL +KF +     +  PM  I+ +L F L   L FG+ FQ+PV+   L  +
Sbjct  131  VAFSYMTVYPLGVKFLITFG--DFTPMISISEFLGFALTFILPFGIIFQLPVILIFLARM  188

Query  188  GLISIQQLEAHRKHIIVFFFFIAMFITP-PDVFSMLALAVPMWLLFELGLWVTKFTTQK  245
            GLI+ Q L  +R++ ++  F IA  ITP PD+ +   +A+PM+LL+E+ +W+ +    K
Sbjct  189  GLITHQLLAKYRQYALLAMFVIAAVITPTPDIVTQTLMALPMYLLYEISIWMIRLIRPK  247


> Q32Q93 Sec-independent protein translocase protein TatC [Mycolicibacterium 
smegmatis]
Length=317

 Score =  120 bits (300),  Expect = 8e-35
 Identities = 82/250 (33%), Positives = 125/250 (50%), Gaps = 18/250 (7%)

Query  13   MKYSEHLKELRKRLIYSIG-IVLAIFLLLLPLAQKNYHF------LAHPLISLLPSNSTM  65
            M   +HL ELR RL+ S+  +VL   +  +      + F      L  P  SL  S    
Sbjct  25   MSLVDHLHELRNRLLISVAAVVLTTIIGFIWYTHGVFGFNSLGEWLRGPYCSLPDSARAN  84

Query  66   IATDVMSTFLA--PF-------KLNIYFSILLSIPFILYQFWQFVAPALYQKEKRFGIAL  116
            IA D     LA  PF       K+ +   ++L+ P  LYQ W F+ P LY+KE+RF +A 
Sbjct  85   IAPDGECRLLATAPFDQFMLRLKVALAAGVVLACPVWLYQLWAFITPGLYKKERRFAMAF  144

Query  117  VISSNLLFYLGIVFAYTLILPLALKFFVLASPDNVLPMTDINSYLDFCLKLFLAFGLAFQ  176
            V    +LF  G V AY ++L  AL F +    D  +     + Y  F + L L FG++F+
Sbjct  145  VSFGAMLFISGAVLAY-VVLSKALSFLLTVGSDVQVTALSGDQYFGFLINLLLVFGISFE  203

Query  177  IPVLTYILIFIGLISIQQLEAHRKHIIVFFFFIAMFITP-PDVFSMLALAVPMWLLFELG  235
             P+L  +L  +G+++ ++L A R+ +I   F  A F TP  D FSMLALA  + +L E  
Sbjct  204  FPLLIIMLNLVGILTYERLSAWRRGLIFGLFVFAAFATPGSDPFSMLALACALTVLLEFA  263

Query  236  LWVTKFTTQK  245
            + + +   ++
Sbjct  264  IQIARLNDRR  273


> A1YH70 TatC [Providencia stuartii]
Length=122

 Score =  109 bits (273),  Expect = 9e-33
 Identities = 56/111 (50%), Positives = 72/111 (65%), Gaps = 0/111 (0%)

Query  18   HLKELRKRLIYSIGIVLAIFLLLLPLAQKNYHFLAHPLISLLPSNSTMIATDVMSTFLAP  77
            HL ELRKRL+  +  VL +F  L   +   Y  +A PLI  LP  S M ATDV STF  P
Sbjct  12   HLIELRKRLLNCLITVLIVFAALAYFSNDIYRLVAAPLIDKLPVGSQMSATDVASTFFTP  71

Query  78   FKLNIYFSILLSIPFILYQFWQFVAPALYQKEKRFGIALVISSNLLFYLGI  128
             KL +  S+ +SIP ILYQ W F+APALY+ E+R  + L++SS+ LFYLG+
Sbjct  72   IKLTMMVSVFISIPVILYQIWAFIAPALYKHERRLMLPLLVSSSFLFYLGM  122


 Score = 20.0 bits (40),  Expect = 0.83
 Identities = 27/105 (26%), Positives = 42/105 (40%), Gaps = 18/105 (17%)

Query  121  NLLFYLGIVFAYTLILPLALKFFVLASPDNVLPM------TDINSYLDFCLKLFLAFGLA  174
            N L  + IVFA        +   V A   + LP+      TD+ S     +KL +   + 
Sbjct  22   NCLITVLIVFAALAYFSNDIYRLVAAPLIDKLPVGSQMSATDVASTFFTPIKLTMMVSVF  81

Query  175  FQIPVLTY-ILIFIGLISIQQLEAHRKHIIV-------FFFFIAM  211
              IPV+ Y I  FI       L  H + +++       F F++ M
Sbjct  82   ISIPVILYQIWAFIA----PALYKHERRLMLPLLVSSSFLFYLGM  122


> Q9F2H3 Sec-independent protein translocase protein TatC [Streptomyces 
lividans]
Length=301

 Score =  105 bits (261),  Expect = 2e-29
 Identities = 66/237 (28%), Positives = 124/237 (52%), Gaps = 18/237 (8%)

Query  13   MKYSEHLKELRKRLIYSIGIVLAIFLLLLPLAQKNYHFLAHPLISLL------------P  60
            M  +EHL+ELR RL  ++  ++ + ++     Q   + L  P++  +             
Sbjct  1    MPLAEHLRELRNRLAKALLAIVVVTVVAAFFYQWIINALTDPILQSIGCEKSFAELAQSE  60

Query  61   SNSTMIATDVMSTFLAPF----KLNIYFSILLSIPFILYQFWQFVAPALYQKEKRFGIAL  116
            + S   A   ++  L PF    K+++   ++L+ P  LYQ W FVAP L++ EK++  A 
Sbjct  61   AGSEPCAQITINGLLGPFTLALKVSLTAGVVLASPVWLYQLWAFVAPGLHRNEKKYAYAF  120

Query  117  VISSNLLFYLGIVFAYTLILPLALKFFVLASPDNVLPMTDINSYLDFCLKLFLAFGLAFQ  176
            V +   LF  G  FAY  +LP + K  +  +P++V  +  ++  LD   ++ + FGL+F+
Sbjct  121  VATGAPLFLAGAYFAYA-VLPTSAKVLIEFTPNDVDNLLPLDELLDLVTRMVVVFGLSFE  179

Query  177  IPVLTYILIFIGLISIQQLEAHRKHIIVFFFFIAMFITP-PDVFSMLALAVPMWLLF  232
            +P+L  +L F G+++ +++    + +I+     A   TP  D  +M+ LA P+W+L+
Sbjct  180  LPLLLVMLNFTGVLTGKRMLGWWRAMIMGITLFAAIATPSTDPLTMIMLAGPIWVLY  236



Lambda      K        H        a         alpha
   0.336    0.148    0.450    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1153040


  Database: d5e03a5fc20475142762ea630f8ae70b.TrEMBL.fasta
    Posted date:  Sep 24, 2020  3:52 AM
  Number of letters in database: 6,968
  Number of sequences in database:  28



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40