ACIAD1507 / TrEMBL Alignments

BLASTP 2.2.28+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: 8fe419e1fc2637734e9694d765f9ef58.TrEMBL.fasta
           24 sequences; 8,553 total letters



Query= ACIAD1507

Length=384
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  Q6FC48 Putative dipeptide transport protein (ABC superfamily, m...   736    0.0  
  N9QIA8 ABC transmembrane type-1 domain-containing protein [Acin...   726    0.0  
  A0A1V2USY3 Peptide ABC transporter permease [Acinetobacter geno...   725    0.0  
  A0A1Y3F9T7 Peptide ABC transporter membrane protein [Acinetobac...   725    0.0  
  D8JK14 Peptide ABC transporter membrane protein [Acinetobacter ...   724    0.0  
  R8YYQ6 ABC transmembrane type-1 domain-containing protein [Acin...   724    0.0  
  A0A2M8MMI8 ABC transporter permease [Acinetobacter seifertii]        724    0.0  
  N8QSS4 ABC transmembrane type-1 domain-containing protein [Acin...   723    0.0  
  A0A2T5QKU7 Peptide ABC transporter permease [Acinetobacter olei...   722    0.0  
  A0A0M3FG56 ABC transporter permease [Acinetobacter baumannii]        721    0.0  
  A0A0R0RUW6 Peptide ABC transporter permease [Acinetobacter pittii]   721    0.0  
  A0A009JIZ9 Binding--dependent transport system inner membrane c...   720    0.0  
  F0KP74 Putative dipeptide transport protein (ABC superfamily, m...   720    0.0  
  A0A241YIW9 Peptide ABC transporter permease [Acinetobacter noso...   720    0.0  
  Q44373 OphB [Rhizobium radiobacter]                                  197    6e-62
  B3EUP0 Putative peptide ABC transporter, permease protein [Bord...   188    9e-59
  O50262 AgaB [Rhizobium radiobacter]                                  187    3e-58
  Q9LCD2 Dipeptide transporter DppB homolog [Ochrobactrum anthropi]    184    3e-57
  O50268 Glutathione ABC transporter permease [Rhizobium radiobac...   182    2e-56
  Q8VPJ0 ABC-type dipeptide/oligopeptide/nickel transport systems...   181    5e-56
  Q9ZI30 Putative OppB [Treponema denticola]                           166    4e-50
  Q9AL81 Nickel ABC transporter permease subunit NikB [Brucella s...   164    8e-50
  Q9ZGP1 ABC transporter permease [Staphylococcus aureus]              163    1e-49
  O30543 AccD [Agrobacterium fabrum (strain C58 / ATCC 33970)]         163    2e-49


> Q6FC48 Putative dipeptide transport protein (ABC superfamily, 
membrane) [Acinetobacter baylyi (strain ATCC 33305 / BD413 
/ ADP1)]
Length=383

 Score =  736 bits (1901),  Expect = 0.0
 Identities = 383/383 (100%), Positives = 383/383 (100%), Gaps = 0/383 (0%)

Query  1    MTIQSSKIEASIQQPAITKSFEFPAWLPWFLTRLVSGILVVFVISLVVFIATQALPSDPA  60
            MTIQSSKIEASIQQPAITKSFEFPAWLPWFLTRLVSGILVVFVISLVVFIATQALPSDPA
Sbjct  1    MTIQSSKIEASIQQPAITKSFEFPAWLPWFLTRLVSGILVVFVISLVVFIATQALPSDPA  60

Query  61   RVILGPEASEATVQILREQLGLNDPILLQYWHWLSQLLQGNFGQSIDSNVPVLQIIQNYF  120
            RVILGPEASEATVQILREQLGLNDPILLQYWHWLSQLLQGNFGQSIDSNVPVLQIIQNYF
Sbjct  61   RVILGPEASEATVQILREQLGLNDPILLQYWHWLSQLLQGNFGQSIDSNVPVLQIIQNYF  120

Query  121  GNTVALTSLVIVVTVPLSVVLGVWLSLHRDSKLDRIVVSSSIVFKAVPGFVIAIWLMMFF  180
            GNTVALTSLVIVVTVPLSVVLGVWLSLHRDSKLDRIVVSSSIVFKAVPGFVIAIWLMMFF
Sbjct  121  GNTVALTSLVIVVTVPLSVVLGVWLSLHRDSKLDRIVVSSSIVFKAVPGFVIAIWLMMFF  180

Query  181  STSVLHVLPAASLLIPNESPYSQLEFLILPILTLALSLTPYLMRLVRGSMIDALESEYVT  240
            STSVLHVLPAASLLIPNESPYSQLEFLILPILTLALSLTPYLMRLVRGSMIDALESEYVT
Sbjct  181  STSVLHVLPAASLLIPNESPYSQLEFLILPILTLALSLTPYLMRLVRGSMIDALESEYVT  240

Query  241  SARLRGIPERRIIWKHVLPNALVPVVQGTALTIRVLLSGALIIEVVFSYPGIGNALNAAI  300
            SARLRGIPERRIIWKHVLPNALVPVVQGTALTIRVLLSGALIIEVVFSYPGIGNALNAAI
Sbjct  241  SARLRGIPERRIIWKHVLPNALVPVVQGTALTIRVLLSGALIIEVVFSYPGIGNALNAAI  300

Query  301  EMRDIPTIQAIVLLLTICVVMVNLIADLITTLLTPKIRTAKRHKARSPGRRQALRLWKSG  360
            EMRDIPTIQAIVLLLTICVVMVNLIADLITTLLTPKIRTAKRHKARSPGRRQALRLWKSG
Sbjct  301  EMRDIPTIQAIVLLLTICVVMVNLIADLITTLLTPKIRTAKRHKARSPGRRQALRLWKSG  360

Query  361  RPITVKPVDRRNALKNIQQGGGK  383
            RPITVKPVDRRNALKNIQQGGGK
Sbjct  361  RPITVKPVDRRNALKNIQQGGGK  383


> N9QIA8 ABC transmembrane type-1 domain-containing protein [Acinetobacter 
sp. NIPH 542]
Length=383

 Score =  726 bits (1873),  Expect = 0.0
 Identities = 374/383 (98%), Positives = 380/383 (99%), Gaps = 0/383 (0%)

Query  1    MTIQSSKIEASIQQPAITKSFEFPAWLPWFLTRLVSGILVVFVISLVVFIATQALPSDPA  60
            MTIQSSKIEASIQQPAI KSFEFPAWLPWFLTRLVSG+LVVFVISL+VFIATQALPSDPA
Sbjct  1    MTIQSSKIEASIQQPAIAKSFEFPAWLPWFLTRLVSGVLVVFVISLIVFIATQALPSDPA  60

Query  61   RVILGPEASEATVQILREQLGLNDPILLQYWHWLSQLLQGNFGQSIDSNVPVLQIIQNYF  120
            RVILGPEA EATVQILREQLGLNDPILLQYWHWLSQLLQGNFG+SIDSNVPVLQIIQNYF
Sbjct  61   RVILGPEAPEATVQILREQLGLNDPILLQYWHWLSQLLQGNFGRSIDSNVPVLQIIQNYF  120

Query  121  GNTVALTSLVIVVTVPLSVVLGVWLSLHRDSKLDRIVVSSSIVFKAVPGFVIAIWLMMFF  180
            GNTVALTSLVIVVTVPLSVVLGVWLSLHRDSKLDRI+VSSSIVFKAVPGFVIAIWLMMFF
Sbjct  121  GNTVALTSLVIVVTVPLSVVLGVWLSLHRDSKLDRIIVSSSIVFKAVPGFVIAIWLMMFF  180

Query  181  STSVLHVLPAASLLIPNESPYSQLEFLILPILTLALSLTPYLMRLVRGSMIDALESEYVT  240
            STSVLH+LPAASLLIPNESPYSQLEFLILPILTLALSL PYLMRLVRGSMIDALESEYVT
Sbjct  181  STSVLHILPAASLLIPNESPYSQLEFLILPILTLALSLIPYLMRLVRGSMIDALESEYVT  240

Query  241  SARLRGIPERRIIWKHVLPNALVPVVQGTALTIRVLLSGALIIEVVFSYPGIGNALNAAI  300
            SARLRGIPERRIIWKHVLPNALVPVVQGTALTIRVLLSGALIIEVVFSYPGIGNALNAAI
Sbjct  241  SARLRGIPERRIIWKHVLPNALVPVVQGTALTIRVLLSGALIIEVVFSYPGIGNALNAAI  300

Query  301  EMRDIPTIQAIVLLLTICVVMVNLIADLITTLLTPKIRTAKRHKARSPGRRQALRLWKSG  360
            EMRDIPTIQAIVLLLTICVV+VNLIADLITTLLTPKIRTAKRHKARSPGRRQALRLWKSG
Sbjct  301  EMRDIPTIQAIVLLLTICVVVVNLIADLITTLLTPKIRTAKRHKARSPGRRQALRLWKSG  360

Query  361  RPITVKPVDRRNALKNIQQGGGK  383
            RPITVKPVDRRNALKNIQQGGGK
Sbjct  361  RPITVKPVDRRNALKNIQQGGGK  383


> A0A1V2USY3 Peptide ABC transporter permease [Acinetobacter genomosp. 
33YU]
Length=383

 Score =  725 bits (1871),  Expect = 0.0
 Identities = 373/383 (97%), Positives = 380/383 (99%), Gaps = 0/383 (0%)

Query  1    MTIQSSKIEASIQQPAITKSFEFPAWLPWFLTRLVSGILVVFVISLVVFIATQALPSDPA  60
            MTIQSSKIEASIQQPAI KSFEFPAWLPWFLTRLVSG+LVVFVISL+VFIATQALPSDPA
Sbjct  1    MTIQSSKIEASIQQPAIAKSFEFPAWLPWFLTRLVSGVLVVFVISLIVFIATQALPSDPA  60

Query  61   RVILGPEASEATVQILREQLGLNDPILLQYWHWLSQLLQGNFGQSIDSNVPVLQIIQNYF  120
            RVILGPEA EATVQILREQLGLNDPILLQYWHWLSQLLQGNFG+SIDSNVPVLQIIQNYF
Sbjct  61   RVILGPEAPEATVQILREQLGLNDPILLQYWHWLSQLLQGNFGRSIDSNVPVLQIIQNYF  120

Query  121  GNTVALTSLVIVVTVPLSVVLGVWLSLHRDSKLDRIVVSSSIVFKAVPGFVIAIWLMMFF  180
            GNTVALTSLVIVVTVP+SVVLGVWLSLHRDSKLDRI+VSSSIVFKAVPGFVIAIWLMMFF
Sbjct  121  GNTVALTSLVIVVTVPISVVLGVWLSLHRDSKLDRIIVSSSIVFKAVPGFVIAIWLMMFF  180

Query  181  STSVLHVLPAASLLIPNESPYSQLEFLILPILTLALSLTPYLMRLVRGSMIDALESEYVT  240
            STSVLH+LPAASLLIPNESPYSQLEFLILPILTLALSL PYLMRLVRGSMIDALESEYVT
Sbjct  181  STSVLHILPAASLLIPNESPYSQLEFLILPILTLALSLIPYLMRLVRGSMIDALESEYVT  240

Query  241  SARLRGIPERRIIWKHVLPNALVPVVQGTALTIRVLLSGALIIEVVFSYPGIGNALNAAI  300
            SARLRGIPERRIIWKHVLPNALVPVVQGTALTIRVLLSGALIIEVVFSYPGIGNALNAAI
Sbjct  241  SARLRGIPERRIIWKHVLPNALVPVVQGTALTIRVLLSGALIIEVVFSYPGIGNALNAAI  300

Query  301  EMRDIPTIQAIVLLLTICVVMVNLIADLITTLLTPKIRTAKRHKARSPGRRQALRLWKSG  360
            EMRDIPTIQAIVLLLTICVV+VNLIADLITTLLTPKIRTAKRHKARSPGRRQALRLWKSG
Sbjct  301  EMRDIPTIQAIVLLLTICVVVVNLIADLITTLLTPKIRTAKRHKARSPGRRQALRLWKSG  360

Query  361  RPITVKPVDRRNALKNIQQGGGK  383
            RPITVKPVDRRNALKNIQQGGGK
Sbjct  361  RPITVKPVDRRNALKNIQQGGGK  383


> A0A1Y3F9T7 Peptide ABC transporter membrane protein [Acinetobacter 
seifertii]
Length=383

 Score =  725 bits (1871),  Expect = 0.0
 Identities = 373/383 (97%), Positives = 380/383 (99%), Gaps = 0/383 (0%)

Query  1    MTIQSSKIEASIQQPAITKSFEFPAWLPWFLTRLVSGILVVFVISLVVFIATQALPSDPA  60
            MTIQSSKIEASIQQPAI KSFEFPAWLPWFLTRLVSG+LVVFVISL+VFIATQALPSDPA
Sbjct  1    MTIQSSKIEASIQQPAIAKSFEFPAWLPWFLTRLVSGVLVVFVISLIVFIATQALPSDPA  60

Query  61   RVILGPEASEATVQILREQLGLNDPILLQYWHWLSQLLQGNFGQSIDSNVPVLQIIQNYF  120
            RVILGPEA EATVQILREQLGLNDPILLQYWHWLSQLLQGNFG+SIDSNVPVLQIIQNYF
Sbjct  61   RVILGPEAPEATVQILREQLGLNDPILLQYWHWLSQLLQGNFGRSIDSNVPVLQIIQNYF  120

Query  121  GNTVALTSLVIVVTVPLSVVLGVWLSLHRDSKLDRIVVSSSIVFKAVPGFVIAIWLMMFF  180
            GNTVALTSLVIVVTVP+SVVLGVWLSLHRDSKLDRI+VSSSIVFKAVPGFVIAIWLMMFF
Sbjct  121  GNTVALTSLVIVVTVPISVVLGVWLSLHRDSKLDRIIVSSSIVFKAVPGFVIAIWLMMFF  180

Query  181  STSVLHVLPAASLLIPNESPYSQLEFLILPILTLALSLTPYLMRLVRGSMIDALESEYVT  240
            STSVLH+LPAASLLIPNESPYSQLEFLILPILTLALSL PYLMRLVRGSMIDALESEYVT
Sbjct  181  STSVLHILPAASLLIPNESPYSQLEFLILPILTLALSLIPYLMRLVRGSMIDALESEYVT  240

Query  241  SARLRGIPERRIIWKHVLPNALVPVVQGTALTIRVLLSGALIIEVVFSYPGIGNALNAAI  300
            SARLRGIPERRIIWKHVLPNALVPVVQGTALTIRVLLSGALIIEVVFSYPGIGNALNAAI
Sbjct  241  SARLRGIPERRIIWKHVLPNALVPVVQGTALTIRVLLSGALIIEVVFSYPGIGNALNAAI  300

Query  301  EMRDIPTIQAIVLLLTICVVMVNLIADLITTLLTPKIRTAKRHKARSPGRRQALRLWKSG  360
            EMRDIPTIQAIVLLLTICVV+VNLIADLITTLLTPKIRTAKRHKARSPGRRQALRLWKSG
Sbjct  301  EMRDIPTIQAIVLLLTICVVVVNLIADLITTLLTPKIRTAKRHKARSPGRRQALRLWKSG  360

Query  361  RPITVKPVDRRNALKNIQQGGGK  383
            RPITVKPVDRRNALKNIQQGGGK
Sbjct  361  RPITVKPVDRRNALKNIQQGGGK  383


> D8JK14 Peptide ABC transporter membrane protein [Acinetobacter 
oleivorans (strain JCM 16667 / KCTC 23045 / DR1)]
Length=383

 Score =  724 bits (1870),  Expect = 0.0
 Identities = 373/383 (97%), Positives = 380/383 (99%), Gaps = 0/383 (0%)

Query  1    MTIQSSKIEASIQQPAITKSFEFPAWLPWFLTRLVSGILVVFVISLVVFIATQALPSDPA  60
            MTIQSSKIEASIQQPAI KSFEFPAWLPWFLTRLVSG+LVVFVISL+VFIATQALPSDPA
Sbjct  1    MTIQSSKIEASIQQPAIAKSFEFPAWLPWFLTRLVSGVLVVFVISLIVFIATQALPSDPA  60

Query  61   RVILGPEASEATVQILREQLGLNDPILLQYWHWLSQLLQGNFGQSIDSNVPVLQIIQNYF  120
            RVILGPEA EATVQILREQLGLNDPILLQYWHWLSQLLQGNFG+SIDSNVPVL+IIQNYF
Sbjct  61   RVILGPEAPEATVQILREQLGLNDPILLQYWHWLSQLLQGNFGRSIDSNVPVLEIIQNYF  120

Query  121  GNTVALTSLVIVVTVPLSVVLGVWLSLHRDSKLDRIVVSSSIVFKAVPGFVIAIWLMMFF  180
            GNTVALTSLVIVVTVPLSVVLGVWLSLHRDSKLDRI+VSSSIVFKAVPGFVIAIWLMMFF
Sbjct  121  GNTVALTSLVIVVTVPLSVVLGVWLSLHRDSKLDRIIVSSSIVFKAVPGFVIAIWLMMFF  180

Query  181  STSVLHVLPAASLLIPNESPYSQLEFLILPILTLALSLTPYLMRLVRGSMIDALESEYVT  240
            STSVLH+LPAASLLIPNESPYSQLEFLILPILTLALSL PYLMRLVRGSMIDALESEYVT
Sbjct  181  STSVLHILPAASLLIPNESPYSQLEFLILPILTLALSLIPYLMRLVRGSMIDALESEYVT  240

Query  241  SARLRGIPERRIIWKHVLPNALVPVVQGTALTIRVLLSGALIIEVVFSYPGIGNALNAAI  300
            SARLRGIPERRIIWKHVLPNALVPVVQGTALTIRVLLSGALIIEVVFSYPGIGNALNAAI
Sbjct  241  SARLRGIPERRIIWKHVLPNALVPVVQGTALTIRVLLSGALIIEVVFSYPGIGNALNAAI  300

Query  301  EMRDIPTIQAIVLLLTICVVMVNLIADLITTLLTPKIRTAKRHKARSPGRRQALRLWKSG  360
            EMRDIPTIQAIVLLLTICVV+VNLIADLITTLLTPKIRTAKRHKARSPGRRQALRLWKSG
Sbjct  301  EMRDIPTIQAIVLLLTICVVVVNLIADLITTLLTPKIRTAKRHKARSPGRRQALRLWKSG  360

Query  361  RPITVKPVDRRNALKNIQQGGGK  383
            RPITVKPVDRRNALKNIQQGGGK
Sbjct  361  RPITVKPVDRRNALKNIQQGGGK  383


> R8YYQ6 ABC transmembrane type-1 domain-containing protein [Acinetobacter 
lactucae]
Length=383

 Score =  724 bits (1870),  Expect = 0.0
 Identities = 373/383 (97%), Positives = 380/383 (99%), Gaps = 0/383 (0%)

Query  1    MTIQSSKIEASIQQPAITKSFEFPAWLPWFLTRLVSGILVVFVISLVVFIATQALPSDPA  60
            MTIQSSKIEASIQQPAI KSFEFPAWLPWFLTRLVSG+LVVFVISL+VFIATQALPSDPA
Sbjct  1    MTIQSSKIEASIQQPAIAKSFEFPAWLPWFLTRLVSGVLVVFVISLIVFIATQALPSDPA  60

Query  61   RVILGPEASEATVQILREQLGLNDPILLQYWHWLSQLLQGNFGQSIDSNVPVLQIIQNYF  120
            RVILGPEA EATVQILR+QLGLNDPILLQYWHWLSQLLQGNFG+SIDSNVPVLQIIQNYF
Sbjct  61   RVILGPEAPEATVQILRQQLGLNDPILLQYWHWLSQLLQGNFGRSIDSNVPVLQIIQNYF  120

Query  121  GNTVALTSLVIVVTVPLSVVLGVWLSLHRDSKLDRIVVSSSIVFKAVPGFVIAIWLMMFF  180
            GNTVALTSLVIVVTVPLSVVLGVWLSLHRDSKLDRI+VSSSIVFKAVPGFVIAIWLMMFF
Sbjct  121  GNTVALTSLVIVVTVPLSVVLGVWLSLHRDSKLDRIIVSSSIVFKAVPGFVIAIWLMMFF  180

Query  181  STSVLHVLPAASLLIPNESPYSQLEFLILPILTLALSLTPYLMRLVRGSMIDALESEYVT  240
            STSVLH+LPAASLLIPNESPYSQLEFLILPILTLALSL PYLMRLVRGSMIDALESEYVT
Sbjct  181  STSVLHILPAASLLIPNESPYSQLEFLILPILTLALSLIPYLMRLVRGSMIDALESEYVT  240

Query  241  SARLRGIPERRIIWKHVLPNALVPVVQGTALTIRVLLSGALIIEVVFSYPGIGNALNAAI  300
            SARLRGIPERRIIWKHVLPNALVPVVQGTALTIRVLLSGALIIEVVFSYPGIGNALNAAI
Sbjct  241  SARLRGIPERRIIWKHVLPNALVPVVQGTALTIRVLLSGALIIEVVFSYPGIGNALNAAI  300

Query  301  EMRDIPTIQAIVLLLTICVVMVNLIADLITTLLTPKIRTAKRHKARSPGRRQALRLWKSG  360
            EMRDIPTIQAIVLLLTICVV+VNLIADLITTLLTPKIRTAKRHKARSPGRRQALRLWKSG
Sbjct  301  EMRDIPTIQAIVLLLTICVVVVNLIADLITTLLTPKIRTAKRHKARSPGRRQALRLWKSG  360

Query  361  RPITVKPVDRRNALKNIQQGGGK  383
            RPITVKPVDRRNALKNIQQGGGK
Sbjct  361  RPITVKPVDRRNALKNIQQGGGK  383


> A0A2M8MMI8 ABC transporter permease [Acinetobacter seifertii]
Length=383

 Score =  724 bits (1870),  Expect = 0.0
 Identities = 373/383 (97%), Positives = 380/383 (99%), Gaps = 0/383 (0%)

Query  1    MTIQSSKIEASIQQPAITKSFEFPAWLPWFLTRLVSGILVVFVISLVVFIATQALPSDPA  60
            MTIQSSKIEASIQQPAI KSFEFPAWLPWFLTRLVSG+LVVFVISL+VFIATQALPSDPA
Sbjct  1    MTIQSSKIEASIQQPAIAKSFEFPAWLPWFLTRLVSGVLVVFVISLIVFIATQALPSDPA  60

Query  61   RVILGPEASEATVQILREQLGLNDPILLQYWHWLSQLLQGNFGQSIDSNVPVLQIIQNYF  120
            RVILGPEA EATVQILR+QLGLNDPILLQYWHWLSQLLQGNFG+SIDSNVPVLQIIQNYF
Sbjct  61   RVILGPEAPEATVQILRQQLGLNDPILLQYWHWLSQLLQGNFGRSIDSNVPVLQIIQNYF  120

Query  121  GNTVALTSLVIVVTVPLSVVLGVWLSLHRDSKLDRIVVSSSIVFKAVPGFVIAIWLMMFF  180
            GNTVALTSLVIVVTVPLSVVLGVWLSLHRDSKLDRI+VSSSIVFKAVPGFVIAIWLMMFF
Sbjct  121  GNTVALTSLVIVVTVPLSVVLGVWLSLHRDSKLDRIIVSSSIVFKAVPGFVIAIWLMMFF  180

Query  181  STSVLHVLPAASLLIPNESPYSQLEFLILPILTLALSLTPYLMRLVRGSMIDALESEYVT  240
            STSVLH+LPAASLLIPNESPYSQLEFLILPILTLALSL PYLMRLVRGSMIDALESEYVT
Sbjct  181  STSVLHILPAASLLIPNESPYSQLEFLILPILTLALSLIPYLMRLVRGSMIDALESEYVT  240

Query  241  SARLRGIPERRIIWKHVLPNALVPVVQGTALTIRVLLSGALIIEVVFSYPGIGNALNAAI  300
            SARLRGIPERRIIWKHVLPNALVPVVQGTALTIRVLLSGALIIEVVFSYPGIGNALNAAI
Sbjct  241  SARLRGIPERRIIWKHVLPNALVPVVQGTALTIRVLLSGALIIEVVFSYPGIGNALNAAI  300

Query  301  EMRDIPTIQAIVLLLTICVVMVNLIADLITTLLTPKIRTAKRHKARSPGRRQALRLWKSG  360
            EMRDIPTIQAIVLLLTICVV+VNLIADLITTLLTPKIRTAKRHKARSPGRRQALRLWKSG
Sbjct  301  EMRDIPTIQAIVLLLTICVVVVNLIADLITTLLTPKIRTAKRHKARSPGRRQALRLWKSG  360

Query  361  RPITVKPVDRRNALKNIQQGGGK  383
            RPITVKPVDRRNALKNIQQGGGK
Sbjct  361  RPITVKPVDRRNALKNIQQGGGK  383


> N8QSS4 ABC transmembrane type-1 domain-containing protein [Acinetobacter 
seifertii]
Length=383

 Score =  723 bits (1865),  Expect = 0.0
 Identities = 372/383 (97%), Positives = 379/383 (99%), Gaps = 0/383 (0%)

Query  1    MTIQSSKIEASIQQPAITKSFEFPAWLPWFLTRLVSGILVVFVISLVVFIATQALPSDPA  60
            MTIQSSKIE SIQQPAI KSFEFPAWLPWFLTRLVSG+LVVFVISL+VFIATQALPSDPA
Sbjct  1    MTIQSSKIEESIQQPAIAKSFEFPAWLPWFLTRLVSGVLVVFVISLIVFIATQALPSDPA  60

Query  61   RVILGPEASEATVQILREQLGLNDPILLQYWHWLSQLLQGNFGQSIDSNVPVLQIIQNYF  120
            RVILGPEA EATVQILR+QLGLNDPILLQYWHWLSQLLQGNFG+SIDSNVPVLQIIQNYF
Sbjct  61   RVILGPEAPEATVQILRQQLGLNDPILLQYWHWLSQLLQGNFGRSIDSNVPVLQIIQNYF  120

Query  121  GNTVALTSLVIVVTVPLSVVLGVWLSLHRDSKLDRIVVSSSIVFKAVPGFVIAIWLMMFF  180
            GNTVALTSLVIVVTVPLSVVLGVWLSLHRDSKLDRI+VSSSIVFKAVPGFVIAIWLMMFF
Sbjct  121  GNTVALTSLVIVVTVPLSVVLGVWLSLHRDSKLDRIIVSSSIVFKAVPGFVIAIWLMMFF  180

Query  181  STSVLHVLPAASLLIPNESPYSQLEFLILPILTLALSLTPYLMRLVRGSMIDALESEYVT  240
            STSVLH+LPAASLLIPNESPYSQLEFLILPILTLALSL PYLMRLVRGSMIDALESEYVT
Sbjct  181  STSVLHILPAASLLIPNESPYSQLEFLILPILTLALSLIPYLMRLVRGSMIDALESEYVT  240

Query  241  SARLRGIPERRIIWKHVLPNALVPVVQGTALTIRVLLSGALIIEVVFSYPGIGNALNAAI  300
            SARLRGIPERRIIWKHVLPNALVPVVQGTALTIRVLLSGALIIEVVFSYPGIGNALNAAI
Sbjct  241  SARLRGIPERRIIWKHVLPNALVPVVQGTALTIRVLLSGALIIEVVFSYPGIGNALNAAI  300

Query  301  EMRDIPTIQAIVLLLTICVVMVNLIADLITTLLTPKIRTAKRHKARSPGRRQALRLWKSG  360
            EMRDIPTIQAIVLLLTICVV+VNLIADLITTLLTPKIRTAKRHKARSPGRRQALRLWKSG
Sbjct  301  EMRDIPTIQAIVLLLTICVVVVNLIADLITTLLTPKIRTAKRHKARSPGRRQALRLWKSG  360

Query  361  RPITVKPVDRRNALKNIQQGGGK  383
            RPITVKPVDRRNALKNIQQGGGK
Sbjct  361  RPITVKPVDRRNALKNIQQGGGK  383


> A0A2T5QKU7 Peptide ABC transporter permease [Acinetobacter oleivorans]
Length=383

 Score =  722 bits (1864),  Expect = 0.0
 Identities = 372/383 (97%), Positives = 379/383 (99%), Gaps = 0/383 (0%)

Query  1    MTIQSSKIEASIQQPAITKSFEFPAWLPWFLTRLVSGILVVFVISLVVFIATQALPSDPA  60
            MTIQSSKIEASIQQPAI KSFEFPAWLPWFLTRLVSGILVVFVISL+VFIATQALPSDPA
Sbjct  1    MTIQSSKIEASIQQPAIAKSFEFPAWLPWFLTRLVSGILVVFVISLIVFIATQALPSDPA  60

Query  61   RVILGPEASEATVQILREQLGLNDPILLQYWHWLSQLLQGNFGQSIDSNVPVLQIIQNYF  120
            RVILGPEA EATVQILREQLGLNDPILLQYWHWLSQLLQGNFG+SIDSNVPVL+IIQNYF
Sbjct  61   RVILGPEAPEATVQILREQLGLNDPILLQYWHWLSQLLQGNFGRSIDSNVPVLEIIQNYF  120

Query  121  GNTVALTSLVIVVTVPLSVVLGVWLSLHRDSKLDRIVVSSSIVFKAVPGFVIAIWLMMFF  180
            GNTVALTSLVIVVTVP+SVVLGVWLSLHRDSKLDRI+VSSSIVFKAVPGFVIAIWLMMFF
Sbjct  121  GNTVALTSLVIVVTVPISVVLGVWLSLHRDSKLDRIIVSSSIVFKAVPGFVIAIWLMMFF  180

Query  181  STSVLHVLPAASLLIPNESPYSQLEFLILPILTLALSLTPYLMRLVRGSMIDALESEYVT  240
            STSVLH+LPAASLLIPNESPYSQLEFLILPILTLALSL PYLMRLVRGSMIDALESEYVT
Sbjct  181  STSVLHILPAASLLIPNESPYSQLEFLILPILTLALSLIPYLMRLVRGSMIDALESEYVT  240

Query  241  SARLRGIPERRIIWKHVLPNALVPVVQGTALTIRVLLSGALIIEVVFSYPGIGNALNAAI  300
            SARLRGIPE RIIWKHVLPNALVPVVQGTALTIRVLLSGALIIEVVFSYPGIGNALNAAI
Sbjct  241  SARLRGIPEHRIIWKHVLPNALVPVVQGTALTIRVLLSGALIIEVVFSYPGIGNALNAAI  300

Query  301  EMRDIPTIQAIVLLLTICVVMVNLIADLITTLLTPKIRTAKRHKARSPGRRQALRLWKSG  360
            EMRDIPTIQAIVLLLTICVV+VNLIADLITTLLTPKIRTAKRHKARSPGRRQALRLWKSG
Sbjct  301  EMRDIPTIQAIVLLLTICVVVVNLIADLITTLLTPKIRTAKRHKARSPGRRQALRLWKSG  360

Query  361  RPITVKPVDRRNALKNIQQGGGK  383
            RPITVKPVDRRNALKNIQQGGGK
Sbjct  361  RPITVKPVDRRNALKNIQQGGGK  383


> A0A0M3FG56 ABC transporter permease [Acinetobacter baumannii]
Length=383

 Score =  721 bits (1861),  Expect = 0.0
 Identities = 370/383 (97%), Positives = 379/383 (99%), Gaps = 0/383 (0%)

Query  1    MTIQSSKIEASIQQPAITKSFEFPAWLPWFLTRLVSGILVVFVISLVVFIATQALPSDPA  60
            MTIQSSKIEASIQQP I KSFEFPAWLPWFLTRLVSG+LVVFVISL+VFIATQALPSDPA
Sbjct  1    MTIQSSKIEASIQQPTIAKSFEFPAWLPWFLTRLVSGVLVVFVISLIVFIATQALPSDPA  60

Query  61   RVILGPEASEATVQILREQLGLNDPILLQYWHWLSQLLQGNFGQSIDSNVPVLQIIQNYF  120
            RVILGPEA EATVQILREQLGLNDPILLQYWHWLSQLLQGNFG+SIDSNVPVL+IIQNYF
Sbjct  61   RVILGPEAPEATVQILREQLGLNDPILLQYWHWLSQLLQGNFGRSIDSNVPVLEIIQNYF  120

Query  121  GNTVALTSLVIVVTVPLSVVLGVWLSLHRDSKLDRIVVSSSIVFKAVPGFVIAIWLMMFF  180
            GNTVALT+LVIVVTVP+SVVLGVWLSLHRDSKLDRI+VSSSIVFKAVPGFVIAIWLMMFF
Sbjct  121  GNTVALTNLVIVVTVPISVVLGVWLSLHRDSKLDRIIVSSSIVFKAVPGFVIAIWLMMFF  180

Query  181  STSVLHVLPAASLLIPNESPYSQLEFLILPILTLALSLTPYLMRLVRGSMIDALESEYVT  240
            STSVLH+LPAASLLIPNESPYSQLEFLILPILTLALSL PYLMRLVRGSMIDALESEYVT
Sbjct  181  STSVLHILPAASLLIPNESPYSQLEFLILPILTLALSLIPYLMRLVRGSMIDALESEYVT  240

Query  241  SARLRGIPERRIIWKHVLPNALVPVVQGTALTIRVLLSGALIIEVVFSYPGIGNALNAAI  300
            SARLRGIPERRIIWKHVLPNALVPVVQGTALTIRVLLSGALIIEVVFSYPGIGNALNAAI
Sbjct  241  SARLRGIPERRIIWKHVLPNALVPVVQGTALTIRVLLSGALIIEVVFSYPGIGNALNAAI  300

Query  301  EMRDIPTIQAIVLLLTICVVMVNLIADLITTLLTPKIRTAKRHKARSPGRRQALRLWKSG  360
            EMRDIPTIQAIVLLLTICVV+VNLIADLITTLLTPKIRTAKRHKARSPGRRQALRLWKSG
Sbjct  301  EMRDIPTIQAIVLLLTICVVVVNLIADLITTLLTPKIRTAKRHKARSPGRRQALRLWKSG  360

Query  361  RPITVKPVDRRNALKNIQQGGGK  383
            RPITVKPVDRRNALKNIQQGGGK
Sbjct  361  RPITVKPVDRRNALKNIQQGGGK  383


> A0A0R0RUW6 Peptide ABC transporter permease [Acinetobacter pittii]
Length=383

 Score =  721 bits (1861),  Expect = 0.0
 Identities = 370/383 (97%), Positives = 379/383 (99%), Gaps = 0/383 (0%)

Query  1    MTIQSSKIEASIQQPAITKSFEFPAWLPWFLTRLVSGILVVFVISLVVFIATQALPSDPA  60
            MTIQSSKIEASIQQP I KSFEFPAWLPWFLTRLVSG+LVVFVISL+VFIATQALPSDPA
Sbjct  1    MTIQSSKIEASIQQPTIAKSFEFPAWLPWFLTRLVSGVLVVFVISLIVFIATQALPSDPA  60

Query  61   RVILGPEASEATVQILREQLGLNDPILLQYWHWLSQLLQGNFGQSIDSNVPVLQIIQNYF  120
            RVILGPEA EATVQILREQLGLNDPILLQYWHWLSQLLQGNFG+SIDSNVPVL+IIQNYF
Sbjct  61   RVILGPEAPEATVQILREQLGLNDPILLQYWHWLSQLLQGNFGRSIDSNVPVLEIIQNYF  120

Query  121  GNTVALTSLVIVVTVPLSVVLGVWLSLHRDSKLDRIVVSSSIVFKAVPGFVIAIWLMMFF  180
            GNTVALT+LVIVVTVP+SVVLGVWLSLHRDSKLDRI+VSSSIVFKAVPGFVIAIWLMMFF
Sbjct  121  GNTVALTNLVIVVTVPISVVLGVWLSLHRDSKLDRIIVSSSIVFKAVPGFVIAIWLMMFF  180

Query  181  STSVLHVLPAASLLIPNESPYSQLEFLILPILTLALSLTPYLMRLVRGSMIDALESEYVT  240
            STSVLH+LPAASLLIPNESPYSQLEFLILPILTLALSL PYLMRLVRGSMIDALESEYVT
Sbjct  181  STSVLHILPAASLLIPNESPYSQLEFLILPILTLALSLIPYLMRLVRGSMIDALESEYVT  240

Query  241  SARLRGIPERRIIWKHVLPNALVPVVQGTALTIRVLLSGALIIEVVFSYPGIGNALNAAI  300
            SARLRGIPERRIIWKHVLPNALVPVVQGTALTIRVLLSGALIIEVVFSYPGIGNALNAAI
Sbjct  241  SARLRGIPERRIIWKHVLPNALVPVVQGTALTIRVLLSGALIIEVVFSYPGIGNALNAAI  300

Query  301  EMRDIPTIQAIVLLLTICVVMVNLIADLITTLLTPKIRTAKRHKARSPGRRQALRLWKSG  360
            EMRDIPTIQAIVLLLTICVV+VNLIADLITTLLTPKIRTAKRHKARSPGRRQALRLWKSG
Sbjct  301  EMRDIPTIQAIVLLLTICVVVVNLIADLITTLLTPKIRTAKRHKARSPGRRQALRLWKSG  360

Query  361  RPITVKPVDRRNALKNIQQGGGK  383
            RPITVKPVDRRNALKNIQQGGGK
Sbjct  361  RPITVKPVDRRNALKNIQQGGGK  383


> A0A009JIZ9 Binding--dependent transport system inner membrane 
component family protein [Acinetobacter baumannii 1419130]
Length=383

 Score =  720 bits (1858),  Expect = 0.0
 Identities = 370/383 (97%), Positives = 378/383 (99%), Gaps = 0/383 (0%)

Query  1    MTIQSSKIEASIQQPAITKSFEFPAWLPWFLTRLVSGILVVFVISLVVFIATQALPSDPA  60
            M IQSSKIEASIQQP I KSFEFPAWLPWFLTRLVSG+LVVFVISL+VFIATQALPSDPA
Sbjct  1    MAIQSSKIEASIQQPTIAKSFEFPAWLPWFLTRLVSGVLVVFVISLIVFIATQALPSDPA  60

Query  61   RVILGPEASEATVQILREQLGLNDPILLQYWHWLSQLLQGNFGQSIDSNVPVLQIIQNYF  120
            RVILGPEA EATVQILREQLGLNDPILLQYWHWLSQLLQGNFG+SIDSNVPVL+IIQNYF
Sbjct  61   RVILGPEAPEATVQILREQLGLNDPILLQYWHWLSQLLQGNFGRSIDSNVPVLEIIQNYF  120

Query  121  GNTVALTSLVIVVTVPLSVVLGVWLSLHRDSKLDRIVVSSSIVFKAVPGFVIAIWLMMFF  180
            GNTVALTSLVIVVTVPLSVVLGVWLSLHRDSKLDRI+VSSSIVFKAVPGFVIAIWLMMFF
Sbjct  121  GNTVALTSLVIVVTVPLSVVLGVWLSLHRDSKLDRIIVSSSIVFKAVPGFVIAIWLMMFF  180

Query  181  STSVLHVLPAASLLIPNESPYSQLEFLILPILTLALSLTPYLMRLVRGSMIDALESEYVT  240
            STSVLH+LPAASLLIPNESPYSQLEFLILPILTLALSL PYLMRLVRGSMIDALESEYVT
Sbjct  181  STSVLHILPAASLLIPNESPYSQLEFLILPILTLALSLIPYLMRLVRGSMIDALESEYVT  240

Query  241  SARLRGIPERRIIWKHVLPNALVPVVQGTALTIRVLLSGALIIEVVFSYPGIGNALNAAI  300
            SARLRGIPERRIIWKHVLPNALVPVVQGTALTIRVLLSGALIIEVVFSYPGIGNALNAAI
Sbjct  241  SARLRGIPERRIIWKHVLPNALVPVVQGTALTIRVLLSGALIIEVVFSYPGIGNALNAAI  300

Query  301  EMRDIPTIQAIVLLLTICVVMVNLIADLITTLLTPKIRTAKRHKARSPGRRQALRLWKSG  360
            EMRDIPTIQAIVLL+TICVV+VNLIADLITTLLTPKIRTAKRHKARSPGRRQALRLWKSG
Sbjct  301  EMRDIPTIQAIVLLVTICVVVVNLIADLITTLLTPKIRTAKRHKARSPGRRQALRLWKSG  360

Query  361  RPITVKPVDRRNALKNIQQGGGK  383
            RPITVKPVDRRNALKNIQQGGGK
Sbjct  361  RPITVKPVDRRNALKNIQQGGGK  383


> F0KP74 Putative dipeptide transport protein (ABC superfamily, 
membrane) [Acinetobacter calcoaceticus (strain PHEA-2)]
Length=383

 Score =  720 bits (1858),  Expect = 0.0
 Identities = 371/383 (97%), Positives = 377/383 (98%), Gaps = 0/383 (0%)

Query  1    MTIQSSKIEASIQQPAITKSFEFPAWLPWFLTRLVSGILVVFVISLVVFIATQALPSDPA  60
            M IQSSKIEASIQQP I KSFEFPAWLPWFLTRLVSG+LVVFVISL+VFIATQALPSDPA
Sbjct  1    MAIQSSKIEASIQQPTIAKSFEFPAWLPWFLTRLVSGVLVVFVISLIVFIATQALPSDPA  60

Query  61   RVILGPEASEATVQILREQLGLNDPILLQYWHWLSQLLQGNFGQSIDSNVPVLQIIQNYF  120
            RVILGPEA EATVQILREQLGLNDPILLQYWHWLSQLLQGNFG+SIDSNVPVLQIIQNYF
Sbjct  61   RVILGPEAPEATVQILREQLGLNDPILLQYWHWLSQLLQGNFGRSIDSNVPVLQIIQNYF  120

Query  121  GNTVALTSLVIVVTVPLSVVLGVWLSLHRDSKLDRIVVSSSIVFKAVPGFVIAIWLMMFF  180
            GNTVALTSLVIVVTVPLSVVLGVWLSLHRDSKLDRI+V SSIVFKAVPGFVIAIWLMMFF
Sbjct  121  GNTVALTSLVIVVTVPLSVVLGVWLSLHRDSKLDRIIVYSSIVFKAVPGFVIAIWLMMFF  180

Query  181  STSVLHVLPAASLLIPNESPYSQLEFLILPILTLALSLTPYLMRLVRGSMIDALESEYVT  240
            STSVLH+LPAASLLIPNESPYSQLEFLILPILTLALSL PYLMRLVRGSMIDALESEYVT
Sbjct  181  STSVLHILPAASLLIPNESPYSQLEFLILPILTLALSLIPYLMRLVRGSMIDALESEYVT  240

Query  241  SARLRGIPERRIIWKHVLPNALVPVVQGTALTIRVLLSGALIIEVVFSYPGIGNALNAAI  300
            SARLRGIPERRIIWKHVLPNALVPVVQGTALTIRVLLSGALIIEVVFSYPGIGNALNAAI
Sbjct  241  SARLRGIPERRIIWKHVLPNALVPVVQGTALTIRVLLSGALIIEVVFSYPGIGNALNAAI  300

Query  301  EMRDIPTIQAIVLLLTICVVMVNLIADLITTLLTPKIRTAKRHKARSPGRRQALRLWKSG  360
            EMRDIPTIQAIVLLLTICVV+VNLIADLITTLLTPKIRTAKRHKARSPGRRQALRLWKSG
Sbjct  301  EMRDIPTIQAIVLLLTICVVVVNLIADLITTLLTPKIRTAKRHKARSPGRRQALRLWKSG  360

Query  361  RPITVKPVDRRNALKNIQQGGGK  383
            RPITVKPVDRRNALKNIQQGGGK
Sbjct  361  RPITVKPVDRRNALKNIQQGGGK  383


> A0A241YIW9 Peptide ABC transporter permease [Acinetobacter nosocomialis]
Length=383

 Score =  720 bits (1858),  Expect = 0.0
 Identities = 371/383 (97%), Positives = 377/383 (98%), Gaps = 0/383 (0%)

Query  1    MTIQSSKIEASIQQPAITKSFEFPAWLPWFLTRLVSGILVVFVISLVVFIATQALPSDPA  60
            M IQSSKIEASIQQP I KSFEFPAWLPWFLTRLVSG+LVVFVISL+VFIATQALPSDPA
Sbjct  1    MAIQSSKIEASIQQPTIAKSFEFPAWLPWFLTRLVSGVLVVFVISLIVFIATQALPSDPA  60

Query  61   RVILGPEASEATVQILREQLGLNDPILLQYWHWLSQLLQGNFGQSIDSNVPVLQIIQNYF  120
            RVILGPEA EATVQILREQLGLNDPILLQYWHWLSQLLQGNFG+SIDSNVPVLQIIQNYF
Sbjct  61   RVILGPEAPEATVQILREQLGLNDPILLQYWHWLSQLLQGNFGRSIDSNVPVLQIIQNYF  120

Query  121  GNTVALTSLVIVVTVPLSVVLGVWLSLHRDSKLDRIVVSSSIVFKAVPGFVIAIWLMMFF  180
            GNTVALTSLVIVVTVPLSVVLGVWLSLHRDSKLDRI+VSSSIVFKAVPGFVIAIWLMMFF
Sbjct  121  GNTVALTSLVIVVTVPLSVVLGVWLSLHRDSKLDRIIVSSSIVFKAVPGFVIAIWLMMFF  180

Query  181  STSVLHVLPAASLLIPNESPYSQLEFLILPILTLALSLTPYLMRLVRGSMIDALESEYVT  240
            STSVLH+LPAASLLIPNESPYSQLEFLILPILTLALSL PYLMRLVRGSMIDALESEYVT
Sbjct  181  STSVLHILPAASLLIPNESPYSQLEFLILPILTLALSLIPYLMRLVRGSMIDALESEYVT  240

Query  241  SARLRGIPERRIIWKHVLPNALVPVVQGTALTIRVLLSGALIIEVVFSYPGIGNALNAAI  300
            SARLR IPERRIIWKHVLPNALVPVVQGTALTIRVLLSGALIIEVVFSYPGIGNALNAAI
Sbjct  241  SARLRSIPERRIIWKHVLPNALVPVVQGTALTIRVLLSGALIIEVVFSYPGIGNALNAAI  300

Query  301  EMRDIPTIQAIVLLLTICVVMVNLIADLITTLLTPKIRTAKRHKARSPGRRQALRLWKSG  360
            EMRDIPTIQAIVLLLTICVV+VNLIADLITTLLTPKIRTAKRHKARSPGRRQALRLWKSG
Sbjct  301  EMRDIPTIQAIVLLLTICVVVVNLIADLITTLLTPKIRTAKRHKARSPGRRQALRLWKSG  360

Query  361  RPITVKPVDRRNALKNIQQGGGK  383
            RPITVKPVDRRNALKNIQQGGGK
Sbjct  361  RPITVKPVDRRNALKNIQQGGGK  383


> Q44373 OphB [Rhizobium radiobacter]
Length=334

 Score =  197 bits (500),  Expect = 6e-62
 Identities = 104/308 (34%), Positives = 177/308 (57%), Gaps = 1/308 (0%)

Query  31   LTRLVSGILVVFVISLVVFIATQALPSDPARVILGPEASEATVQILREQLGLNDPILLQY  90
            L R+ +G+ ++ V+S ++FI +  LP D A  ILG  A+ A +  LRE+LGLN+P++++Y
Sbjct  25   LKRVAAGLGLLLVLSSLIFIGSTLLPGDAATAILGRSATPAALAELRERLGLNEPLIVRY  84

Query  91   WHWLSQLLQGNFGQSIDSNVPVLQIIQNYFGNTVALTSLVIVVTVPLSVVLGVWLSLHRD  150
              WL+  + G+ G S+ +   V   I    GNT+ L + V +V VPL+V LGV    +R 
Sbjct  85   MSWLNAFVHGDLGSSLINGRSVADSIGARLGNTLFLAASVALVAVPLAVFLGVLSVRYRG  144

Query  151  SKLDRIVVSSSIVFKAVPGFVIAIWLMMFFSTSVLHVLPAASLLIPNESPYSQLEFLILP  210
              LDR +   +  F A+P F I   L+   S S L    ++S +        ++  + LP
Sbjct  145  RVLDRTIALVTRTFVALPEFFIGYLLIYILSVS-LGWFASSSTVFARMGFADRVVAIALP  203

Query  211  ILTLALSLTPYLMRLVRGSMIDALESEYVTSARLRGIPERRIIWKHVLPNALVPVVQGTA  270
             LTL   +T ++  +VR S++D +E  ++  A L+G+    ++W+H LPNAL P++    
Sbjct  204  CLTLVFVVTGHITTMVRASVLDVMERPFIEMAALKGVSHGAVVWRHALPNALSPIINVVL  263

Query  271  LTIRVLLSGALIIEVVFSYPGIGNALNAAIEMRDIPTIQAIVLLLTICVVMVNLIADLIT  330
            + +  L++G +++EV+F YPGIG  +  ++  R +P +QA  LL     + +NL AD+++
Sbjct  264  VNLAYLVAGVVVVEVIFVYPGIGQYMVDSVVNRHVPVVQATALLFAGVYIGLNLCADVLS  323

Query  331  TLLTPKIR  338
             L  P++R
Sbjct  324  VLANPRLR  331


> B3EUP0 Putative peptide ABC transporter, permease protein [Bordetella 
bronchiseptica]
Length=317

 Score =  188 bits (477),  Expect = 9e-59
 Identities = 102/312 (33%), Positives = 177/312 (57%), Gaps = 1/312 (0%)

Query  27   LPWFLTRLVSGILVVFVISLVVFIATQALPSDPARVILGPEASEATVQILREQLGLNDPI  86
            L +   RL   +LV+ +++++VFI ++    DP  ++LG +AS A ++ +R Q GL+ P+
Sbjct  2    LRFLFARLAGAVLVLVLVAVIVFIMSRLAAGDPIALLLGDQASIADIEHVRAQYGLDQPL  61

Query  87   LLQYWHWLSQLLQGNFGQSIDSNVPVLQIIQNYFGNTVALTSLVIVVTVPLSVVLGVWLS  146
              Q+  W+ QLLQGN GQS+    PV Q + +    T+ L    + +   + +  G+  +
Sbjct  62   PTQFALWVEQLLQGNLGQSLFLQQPVAQALLDRAEPTLFLAIFAVGIAALIGIPAGMAAA  121

Query  147  LHRDSKLDRIVVSSSIVFKAVPGFVIAIWLMMFFSTSVLHVLPAASLLIPNESPYSQLEF  206
            + R S  D+   S +++  +VP F + + L+  F+   L   PA+    P+     +L  
Sbjct  122  IWRGSAADQAFSSLAMLGASVPSFWLGLTLIQVFAVQ-LGWFPASGYGDPSAGFSERLGH  180

Query  207  LILPILTLALSLTPYLMRLVRGSMIDALESEYVTSARLRGIPERRIIWKHVLPNALVPVV  266
            L+LP + L L  +  ++R  R +M+D L  +YV +AR +G+ E  ++ KHVL N+LVP++
Sbjct  181  LLLPAIVLGLVNSALIIRFTRAAMLDILGEDYVRTARAKGLGEATVMIKHVLGNSLVPII  240

Query  267  QGTALTIRVLLSGALIIEVVFSYPGIGNALNAAIEMRDIPTIQAIVLLLTICVVMVNLIA  326
                LT+ V++ G ++ E VF+ PG+GN +  A+  RD P IQ  +L++    V +N   
Sbjct  241  TVLGLTMAVMIGGTVVTETVFNLPGVGNLVVRAVLRRDYPVIQGTLLVIAAIYVFINFSI  300

Query  327  DLITTLLTPKIR  338
            D+I TL+ P+IR
Sbjct  301  DIIYTLVDPRIR  312


> O50262 AgaB [Rhizobium radiobacter]
Length=323

 Score =  187 bits (474),  Expect = 3e-58
 Identities = 100/309 (32%), Positives = 177/309 (57%), Gaps = 4/309 (1%)

Query  32   TRLVSGILVVFVISLVVFIATQALPSDPARVILGPEA--SEATVQILREQLGLNDPILLQ  89
            +RL++ ++ ++VI+ +VF     +P DP  ++LGPE+  S   V  +R QLGL+ P++ Q
Sbjct  13   SRLITALVQLWVIATLVFSIMYIMPGDPVLLLLGPESNPSPEAVAAMRHQLGLDQPVMSQ  72

Query  90   YWHWLSQLLQGNFGQSIDSNVPVLQIIQNYFGNTVALTSLVIVVTVPLSVVLGVWLSLHR  149
            Y  WL     G+ G S+D  V V++ I      T+ L +  I++   + V +G+  +L R
Sbjct  73   YLKWLGNAASGDLGNSVDG-VSVVEYITASIPKTMELATAAIILASIIGVPIGIAAALRR  131

Query  150  DSKLDRIVVSSSIVFKAVPGFVIAIWLMMFFSTSVLHVLPAASLLIPNESPYSQLEFLIL  209
               LD ++ S S +  ++P +++   L++ FS   L  LP++     + S +   + L L
Sbjct  132  GRFLDSLLTSLSTLGISLPVYILGSLLILMFSLK-LGWLPSSGYTDISRSVFLHFQKLTL  190

Query  210  PILTLALSLTPYLMRLVRGSMIDALESEYVTSARLRGIPERRIIWKHVLPNALVPVVQGT  269
            P +TL L L   + R+ R SM++ L  ++V S R RG+ ERR+IW HVL NA +P+V   
Sbjct  191  PAVTLGLGLAASIARMTRSSMLEILGRDFVRSLRARGMRERRVIWVHVLRNAAIPIVTII  250

Query  270  ALTIRVLLSGALIIEVVFSYPGIGNALNAAIEMRDIPTIQAIVLLLTICVVMVNLIADLI  329
             L +  L+ G +++E ++++PG+   L  A+  R+ P +Q  +L +    +++NL  D++
Sbjct  251  GLQLGNLMGGTVLVEALYNWPGLSTLLVTAVSNRNYPLVQGSILTIAALFILINLCVDIL  310

Query  330  TTLLTPKIR  338
             +LL P+IR
Sbjct  311  YSLLDPRIR  319


> Q9LCD2 Dipeptide transporter DppB homolog [Ochrobactrum anthropi]
Length=313

 Score =  184 bits (466),  Expect = 3e-57
 Identities = 105/312 (34%), Positives = 178/312 (57%), Gaps = 4/312 (1%)

Query  29   WFLTRLVSGILVVFVISLVVFIATQALPSDPARVILGPEASEATVQILREQLGLNDPILL  88
            + ++RL+  I VV  +++ VF+    +P DP R+++     +  V  +  QLG++ P+L+
Sbjct  6    YVISRLLHAIPVVLGVTICVFLTIHLVPGDPVRIMMHGRIGDDEVAAIYHQLGMDRPLLV  65

Query  89   QYWHWLSQLLQGNFGQSIDSNVPVLQIIQNYFGNTVALTSLVIVVTVPLSVVLGVWLSLH  148
            QY+ ++   L GN G SI    PV  ++      T+ L +   +++V +++ LG+  S +
Sbjct  66   QYFDFVRHALTGNLGTSIVQKAPVTDLVLEKLWPTLLLLAFSTLISVLIAIPLGLVASFY  125

Query  149  RDSKLDRIVVSSSIVFKAVPGFVIAIWLMMFFSTSVLHVLPAASLLIPNESPYSQLEFLI  208
            R+   D  +   S +  A+P + I + L++ F    L   P + +    +     L  L 
Sbjct  126  RNRWPDHAIRLVSSIGFAMPSYWIGLLLILLFGLW-LGWFPISGI---GQGHLEILHHLF  181

Query  209  LPILTLALSLTPYLMRLVRGSMIDALESEYVTSARLRGIPERRIIWKHVLPNALVPVVQG  268
            LP LT++L L P L++ +R SM+D L SEY+  AR +G+ E RI+ KHV+ NAL+PV+  
Sbjct  182  LPALTISLFLGPVLIQSLRSSMLDVLTSEYIEVARAKGVSEWRILTKHVMRNALIPVITV  241

Query  269  TALTIRVLLSGALIIEVVFSYPGIGNALNAAIEMRDIPTIQAIVLLLTICVVMVNLIADL  328
             A+ I  LLSGA+I+E VF  PG+G+ L  ++  RD P IQ + L+  + VV++NL+ADL
Sbjct  242  LAINISWLLSGAVIVEYVFGLPGLGSLLVRSVGYRDYPLIQGLSLVFGVLVVVINLLADL  301

Query  329  ITTLLTPKIRTA  340
               L+  ++  A
Sbjct  302  SYMLVDRRVLKA  313


> O50268 Glutathione ABC transporter permease [Rhizobium radiobacter]
Length=313

 Score =  182 bits (461),  Expect = 2e-56
 Identities = 99/314 (32%), Positives = 181/314 (58%), Gaps = 6/314 (2%)

Query  27   LPWFLTRLVSGILVVFVISLVVFIATQALPSDPARVILGPEASEATVQILREQLGLNDPI  86
            L +   RL   ++ +  +  ++F+  + LP DP  +ILG +AS  +V  LR++LGL+ PI
Sbjct  2    LLYLAKRLCFAVVTLLSVLTLIFLMVRVLPGDPVLMILGDQASPESVAALRQRLGLDQPI  61

Query  87   LLQYWHWLSQLLQGNFGQSIDSNVPVLQIIQNYFGNTVALTSLVIVVTVPLSVVLGVWLS  146
             LQY  +L   ++G+ G S+ +  PV + + +    T+ LT   +VV + L V  GVW +
Sbjct  62   GLQYVQFLGSAVKGDLGNSMVTGRPVTEEVMSVLPYTLELTFASLVVGLILGVPTGVWAA  121

Query  147  LHRDSKLDRIVVSSSIVFKAVPGFVIAIWLMMFFSTSV--LHVLPAASLLIPNESPYSQL  204
            + R    D I+   S++  ++PGFV AI L++ F+ ++    V+ A +     +   +++
Sbjct  122  VKRSKLPDYILRLISLIGLSLPGFVSAIVLLIVFAINLRWFPVISAGT----GDGIVNRV  177

Query  205  EFLILPILTLALSLTPYLMRLVRGSMIDALESEYVTSARLRGIPERRIIWKHVLPNALVP  264
              + LP+++LAL +  Y+ R+ R +M++ L  ++V +AR +G     +IW+H L N L+P
Sbjct  178  WQMTLPVISLALIMMAYITRVTRSAMLEVLNQDFVRTARAKGARPSVVIWRHALGNCLIP  237

Query  265  VVQGTALTIRVLLSGALIIEVVFSYPGIGNALNAAIEMRDIPTIQAIVLLLTICVVMVNL  324
            +     L + +L+  +++ E+VFS PG+G  +  A+  RD   +Q +V++ T+ VV+VNL
Sbjct  238  ISTVVGLYLGILIGNSVLTEIVFSRPGLGKLILTALSQRDYTLLQGMVVVYTLIVVIVNL  297

Query  325  IADLITTLLTPKIR  338
              DL   L  P+++
Sbjct  298  ATDLTYGLFDPRVQ  311


> Q8VPJ0 ABC-type dipeptide/oligopeptide/nickel transport systems, 
permease components [Lactobacillus delbrueckii subsp. bulgaricus]
Length=319

 Score =  181 bits (458),  Expect = 5e-56
 Identities = 101/316 (32%), Positives = 176/316 (56%), Gaps = 12/316 (4%)

Query  31   LTRLVSGILVVFVISLVVFIATQALPSDPARVILGPEASEATVQILREQLGLNDPILLQY  90
            L R++  I  + ++S++VF+  + +P DP   ++ P +S   +  L++  GLNDP+ +QY
Sbjct  6    LRRVLIMIPQLILLSIIVFMLAKMMPGDPFTGLINPNSSPKEIARLKQAYGLNDPVPVQY  65

Query  91   WHWLSQLLQGNFGQSIDSNVPVLQIIQNYFGNTVALTSLVIVVTVPLSVVLGVWLSLHRD  150
              W+  LL G+ GQS   +VPV  +I +   NT  L+ L  ++   +++ +G+    H  
Sbjct  66   VRWIKNLLHGDLGQSYIQHVPVASLIADRAQNTFWLSLLSTIILYGIAIPMGISAGKHEG  125

Query  151  SKLDRIVVSSSIVFKAVPGFV---IAIWLMMFFSTSVLHVLPAASLLIPNESPY-----S  202
               DR +   + V  A+PGFV   + +WL  F     L   P +  +  N S +     S
Sbjct  126  EWQDRAISIFNYVTYAIPGFVFYLLGLWLFGF----TLGWFPISGTVAANASGFWGVFFS  181

Query  203  QLEFLILPILTLALSLTPYLMRLVRGSMIDALESEYVTSARLRGIPERRIIWKHVLPNAL  262
            +L+ +ILP +  A+  T   ++ +R  +ID    +YV +AR +G+PE+ +  KH+L N+ 
Sbjct  182  RLQHMILPAILFAIIATTGTVQYLRTGIIDNKVEDYVKTARSKGVPEKVVFNKHILRNSF  241

Query  263  VPVVQGTALTIRVLLSGALIIEVVFSYPGIGNALNAAIEMRDIPTIQAIVLLLTICVVMV  322
            +P+      TI  LL G+LIIE VFS+PG+G     +I  RD  T+ A++++     ++ 
Sbjct  242  LPIAAFMGNTITGLLGGSLIIETVFSFPGMGKLFLDSISQRDYTTLTALIMIYGTLTLLG  301

Query  323  NLIADLITTLLTPKIR  338
            NL++D+I +L+ P+IR
Sbjct  302  NLLSDIIMSLVDPRIR  317


> Q9ZI30 Putative OppB [Treponema denticola]
Length=341

 Score =  166 bits (419),  Expect = 4e-50
 Identities = 95/327 (29%), Positives = 180/327 (55%), Gaps = 11/327 (3%)

Query  23   FPAWLPWFLTRLVSGILVVFVISLVVFIATQALPSDPARVILGPEASEAT--------VQ  74
            FP ++ +   RLVS I V+ ++S+ +FI    +P DP   +L PE ++A         ++
Sbjct  17   FP-YVRYIFKRLVSIIPVLIIMSVAIFILINLMPGDPILAMLDPEKTKAMTPEERALYIE  75

Query  75   ILREQLGLNDPILLQYWHWLSQLLQGNFGQSIDSNVPVLQIIQNYFGNTVALTSLVIVVT  134
             +R+ LG +   + +Y+ W+    +G FG SI  N PV + I  Y   +  +     ++ 
Sbjct  76   NMRKFLGYDKGPVERYFLWMGDTFRGEFGYSIKYNKPVNEFIGTYIKRSFRINIWGFLLA  135

Query  135  VPLSVVLGVWLSLHRDSKLDRIVVSSSIVFKAVPGFVIAIWLMMFFSTSVLHVLPAASLL  194
              +S+ +G+  ++ ++S  D+ V   +IV  ++P F +A+ L+M F    + +LP + + 
Sbjct  136  FLISIPVGITAAVKKNSFFDKTVTVLTIVGISLPSFFLALLLIMVF-VIFMQILPFSGMS  194

Query  195  IPNESPYSQLEFLILPILTLALSLTPYLMRLVRGSMIDALESEYVTSARLRGIPERRIIW  254
             P         ++ILP+  + L+    L+R VR +MI+ L+S+Y+ +AR +G+ E+ +I+
Sbjct  195  DPR-GILPDWHYIILPVTVVVLTSLVGLIRYVRSAMIEILKSDYIRTARAKGLSEKVVIY  253

Query  255  KHVLPNALVPVVQGTALTIRVLLSGALIIEVVFSYPGIGNALNAAIEMRDIPTIQAIVLL  314
            +H   NAL+PVV    L I  L  G++++E +F+YPG+G  +N A   +D   +Q ++L 
Sbjct  254  RHAFQNALIPVVTLIGLYIPGLFGGSIVVEKIFAYPGMGLLMNYAYGFKDRAVLQTVLLF  313

Query  315  LTICVVMVNLIADLITTLLTPKIRTAK  341
              +  ++ N+  D+   ++ P+IR  K
Sbjct  314  FGLLTLLGNIFIDVGYMVVDPRIREGK  340


> Q9AL81 Nickel ABC transporter permease subunit NikB [Brucella 
suis]
Length=314

 Score =  164 bits (415),  Expect = 8e-50
 Identities = 99/313 (32%), Positives = 164/313 (52%), Gaps = 12/313 (4%)

Query  29   WFLTRLVSGILVVFVISLVVFIATQALPSDPARVILGPEASEATVQIL---REQLGLNDP  85
            + + R++  + ++F  SLV+F+  +  PSDPA   L       T Q L   R+ LGL+  
Sbjct  4    FIIRRVILLVPMLFGASLVIFLMLRLGPSDPAMDYLRLSKVPPTPQALESARQMLGLDRA  63

Query  86   ILLQYWHWLSQLLQGNFGQSIDSNVPVLQIIQNYFGNTVALTSLVIVVTVPLSVVLGVWL  145
            I  QY+ WL + L G+FG S  +  PVL  +  +   T+ L  + +V+T+ LS+ LG+W 
Sbjct  64   ITTQYFDWLGKALHGDFGISFATQRPVLPDLLYFLPATLQLAGVALVLTLGLSIPLGMWA  123

Query  146  SLHRDSKLDRIVVSSSIVFKAVPGFVIAIWLMMFFSTSVLHVLPAASLLIPNESPYSQLE  205
            + HR+   D++V   + +  ++P F +   L++ FS  +  + P                
Sbjct  124  ARHREGWQDQVVRFVAFLGVSMPNFWLGFLLVLVFSIQLGWLPPMGR---------GGFA  174

Query  206  FLILPILTLALSLTPYLMRLVRGSMIDALESEYVTSARLRGIPERRIIWKHVLPNALVPV  265
             +I+P + ++        RL+R SM++     +V  ARLRG+ ER +   HVL NA +P+
Sbjct  175  HMIMPAIAISFMSLSINARLLRASMLEVSGQRHVRYARLRGLSERSVERSHVLRNAWLPI  234

Query  266  VQGTALTIRVLLSGALIIEVVFSYPGIGNALNAAIEMRDIPTIQAIVLLLTICVVMVNLI  325
            +  T + I  L+ G L+IE +F +PG+G    +AI  RD P IQ   L++    V+ NLI
Sbjct  235  ITATGMHIGELIGGTLVIESIFGWPGVGRYAVSAILNRDYPVIQCFTLVMVTIFVICNLI  294

Query  326  ADLITTLLTPKIR  338
             D++     P+IR
Sbjct  295  VDVVYAWADPRIR  307


> Q9ZGP1 ABC transporter permease [Staphylococcus aureus]
Length=311

 Score =  163 bits (413),  Expect = 1e-49
 Identities = 102/318 (32%), Positives = 168/318 (53%), Gaps = 14/318 (4%)

Query  29   WFLTRLVSGILVVFVISLVVFIATQALPSDPARVILG----PEASEATVQILREQLGLND  84
            + L R+     ++ V+S + F+ T     +PA  IL     P  +   +    E+ G ND
Sbjct  4    FILKRIALMFPLMIVVSFMTFLLTYITNENPAVTILHAQGTPNVTPELIAETNEKYGFND  63

Query  85   PILLQYWHWLSQLLQGNFGQSIDSNVPVLQIIQNYFGNTVALTSLVIVVTVPLSVVLGVW  144
            P+L+QY +WL + +Q NFG S  +  PV + I   F NT+ LT +  V+ +  S++LGV 
Sbjct  64   PLLIQYKNWLLEAMQFNFGTSYITGDPVAERIGPAFMNTLKLTIISSVMVMITSIILGVV  123

Query  145  LSLHRDSKLDRIVVSSSIVFKAVPGFVIAIWLMMFFSTSVLHVLPAASLLIPNESPYSQL  204
             +L R    DR + S +    A+P + IA  L+++ S   L++LP + L  P        
Sbjct  124  SALKRGKFTDRAIRSVAFFLTALPSYWIASILIIYVSVK-LNILPTSGLTGP--------  174

Query  205  EFLILPILTLALSLTPYLMRLVRGSMIDALESEYVTSARLRGIPERRIIWKHVLPNALVP  264
            E  ILP++ + ++      R VR SM++ L  +YV   R  G+    ++  HVL NAL  
Sbjct  175  ESYILPVIVITIAYAGIYFRNVRRSMVEQLNEDYVLYLRASGVKSITLM-LHVLRNALQV  233

Query  265  VVQGTALTIRVLLSGALIIEVVFSYPGIGNALNAAIEMRDIPTIQAIVLLLTICVVMVNL  324
             V    ++I +++ G ++IE +F++PG+G     AI   D P IQA VL++ +  ++ N 
Sbjct  234  AVSIFCMSIPMIMGGLVVIEYIFAWPGLGQLSLKAILEHDFPVIQAYVLIVAVLFIVFNT  293

Query  325  IADLITTLLTPKIRTAKR  342
            +AD+I  LL P++R   R
Sbjct  294  LADIINALLNPRLREGAR  311


> O30543 AccD [Agrobacterium fabrum (strain C58 / ATCC 33970)]
Length=306

 Score =  163 bits (412),  Expect = 2e-49
 Identities = 101/315 (32%), Positives = 168/315 (53%), Gaps = 12/315 (4%)

Query  27   LPWFLTRLVSGILVVFVISLVVFIATQALPSDPARVILGPEASEATVQILREQLGLNDPI  86
            + + L RLV  I+V+ +    VFI  + L  DPAR +LG  A+   +   R   GL+  I
Sbjct  2    ISFILARLVRAIIVMMLTVTFVFIILR-LGGDPARAMLGENATPEALAAFRTAWGLDRSI  60

Query  87   LLQYWHWLSQLLQGNFGQSIDSNVPVLQIIQNYFGNTVALTSLVIVVTVPLSVVLGVWLS  146
              Q+  +L+  L+G+FG S      V  +I      T+ LT    V+++ + +  G+  +
Sbjct  61   PEQFLIYLASALRGDFGVSAADGREVFTVISERIPKTLTLTISAFVLSILVGIPAGIIAA  120

Query  147  LHRDSKLDRIVVSSSIVFKAVPGFVIAIWLMMFFSTSVLHVLPAASLLIPNESPYSQLEF  206
            + RDS  D+ V++ +++  +VP F++ + L+  F+     VLP+        S  S  + 
Sbjct  121  VRRDSAADKSVMAGAVLGYSVPNFLLGLTLIFVFAVW-FRVLPS--------SGSSTWQH  171

Query  207  LILPILTLALSLTPYLMRLVRGSMIDALESEYVTSARLRGIPERRIIWKHVLPNALVPVV  266
             ILP+ T  L     +    R  +I+ LE  Y+ +AR  GIP+  ++ +H LPNA +P+V
Sbjct  172  AILPVATFGLVNAAAIALPFR--VIEVLEQPYIAAARADGIPKWEVVIRHALPNAAIPMV  229

Query  267  QGTALTIRVLLSGALIIEVVFSYPGIGNALNAAIEMRDIPTIQAIVLLLTICVVMVNLIA  326
                     LL G+ I+E VF++PG+G+    AI + D+  +QA++LL T  +V +NLI 
Sbjct  230  TMLGFVAAGLLGGSAIVETVFAWPGLGSGFVRAITLSDLNVVQAMILLFTAFMVTINLIV  289

Query  327  DLITTLLTPKIRTAK  341
            D++  +L PKIR  K
Sbjct  290  DVLYAVLNPKIRLQK  304



Lambda      K        H        a         alpha
   0.326    0.140    0.412    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2440557


  Database: 8fe419e1fc2637734e9694d765f9ef58.TrEMBL.fasta
    Posted date:  Sep 25, 2020  11:47 AM
  Number of letters in database: 8,553
  Number of sequences in database:  24



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40