ACIAD1520 / SwissProt Alignments

BLASTP 2.2.28+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: 76eff9c7d92b3705bcb948768f3e3901.SwissProt.fasta
           20 sequences; 5,563 total letters



Query= ACIAD1520

Length=249
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  P54085 Sec-independent protein translocase protein TatC [Azotob...   230    1e-77
  P44560 Sec-independent protein translocase protein TatC [Haemop...   226    2e-76
  P69424 Sec-independent protein translocase protein TatC [Escher...   221    3e-74
  P69423 Sec-independent protein translocase protein TatC [Escher...   221    3e-74
  Q8FBI6 Sec-independent protein translocase protein TatC [Escher...   221    4e-74
  D0KWI6 Sec-independent protein translocase protein TatC [Haloth...   196    3e-63
  C0QD59 Sec-independent protein translocase protein TatC [Desulf...   161    5e-51
  O67305 Sec-independent protein translocase protein TatC [Aquife...   158    5e-50
  A0L833 Sec-independent protein translocase protein TatC [Magnet...   152    2e-47
  Q9PHT8 Sec-independent protein translocase protein TatC [Campyl...   148    4e-46
  Q9ZM59 Sec-independent protein translocase protein TatC [Helico...   142    7e-44
  Q9Z9P4 Sec-independent protein translocase protein TatC [Bacill...   129    7e-39
  O05523 Sec-independent protein translocase protein TatCy [Bacil...   129    7e-39
  P9WG97 Sec-independent protein translocase protein TatC [Mycoba...   119    1e-34
  D0J948 Sec-independent protein translocase protein TatC [Blatta...   117    2e-34
  Q9AVE6 Sec-independent protein translocase protein TATC, chloro...   119    2e-34
  Q9SJV5 Sec-independent protein translocase protein TATC, chloro...   116    1e-33
  Q94G17 Sec-independent protein translocase protein TATC, chloro...   113    2e-32
  D2BJS8 Sec-independent protein translocase protein TatC [Dehalo...   111    4e-32
  P42252 Sec-independent protein translocase protein TatCd [Bacil...   105    3e-30


> P54085 Sec-independent protein translocase protein TatC [Azotobacter 
chroococcum mcd 1]
Length=255

 Score =  230 bits (586),  Expect = 1e-77
 Identities = 113/230 (49%), Positives = 153/230 (67%), Gaps = 0/230 (0%)

Query  8    ESLTEMKYSEHLKELRKRLIYSIGIVLAIFLLLLPLAQKNYHFLAHPLISLLPSNSTMIA  67
            +S  +M    HL ELR RL+ S+  VL IF  L   AQ  Y  ++ PL + LP  +TMIA
Sbjct  6    DSDQDMPLVAHLTELRSRLLRSVAAVLLIFAALFYFAQDIYALVSAPLRAYLPEGATMIA  65

Query  68   TDVMSTFLAPFKLNIYFSILLSIPFILYQFWQFVAPALYQKEKRFGIALVISSNLLFYLG  127
            T V S FLAPFKL +  S+ L++P +L+Q W F+AP LYQ EKR  + L+ SS LLFY G
Sbjct  66   TGVASPFLAPFKLTLMISLFLAMPVVLHQVWGFIAPGLYQHEKRIAMPLMASSVLLFYAG  125

Query  128  IVFAYTLILPLALKFFVLASPDNVLPMTDINSYLDFCLKLFLAFGLAFQIPVLTYILIFI  187
            + FAY ++ P+   FF   +P+ V  MTDI  YLDF L LF AFG+AF++PV T++LI++
Sbjct  126  MAFAYFVVFPIMFGFFASVTPEGVAMMTDIGQYLDFVLTLFFAFGVAFEVPVATFLLIWV  185

Query  188  GLISIQQLEAHRKHIIVFFFFIAMFITPPDVFSMLALAVPMWLLFELGLW  237
            G++ +  L   R ++IV  F + M +TPPDVFS   LAVPMWLLFE+G++
Sbjct  186  GIVDVASLRNSRPYVIVGCFVVGMVLTPPDVFSQTLLAVPMWLLFEIGVF  235


> P44560 Sec-independent protein translocase protein TatC [Haemophilus 
influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)]
Length=256

 Score =  226 bits (577),  Expect = 2e-76
 Identities = 108/229 (47%), Positives = 152/229 (66%), Gaps = 0/229 (0%)

Query  18   HLKELRKRLIYSIGIVLAIFLLLLPLAQKNYHFLAHPLISLLPSNSTMIATDVMSTFLAP  77
            HL ELR RL+  +  V+ +F+ L+  +   YHF+A PL +++P  +TMIAT++ + F  P
Sbjct  13   HLVELRNRLLRCVICVVLVFVALVYFSNDIYHFVAAPLTAVMPKGATMIATNIQTPFFTP  72

Query  78   FKLNIYFSILLSIPFILYQFWQFVAPALYQKEKRFGIALVISSNLLFYLGIVFAYTLILP  137
             KL    +I +S+P++LYQ W F+APALYQ EKR    L+ SS +LFY G+ FAY ++ P
Sbjct  73   IKLTAIVAIFISVPYLLYQIWAFIAPALYQHEKRMIYPLLFSSTILFYCGVAFAYYIVFP  132

Query  138  LALKFFVLASPDNVLPMTDINSYLDFCLKLFLAFGLAFQIPVLTYILIFIGLISIQQLEA  197
            L   FF   +P+ V   TDI+SYLDF L LFLAFG+ F++P+   +L + G+ +++ L  
Sbjct  133  LVFSFFTQTAPEGVTIATDISSYLDFALALFLAFGVCFEVPIAIILLCWTGITTVKALSE  192

Query  198  HRKHIIVFFFFIAMFITPPDVFSMLALAVPMWLLFELGLWVTKFTTQKN  246
             R +IIV  FFI M +TPPDVFS   LA+PM LLFELGL V +F   K+
Sbjct  193  KRPYIIVAAFFIGMLLTPPDVFSQTLLAIPMCLLFELGLLVARFYQPKD  241


> P69424 Sec-independent protein translocase protein TatC [Escherichia 
coli O157:H7]
Length=258

 Score =  221 bits (563),  Expect = 3e-74
 Identities = 109/228 (48%), Positives = 152/228 (67%), Gaps = 0/228 (0%)

Query  18   HLKELRKRLIYSIGIVLAIFLLLLPLAQKNYHFLAHPLISLLPSNSTMIATDVMSTFLAP  77
            HL ELRKRL+  I  V+ IFL L+  A   YH ++ PLI  LP  STMIATDV S F  P
Sbjct  12   HLIELRKRLLNCIIAVIVIFLCLVYFANDIYHLVSAPLIKQLPQGSTMIATDVASPFFTP  71

Query  78   FKLNIYFSILLSIPFILYQFWQFVAPALYQKEKRFGIALVISSNLLFYLGIVFAYTLILP  137
             KL    S++LS P ILYQ W F+APALY+ E+R  + L++SS+LLFY+G+ FAY ++ P
Sbjct  72   IKLTFMVSLILSAPVILYQVWAFIAPALYKHERRLVVPLLVSSSLLFYIGMAFAYFVVFP  131

Query  138  LALKFFVLASPDNVLPMTDINSYLDFCLKLFLAFGLAFQIPVLTYILIFIGLISIQQLEA  197
            LA  F    +P+ V   TDI SYL F + LF+AFG++F++PV   +L ++G+ S + L  
Sbjct  132  LAFGFLANTAPEGVQVSTDIASYLSFVMALFMAFGVSFEVPVAIVLLCWMGITSPEDLRK  191

Query  198  HRKHIIVFFFFIAMFITPPDVFSMLALAVPMWLLFELGLWVTKFTTQK  245
             R +++V  F + M +TPPDVFS   LA+PM+ LFE+G++ ++F   K
Sbjct  192  KRPYVLVGAFVVGMLLTPPDVFSQTLLAIPMYCLFEIGVFFSRFYVGK  239


> P69423 Sec-independent protein translocase protein TatC [Escherichia 
coli (strain K12)]
Length=258

 Score =  221 bits (563),  Expect = 3e-74
 Identities = 109/228 (48%), Positives = 152/228 (67%), Gaps = 0/228 (0%)

Query  18   HLKELRKRLIYSIGIVLAIFLLLLPLAQKNYHFLAHPLISLLPSNSTMIATDVMSTFLAP  77
            HL ELRKRL+  I  V+ IFL L+  A   YH ++ PLI  LP  STMIATDV S F  P
Sbjct  12   HLIELRKRLLNCIIAVIVIFLCLVYFANDIYHLVSAPLIKQLPQGSTMIATDVASPFFTP  71

Query  78   FKLNIYFSILLSIPFILYQFWQFVAPALYQKEKRFGIALVISSNLLFYLGIVFAYTLILP  137
             KL    S++LS P ILYQ W F+APALY+ E+R  + L++SS+LLFY+G+ FAY ++ P
Sbjct  72   IKLTFMVSLILSAPVILYQVWAFIAPALYKHERRLVVPLLVSSSLLFYIGMAFAYFVVFP  131

Query  138  LALKFFVLASPDNVLPMTDINSYLDFCLKLFLAFGLAFQIPVLTYILIFIGLISIQQLEA  197
            LA  F    +P+ V   TDI SYL F + LF+AFG++F++PV   +L ++G+ S + L  
Sbjct  132  LAFGFLANTAPEGVQVSTDIASYLSFVMALFMAFGVSFEVPVAIVLLCWMGITSPEDLRK  191

Query  198  HRKHIIVFFFFIAMFITPPDVFSMLALAVPMWLLFELGLWVTKFTTQK  245
             R +++V  F + M +TPPDVFS   LA+PM+ LFE+G++ ++F   K
Sbjct  192  KRPYVLVGAFVVGMLLTPPDVFSQTLLAIPMYCLFEIGVFFSRFYVGK  239


> Q8FBI6 Sec-independent protein translocase protein TatC [Escherichia 
coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)]
Length=258

 Score =  221 bits (562),  Expect = 4e-74
 Identities = 109/228 (48%), Positives = 152/228 (67%), Gaps = 0/228 (0%)

Query  18   HLKELRKRLIYSIGIVLAIFLLLLPLAQKNYHFLAHPLISLLPSNSTMIATDVMSTFLAP  77
            HL ELRKRL+  I  V+ IFL L+  A   YH ++ PLI  LP  STMIATDV S F  P
Sbjct  12   HLIELRKRLLNCIISVIVIFLCLVYFANDIYHLVSAPLIKQLPQGSTMIATDVASPFFTP  71

Query  78   FKLNIYFSILLSIPFILYQFWQFVAPALYQKEKRFGIALVISSNLLFYLGIVFAYTLILP  137
             KL    S++LS P ILYQ W F+APALY+ E+R  + L++SS+LLFY+G+ FAY ++ P
Sbjct  72   IKLTFMVSLILSAPVILYQVWAFIAPALYKHERRLVVPLLVSSSLLFYIGMAFAYFVVFP  131

Query  138  LALKFFVLASPDNVLPMTDINSYLDFCLKLFLAFGLAFQIPVLTYILIFIGLISIQQLEA  197
            LA  F    +P+ V   TDI SYL F + LF+AFG++F++PV   +L ++G+ S + L  
Sbjct  132  LAFGFLANTAPEGVQVSTDIASYLSFVMALFMAFGVSFEVPVAIVLLCWMGITSPEDLRK  191

Query  198  HRKHIIVFFFFIAMFITPPDVFSMLALAVPMWLLFELGLWVTKFTTQK  245
             R +++V  F + M +TPPDVFS   LA+PM+ LFE+G++ ++F   K
Sbjct  192  KRPYVLVGAFVVGMLLTPPDVFSQTLLAIPMYCLFEIGVFFSRFYVGK  239


> D0KWI6 Sec-independent protein translocase protein TatC [Halothiobacillus 
neapolitanus (strain ATCC 23641 / c2)]
Length=366

 Score =  196 bits (498),  Expect = 3e-63
 Identities = 94/224 (42%), Positives = 138/224 (62%), Gaps = 0/224 (0%)

Query  18   HLKELRKRLIYSIGIVLAIFLLLLPLAQKNYHFLAHPLISLLPSNSTMIATDVMSTFLAP  77
            HL ELR RL+  +  VL +FL+L P   + +  LA PL   +P+ STMIA +V S F  P
Sbjct  30   HLVELRNRLLKGVLAVLVLFLILFPFRNELFTMLADPLSRHMPAGSTMIAVEVASPFFIP  89

Query  78   FKLNIYFSILLSIPFILYQFWQFVAPALYQKEKRFGIALVISSNLLFYLGIVFAYTLILP  137
             KL    ++ ++IPF+LYQ W F+AP LY+ E++    LV SS +LFYLG  FAY ++ P
Sbjct  90   LKLTALTAVFIAIPFLLYQLWAFIAPGLYKHERKLVAPLVFSSTILFYLGAAFAYFVVFP  149

Query  138  LALKFFVLASPDNVLPMTDINSYLDFCLKLFLAFGLAFQIPVLTYILIFIGLISIQQLEA  197
            +   F   A P +V    DI  YL F   LF AFG  F++PV   +L+ +G+++  +L  
Sbjct  150  VVFGFLSTAGPSDVNFAPDIGEYLSFVTSLFFAFGFVFEVPVAIVLLVIVGVVTPDKLAG  209

Query  198  HRKHIIVFFFFIAMFITPPDVFSMLALAVPMWLLFELGLWVTKF  241
             R++ I+  F IA  +TPPDV S   +A+P+ +L+E GL+V++F
Sbjct  210  FRRYAILIAFIIAAILTPPDVLSQFMMALPIIMLYEFGLFVSRF  253


 Score = 18.9 bits (37),  Expect = 2.1
 Identities = 8/28 (29%), Positives = 17/28 (61%), Gaps = 1/28 (4%)

Query  81   NIYFSILLSIPFI-LYQFWQFVAPALYQ  107
            ++    ++++P I LY+F  FV+   Y+
Sbjct  229  DVLSQFMMALPIIMLYEFGLFVSRFFYK  256


> C0QD59 Sec-independent protein translocase protein TatC [Desulfobacterium 
autotrophicum (strain ATCC 43914 / DSM 3382 / HRM2)]
Length=270

 Score =  161 bits (408),  Expect = 5e-51
 Identities = 78/222 (35%), Positives = 131/222 (59%), Gaps = 0/222 (0%)

Query  15   YSEHLKELRKRLIYSIGIVLAIFLLLLPLAQKNYHFLAHPLISLLPSNSTMIATDVMSTF  74
            ++EHL ELR RL+ S   V   F++     ++ +  L  PLI+ +     MI T +   F
Sbjct  10   FTEHLGELRDRLVRSFIAVGVGFVIAYCFKERLFDILTAPLIAAMGEGQKMIFTGLPEAF  69

Query  75   LAPFKLNIYFSILLSIPFILYQFWQFVAPALYQKEKRFGIALVISSNLLFYLGIVFAYTL  134
                K+++   ++L+ P + Y+FW FV+P LY+KEKRF + +VI S   F +G  F Y +
Sbjct  70   FTYLKVSLLTGVILATPVLFYEFWMFVSPGLYRKEKRFVLPVVILSIFFFCVGSSFGYFI  129

Query  135  ILPLALKFFVLASPDNVLPMTDINSYLDFCLKLFLAFGLAFQIPVLTYILIFIGLISIQQ  194
            + P   +FF+  S D +  M  +  YL F  K+ LAFG  F++P++   +  +GL+S++ 
Sbjct  130  VFPYGFQFFLGFSSDTIQAMPSMKEYLGFASKMLLAFGFVFELPLVLTFMARMGLVSVEF  189

Query  195  LEAHRKHIIVFFFFIAMFITPPDVFSMLALAVPMWLLFELGL  236
            L+ +RK+ I+ FF  A  ITPPDV + + +A+P+ +L+E+ +
Sbjct  190  LKKNRKYAILIFFTGAALITPPDVVTQIMMAIPLMILYEISI  231


> O67305 Sec-independent protein translocase protein TatC [Aquifex 
aeolicus (strain VF5)]
Length=240

 Score =  158 bits (399),  Expect = 5e-50
 Identities = 89/235 (38%), Positives = 140/235 (60%), Gaps = 4/235 (2%)

Query  13   MKYSEHLKELRKRLIYSIGIVLAIFLLLLPLAQKNYHFLAHPLISLLPSNSTMIATDVMS  72
            M  +EHL+ELR RLI SI   L    +    A+  +  L  P++   P    +  +    
Sbjct  1    MPLTEHLRELRYRLIISIIAFLIGSGIAFYFAKYVFEILKEPILKSYPEVELITLSPTEP  60

Query  73   TFLAPFKLNIYFSILLSIPFILYQFWQFVAPALYQKEKRFGIALVISSNLLFYLGIVFAY  132
             F+   K+++    +++ P ILYQFW+F+ PALY  EKR  I L++ S LLF LG +FAY
Sbjct  61   LFIL-IKISLAVGFIIASPVILYQFWRFIEPALYSHEKRAFIPLLLGSILLFMLGALFAY  119

Query  133  TLILPLALKFFVLASPDNVL--PMTDINSYLDFCLKLFLAFGLAFQIPVLTYILIFIGLI  190
             ++LPLALKF +      +L  P   ++ Y+ F LKL +AFG+AF++P++ Y+L   G+I
Sbjct  120  FIVLPLALKFLLGLGFTQLLATPYLSVDMYISFVLKLVVAFGIAFEMPIVLYVLQKAGVI  179

Query  191  SIQQLEAHRKHIIVFFFFIAMFITPPDVFSMLALAVPMWLLFELGLWVTKFTTQK  245
            + +QL + RK+ IV  F I   I  PDV + + +A+P+ LL+E+ +++ K  T+K
Sbjct  180  TPEQLASFRKYFIVIAFVIGAIIA-PDVSTQVLMAIPLLLLYEISIFLGKLATRK  233


> A0L833 Sec-independent protein translocase protein TatC [Magnetococcus 
marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)]
Length=271

 Score =  152 bits (384),  Expect = 2e-47
 Identities = 75/221 (34%), Positives = 126/221 (57%), Gaps = 0/221 (0%)

Query  17   EHLKELRKRLIYSIGIVLAIFLLLLPLAQKNYHFLAHPLISLLPSNSTMIATDVMSTFLA  76
            EHL ELR RL+ S+G ++  F+L    +++ + FLA PL  +L   + MI T +   F  
Sbjct  13   EHLIELRNRLMISVGAIIVGFILCYSFSEQIFEFLAAPLHEILGPQAKMIYTALHEAFFT  72

Query  77   PFKLNIYFSILLSIPFILYQFWQFVAPALYQKEKRFGIALVISSNLLFYLGIVFAYTLIL  136
              K++ +  + L++P +  Q W F+AP LYQ E+   +  +  + +LF++G   AY  + 
Sbjct  73   QIKVSFFAGLFLAMPVLFTQMWLFIAPGLYQHERSAILPFLFVTPVLFFMGGTLAYYFVF  132

Query  137  PLALKFFVLASPDNVLPMTDINSYLDFCLKLFLAFGLAFQIPVLTYILIFIGLISIQQLE  196
            PLA KFF+      +  +  +  YL   +KL +AFG+ F++PV   + I  G++S   L 
Sbjct  133  PLAFKFFLGFQSSTIEALPSMREYLSLVIKLIIAFGITFELPVGLLLAIKAGVVSTAGLV  192

Query  197  AHRKHIIVFFFFIAMFITPPDVFSMLALAVPMWLLFELGLW  237
              RK+ IV  F  A  +TPPD F+ + LA+P+ L++E+ ++
Sbjct  193  DKRKYNIVLAFVAAAILTPPDPFTQVMLAIPIMLMYEISIF  233


> Q9PHT8 Sec-independent protein translocase protein TatC [Campylobacter 
jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 
/ NCTC 11168)]
Length=245

 Score =  148 bits (373),  Expect = 4e-46
 Identities = 76/225 (34%), Positives = 127/225 (56%), Gaps = 2/225 (1%)

Query  18   HLKELRKRLIYSIGIVLAIFLLLLPLAQKNYHFLAHPLISLLPSNSTMI-ATDVMSTFLA  76
            HL ELRKRL  S+  ++ +F++   L       L  PLI++LP  +  +   +V      
Sbjct  8    HLIELRKRLFISVACIVVMFIVCFALRSYILDILKAPLIAVLPEVAKHVNVIEVQEALFT  67

Query  77   PFKLNIYFSILLSIPFILYQFWQFVAPALYQKEKRFGIALVISSNLLFYLGIVFAYTLIL  136
              K++ + + + S+P I +QFW+FVAP LY  EKR  +  V  ++++F  G  F Y +++
Sbjct  68   AMKVSFFAAFIFSLPVIFWQFWKFVAPGLYDNEKRLVVPFVSFASIMFAFGACFCYFVVV  127

Query  137  PLALKFFV-LASPDNVLPMTDINSYLDFCLKLFLAFGLAFQIPVLTYILIFIGLISIQQL  195
            PLA KF +     ++  P+  I +Y+DF  K+ +AFGLAF++PV+ +    IGLI    L
Sbjct  128  PLAFKFLINFGLNEDFNPVITIGTYVDFFTKVVVAFGLAFEMPVIAFFFAKIGLIDDSFL  187

Query  196  EAHRKHIIVFFFFIAMFITPPDVFSMLALAVPMWLLFELGLWVTK  240
            + H +  ++  F  + F+TPPDV S   +A P+  L+ L + + +
Sbjct  188  KRHFRIAVLVIFVFSAFMTPPDVLSQFLMAGPLCGLYGLSILIVQ  232


> Q9ZM59 Sec-independent protein translocase protein TatC [Helicobacter 
pylori (strain J99 / ATCC 700824)]
Length=249

 Score =  142 bits (358),  Expect = 7e-44
 Identities = 77/227 (34%), Positives = 125/227 (55%), Gaps = 14/227 (6%)

Query  18   HLKELRKRLIYSIGIVLAIFLLLLPLAQKNYHFLAHP----LISLLPSNSTMIATDVMST  73
            HL+ELRKRL+ S+G +L  FL      +  + F+ +     LI L P    M+A      
Sbjct  8    HLQELRKRLMVSVGTILVAFLGCFHFWKNIFEFVKNSYKGTLIQLSPIEGVMVAV-----  62

Query  74   FLAPFKLNIYFSILLSIPFILYQFWQFVAPALYQKEKRFGIALVISSNLLFYLGIVFAYT  133
                 K++   +I++S+P I +Q W F+AP LY+ EK+  +  V   + +F +G  F+Y 
Sbjct  63   -----KISFSAAIVISMPIIFWQLWLFIAPGLYKNEKKVILPFVFFGSGMFLMGAAFSYY  117

Query  134  LILPLALKFFVLASPDNVLPMTDINSYLDFCLKLFLAFGLAFQIPVLTYILIFIGLISIQ  193
            ++ P  +++      D        +SY+ F  +L L FG+AF++PVL Y L  +GLI+  
Sbjct  118  VVFPFIIEYLATFGSDVFAANISASSYVSFFTRLILGFGVAFELPVLAYFLAKVGLITDA  177

Query  194  QLEAHRKHIIVFFFFIAMFITPPDVFSMLALAVPMWLLFELGLWVTK  240
             L+A+ K+ IV  F +A  ITPPDV S + +A+P+  L+ L + + K
Sbjct  178  SLKAYFKYAIVVIFIVAAIITPPDVVSQIFMALPLVGLYGLSILIAK  224


> Q9Z9P4 Sec-independent protein translocase protein TatC [Bacillus 
halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 
/ JCM 9153 / C-125)]
Length=253

 Score =  129 bits (324),  Expect = 7e-39
 Identities = 77/242 (32%), Positives = 133/242 (55%), Gaps = 18/242 (7%)

Query  12   EMKYSEHLKELRKRLIYSIGIVLAIFLLLLPLAQKNYHFLAHPLISLLPSNSTMIATDV-  70
            +M   +H+ ELR+R++    I++  F++ L +      FLA P+I+ L    T  A D+ 
Sbjct  5    DMSLMDHIAELRRRIL----IIVVFFVIALVVG----FFLATPMITYLQGAPT--AQDLP  54

Query  71   MSTFLAPFKLNIYFSI------LLSIPFILYQFWQFVAPALYQKEKRFGIALVISSNLLF  124
            M+ F     L +Y +       +L  P ILYQ W FV+P L++ E++  +A +  +  LF
Sbjct  55   MNAFKLTDPLRVYMTFAFTSAFILVFPIILYQLWAFVSPGLHENERKATLAYIPIAFFLF  114

Query  125  YLGIVFAYTLILPLALKFFV-LASPDNVLPMTDINSYLDFCLKLFLAFGLAFQIPVLTYI  183
              G+ FAY ++ P  ++F   LA   ++  +  IN Y  F  ++ + FG+ FQ+PV+   
Sbjct  115  LGGLSFAYFILFPFLIQFIGGLAERLHINELYGINEYFTFLFQITMPFGVLFQLPVVVMF  174

Query  184  LIFIGLISIQQLEAHRKHIIVFFFFIAMFITPPDVFSMLALAVPMWLLFELGLWVTKFTT  243
            L  +G+++ + L + RK+       +A FITPP++ S L + VP+ LL+E  +WV+  T 
Sbjct  175  LTRLGIVTPEFLRSVRKYAFFVLLVVAGFITPPELISHLMVTVPLLLLYEFSIWVSHLTY  234

Query  244  QK  245
            +K
Sbjct  235  RK  236


 Score = 19.6 bits (39),  Expect = 1.1
 Identities = 10/42 (24%), Positives = 25/42 (60%), Gaps = 1/42 (2%)

Query  70   VMSTFLAPFKLNIYFSILLSIPFILYQFWQFVAPALYQKEKR  111
            V++ F+ P +L  +  + + +  +LY+F  +V+   Y+K ++
Sbjct  199  VVAGFITPPELISHLMVTVPL-LLLYEFSIWVSHLTYRKVQK  239


> O05523 Sec-independent protein translocase protein TatCy [Bacillus 
subtilis (strain 168)]
Length=254

 Score =  129 bits (324),  Expect = 7e-39
 Identities = 77/242 (32%), Positives = 126/242 (52%), Gaps = 14/242 (6%)

Query  10   LTEMKYSEHLKELRKRLIYSIGIVLAIFLLLLPLAQKNYHFLAHPLISLLPSNS-----T  64
            + +M   EH+ ELRKRL+  + +   +F +          FLA P+I  L         T
Sbjct  6    VNQMSLLEHIAELRKRLLI-VALAFVVFFIA-------GFFLAKPIIVYLQETDEAKQLT  57

Query  65   MIATDVMSTFLAPFKLNIYFSILLSIPFILYQFWQFVAPALYQKEKRFGIALVISSNLLF  124
            + A ++        +      I+L+ P ILYQ W FV+P LY+KE++  ++ +  S LLF
Sbjct  58   LNAFNLTDPLYVFMQFAFIIGIVLTSPVILYQLWAFVSPGLYEKERKVTLSYIPVSILLF  117

Query  125  YLGIVFAYTLILPLALKFFVLASPD-NVLPMTDINSYLDFCLKLFLAFGLAFQIPVLTYI  183
              G+ F+Y ++ P  + F    S D NV  +  IN Y  F L+L + FGL FQ+PV+   
Sbjct  118  LAGLSFSYYILFPFVVDFMKRISQDLNVNQVIGINEYFHFLLQLTIPFGLLFQMPVILMF  177

Query  184  LIFIGLISIQQLEAHRKHIIVFFFFIAMFITPPDVFSMLALAVPMWLLFELGLWVTKFTT  243
            L  +G+++   L   RK+       IA  ITPP++ S + + VP+ +L+E+ + ++K   
Sbjct  178  LTRLGIVTPMFLAKIRKYAYFTLLVIAALITPPELLSHMMVTVPLLILYEISILISKAAY  237

Query  244  QK  245
            +K
Sbjct  238  RK  239


 Score = 18.9 bits (37),  Expect = 2.0
 Identities = 10/46 (22%), Positives = 24/46 (52%), Gaps = 1/46 (2%)

Query  70   VMSTFLAPFKLNIYFSILLSIPFILYQFWQFVAPALYQKEKRFGIA  115
            V++  + P +L  +  + + +  ILY+    ++ A Y+K ++   A
Sbjct  202  VIAALITPPELLSHMMVTVPL-LILYEISILISKAAYRKAQKSSAA  246


> P9WG97 Sec-independent protein translocase protein TatC [Mycobacterium 
tuberculosis (strain ATCC 25618 / H37Rv)]
Length=308

 Score =  119 bits (297),  Expect = 1e-34
 Identities = 76/245 (31%), Positives = 121/245 (49%), Gaps = 18/245 (7%)

Query  13   MKYSEHLKELRKRLIYSIGIVLAIFLLLLPLAQKNY-------HFLAHPLISLLPS----  61
            M   +HL ELR RL+ S+  +L   +        +         +L HP  +L  S    
Sbjct  25   MSLVDHLTELRTRLLISLAAILVTTIFGFVWYSHSIFGLDSLGEWLRHPYCALPQSARAD  84

Query  62   -----NSTMIATDVMSTFLAPFKLNIYFSILLSIPFILYQFWQFVAPALYQKEKRFGIAL  116
                    ++AT     F+   K+ +   I+L+ P   YQ W F+ P LYQ+E+RF +A 
Sbjct  85   ISADGECRLLATAPFDQFMLRLKVGMAAGIVLACPVWFYQLWAFITPGLYQRERRFAVAF  144

Query  117  VISSNLLFYLGIVFAYTLILPLALKFFVLASPDNVLPMTDINSYLDFCLKLFLAFGLAFQ  176
            VI + +LF  G V AY L+L  AL F +    D  +     + Y  F L L + FG++F+
Sbjct  145  VIPAAVLFVAGAVLAY-LVLSKALGFLLTVGSDVQVTALSGDRYFGFLLNLLVVFGVSFE  203

Query  177  IPVLTYILIFIGLISIQQLEAHRKHII-VFFFFIAMFITPPDVFSMLALAVPMWLLFELG  235
             P+L  +L   GL++ ++L++ R+ +I   F F A+F    D FSM AL   + +L EL 
Sbjct  204  FPLLIVMLNLAGLLTYERLKSWRRGLIFAMFVFAAIFTPGSDPFSMTALGAALTVLLELA  263

Query  236  LWVTK  240
            + + +
Sbjct  264  IQIAR  268


 Score = 21.9 bits (45),  Expect = 0.22
 Identities = 12/33 (36%), Positives = 19/33 (58%), Gaps = 0/33 (0%)

Query  5    IVSESLTEMKYSEHLKELRKRLIYSIGIVLAIF  37
            IV  +L  +   E LK  R+ LI+++ +  AIF
Sbjct  208  IVMLNLAGLLTYERLKSWRRGLIFAMFVFAAIF  240


> D0J948 Sec-independent protein translocase protein TatC [Blattabacterium 
sp. subsp. Periplaneta americana (strain BPLAN)]
Length=266

 Score =  117 bits (294),  Expect = 2e-34
 Identities = 70/268 (26%), Positives = 132/268 (49%), Gaps = 43/268 (16%)

Query  12   EMKYSEHLKELRKRLIYSIGIVLAIFLLLLP------------------LAQKNYHFL--  51
            EM + EH++ELRK LI+S+  ++   ++L+                   +  + +H L  
Sbjct  7    EMPFWEHIEELRKHLIHSVCAMIIATIILMNNKNVIFDYILFGPAKTDFITYRLFHKLGK  66

Query  52   ----AHPLISLLPSNSTMIATDVMSTFLAPFKLNIYF------SILLSIPFILYQFWQFV  101
                +H        N  +    +   F      NIY         +LS P+I Y+FW+F+
Sbjct  67   IFHRSHHSFYFFSHNLEIQNRQIFGQF------NIYVWTCFIGGFILSFPYIFYEFWKFI  120

Query  102  APALYQKEKRFGIALVISSNLLFYLGIVFAYTLILPLALKF---FVLAS-PDNVLPMTDI  157
             PAL  +E+++   +++    LF LG++F Y ++ P  + F   F ++S P N+    D+
Sbjct  121  KPALSDEERKYSRGIIMMVTFLFILGVLFGYFILCPFLIHFGYTFRISSFPRNIF---DL  177

Query  158  NSYLDFCLKLFLAFGLAFQIPVLTYILIFIGLISIQQLEAHRKHIIVFFFFIAMFITPPD  217
            + Y+   +   L+ G+ F  P+  Y L  I LIS   L+ +RKH  +    +A  ITP D
Sbjct  178  SDYISLIMHSILSMGITFLFPIFIYFLTKIELISYPFLKKYRKHAFLILLILASAITPGD  237

Query  218  VFSMLALAVPMWLLFELGLWVTKFTTQK  245
            +FS + + +P+ +L++  ++++ + ++K
Sbjct  238  IFSTIVVLIPLMILYQFSIYISFYVSKK  265


> Q9AVE6 Sec-independent protein translocase protein TATC, chloroplastic 
[Oryza sativa subsp. japonica]
Length=359

 Score =  119 bits (298),  Expect = 2e-34
 Identities = 76/232 (33%), Positives = 121/232 (52%), Gaps = 4/232 (2%)

Query  12   EMKYSEHLKELRKRLIYSIGIVLAIFLLLLPLAQKNYHFLAHPLISLLPSNSTMIATDVM  71
            EM   +HL+ELR R+  S+  V A  L     ++     L  P+          +     
Sbjct  129  EMSIFDHLEELRDRIFVSVLAVGAAILGCFAYSKDLIRILEAPVSV---QGVRFLQLSPG  185

Query  72   STFLAPFKLNIYFSILLSIPFILYQFWQFVAPALYQKEKRFGIALVISSNLLFYLGIVFA  131
              F    K++ Y  +LL  P ILY+   FV P L + E++F   +V+ S++LFYLGI F+
Sbjct  186  EFFFTTLKVSGYCGLLLGSPVILYEIIAFVLPGLTRDERKFLGPIVLGSSVLFYLGIFFS  245

Query  132  YTLILPLALKFFVLASPDNVLPMTDINSYLDFCLKLFLAFGLAFQIPVLTYILIFIGLIS  191
            YT++ P AL FFV  +   V  +  I+ Y +F L L  + GL+FQ+PV+  +L  +GL+S
Sbjct  246  YTVLAPAALNFFVNYADGAVESLWSIDQYFEFVLVLLFSTGLSFQVPVIQLLLGQVGLVS  305

Query  192  IQQLEAHRKHIIVFFFFIAMFITP-PDVFSMLALAVPMWLLFELGLWVTKFT  242
              Q+ +  ++++V     A  +TP  D  + + LA P+  L+  G W+ K T
Sbjct  306  SDQMLSIWRYVVVGAVVAAAVLTPSTDPLTQMLLAGPLLGLYLGGAWMVKLT  357


> Q9SJV5 Sec-independent protein translocase protein TATC, chloroplastic 
[Arabidopsis thaliana]
Length=340

 Score =  116 bits (291),  Expect = 1e-33
 Identities = 75/232 (32%), Positives = 121/232 (52%), Gaps = 4/232 (2%)

Query  12   EMKYSEHLKELRKRLIYSIGIVLAIFLLLLPLAQKNYHFLAHPLISLLPSNSTMIATDVM  71
            EM   +HL+ELR+R+  S+  V A  L     ++    FL  P+ +        +     
Sbjct  110  EMTIFDHLEELRERIFVSVLAVGAAILGCFAFSKDLIVFLEAPVKT---QGVRFLQLAPG  166

Query  72   STFLAPFKLNIYFSILLSIPFILYQFWQFVAPALYQKEKRFGIALVISSNLLFYLGIVFA  131
              F    K++ Y  +LL  P ILY+   FV P L + E+RF   +V  S+LLFY G+ F+
Sbjct  167  EFFFTTLKVSGYCGLLLGSPVILYEIIAFVLPGLTRAERRFLGPIVFGSSLLFYAGLAFS  226

Query  132  YTLILPLALKFFVLASPDNVLPMTDINSYLDFCLKLFLAFGLAFQIPVLTYILIFIGLIS  191
            Y ++ P AL FFV  +   V  +  I+ Y +F L L  + GL+FQ+PV+  +L  +G++S
Sbjct  227  YWVLTPAALNFFVNYAEGVVESLWSIDQYFEFVLVLMFSTGLSFQVPVIQLLLGQVGVVS  286

Query  192  IQQLEAHRKHIIVFFFFIAMFITP-PDVFSMLALAVPMWLLFELGLWVTKFT  242
              Q+ +  ++++V     A  +TP  D  + + LA P+  L+  G W+ K T
Sbjct  287  GDQMLSIWRYVVVGAVVAAAVVTPSTDPVTQMLLATPLLGLYLGGAWMVKLT  338


> Q94G17 Sec-independent protein translocase protein TATC, chloroplastic 
[Pisum sativum]
Length=353

 Score =  113 bits (283),  Expect = 2e-32
 Identities = 74/242 (31%), Positives = 125/242 (52%), Gaps = 28/242 (12%)

Query  12   EMKYSEHLKELRKRLIYSI----GIVLAIF--------LLLLPLAQKNYHFLAHPLISLL  59
            EM   +HL+ELR+R+  S+    G +L  F        +L  P+  +   FL      L 
Sbjct  123  EMSIFDHLEELRERIFISVLGVGGSILGCFAFSKDLVKILEAPVKSEGVRFL-----QLA  177

Query  60   PSNSTMIATDVMSTFLAPFKLNIYFSILLSIPFILYQFWQFVAPALYQKEKRFGIALVIS  119
            P             F    K++ Y  +LL  P ILY+   F+ P L ++E++F   +V+ 
Sbjct  178  PGEF----------FFTTLKVSGYCGLLLGSPIILYEIIAFIIPGLTKEERKFLGPIVLG  227

Query  120  SNLLFYLGIVFAYTLILPLALKFFVLASPDNVLPMTDINSYLDFCLKLFLAFGLAFQIPV  179
            S++LFY GI F+Y +++P AL FFV  +   V  +  I+ Y +F L L  + GL+FQ+P+
Sbjct  228  SSVLFYAGITFSYLVLVPAALNFFVNYAEGAVESLWSIDQYFEFVLVLMFSTGLSFQVPI  287

Query  180  LTYILIFIGLISIQQLEAHRKHIIVFFFFIAMFITP-PDVFSMLALAVPMWLLFELGLWV  238
            +  +L  +GL+S  ++ +  ++++V     A  +TP  D  + + LA P+  L+  G W+
Sbjct  288  IQLLLGQLGLVSGDKMLSVWRYVVVGAVVAAAVVTPSTDPLTQVLLAAPLLGLYLGGAWM  347

Query  239  TK  240
             K
Sbjct  348  VK  349


> D2BJS8 Sec-independent protein translocase protein TatC [Dehalococcoides 
mccartyi (strain VS)]
Length=262

 Score =  111 bits (277),  Expect = 4e-32
 Identities = 69/239 (29%), Positives = 123/239 (51%), Gaps = 13/239 (5%)

Query  12   EMKYSEHLKELRKRLIYSIGIVLAIFLLLLPLAQKNYHFLAHPLISLLPS----NSTMIA  67
            +M    H  ELR+R  ++ GI+  +  +++        F A P+I  L +    +     
Sbjct  24   KMPIGGHFNELRQR--FTRGIIALVMGVMVAF------FFATPIIGFLTAPGGPDFKPAQ  75

Query  68   TDVMSTFLAPFKLNIYFSILLSIPFILYQFWQFVAPALYQKEKRFGIALVISSNLLFYLG  127
              VM      F ++++   +++ P+ILYQ   F+ PAL + EK+F    + +  ++F  G
Sbjct  76   LGVMEYASVFFNVSLWAGFIIASPYILYQLIAFITPALNRNEKKFIFIAIPAVTVMFLAG  135

Query  128  IVFAYTLILPLALKFFVLASPDNVLPMTDINSYLDFCLKLFLAFGLAFQIPVLTYILIFI  187
            + FAY + LP AL   +    D VL +  I  Y++   ++ +A GL F+ P +  +L  +
Sbjct  136  LAFAYYVALPPALNILLHWGDDVVLTVVGIKDYMNVVTRILIALGLIFETPFIIMVLARL  195

Query  188  GLISIQQLEAHRKHIIVFFFFIAMFITPP-DVFSMLALAVPMWLLFELGLWVTKFTTQK  245
            G++S Q L + RK  +V  F IA  ITP  D  +   +A P+ +L+E+ +W++K   +K
Sbjct  196  GVVSPQWLASKRKIWVVIAFVIAALITPTFDPVNQTIMAGPLIVLYEISIWLSKLVYRK  254


 Score = 17.7 bits (34),  Expect = 4.8
 Identities = 12/86 (14%), Positives = 40/86 (47%), Gaps = 3/86 (3%)

Query  25   RLIYSIGIVLAIFLLLLPLAQKNYHFLAHPLISLLPSNSTMIATDVMSTFLAPFKLNIYF  84
            R++ ++G++     +++ LA+     +  P          ++   V++  + P    +  
Sbjct  174  RILIALGLIFETPFIIMVLARLG---VVSPQWLASKRKIWVVIAFVIAALITPTFDPVNQ  230

Query  85   SILLSIPFILYQFWQFVAPALYQKEK  110
            +I+     +LY+   +++  +Y+K++
Sbjct  231  TIMAGPLIVLYEISIWLSKLVYRKKR  256


> P42252 Sec-independent protein translocase protein TatCd [Bacillus 
subtilis (strain 168)]
Length=242

 Score =  105 bits (263),  Expect = 3e-30
 Identities = 63/230 (27%), Positives = 114/230 (50%), Gaps = 6/230 (3%)

Query  18   HLKELRKRLIYSIGIVLAIFLLLLPLAQKNYHFLAHPLISLLPSNSTMIATDVMSTFLAP  77
            HL+ELR+R+I ++       +      Q  Y +L   L   L   + +  ++++  ++  
Sbjct  11   HLEELRRRIIVTLAAFFLFLITAFLFVQDIYDWLIRDLDGKL---AVLGPSEILWVYMM-  66

Query  78   FKLNIYFSILLSIPFILYQFWQFVAPALYQKEKRFGIALVISSNLLFYLGIVFAYTLILP  137
              L+   +I  SIP   YQ W+FVAPAL + E++  +  +     LF  GI F Y ++ P
Sbjct  67   --LSGICAIAASIPVAAYQLWRFVAPALTKTERKVTLMYIPGLFALFLAGISFGYFVLFP  124

Query  138  LALKFFVLASPDNVLPMTDINSYLDFCLKLFLAFGLAFQIPVLTYILIFIGLISIQQLEA  197
            + L F    S  +   M   + Y  F + L L FG  F++P++   L  +G+++  +L  
Sbjct  125  IVLSFLTHLSSGHFETMFTADRYFRFMVNLSLPFGFLFEMPLVVMFLTRLGILNPYRLAK  184

Query  198  HRKHIIVFFFFIAMFITPPDVFSMLALAVPMWLLFELGLWVTKFTTQKNI  247
             RK        +++ ITPPD  S   + +P+ +LFE+ + ++ F  +K +
Sbjct  185  ARKLSYFLLIVVSILITPPDFISDFLVMIPLLVLFEVSVTLSAFVYKKRM  234



Lambda      K        H        a         alpha
   0.336    0.148    0.450    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 951252


  Database: 76eff9c7d92b3705bcb948768f3e3901.SwissProt.fasta
    Posted date:  Sep 19, 2020  2:42 PM
  Number of letters in database: 5,563
  Number of sequences in database:  20



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40