ACIAD1507 / SwissProt Alignments

BLASTP 2.2.28+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: 02495870eaf542ce963b249e58b44f1e.SwissProt.fasta
           25 sequences; 7,844 total letters



Query= ACIAD1507

Length=384
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  Q53191 Probable peptide ABC transporter permease protein y4tP [...   206    9e-66
  Q0T6D1 Glutathione transport system permease protein GsiC [Shig...   200    1e-63
  Q57RB0 Glutathione transport system permease protein GsiC [Salm...   200    2e-63
  Q8Z862 Glutathione transport system permease protein GsiC [Salm...   200    2e-63
  Q83S26 Glutathione transport system permease protein GsiC [Shig...   200    2e-63
  Q8ZQM2 Glutathione transport system permease protein GsiC [Salm...   199    2e-63
  A1A970 Glutathione transport system permease protein GsiC [Esch...   199    3e-63
  Q0TJL7 Glutathione transport system permease protein GsiC [Esch...   199    3e-63
  Q1RE94 Glutathione transport system permease protein GsiC [Esch...   199    3e-63
  Q32IB7 Glutathione transport system permease protein GsiC [Shig...   199    3e-63
  P75798 Glutathione transport system permease protein GsiC [Esch...   199    3e-63
  Q8X6V7 Glutathione transport system permease protein GsiC [Esch...   199    5e-63
  Q8FJK9 Glutathione transport system permease protein GsiC [Esch...   197    3e-62
  Q5PGP5 Glutathione transport system permease protein GsiC [Salm...   196    4e-62
  Q323W3 Glutathione transport system permease protein GsiC [Shig...   196    5e-62
  Q2FYQ5 Nickel import system permease protein NikB [Staphylococc...   186    6e-58
  P42062 Oligopeptide transport system permease protein AppB [Bac...   172    7e-53
  P77308 Probable D,D-dipeptide transport system permease protein...   169    2e-51
  P33591 Nickel transport system permease protein NikB [Escherich...   165    4e-50
  P94311 Dipeptide transport system permease protein DppB [Bacill...   164    2e-49
  P45096 Dipeptide transport system permease protein DppB [Haemop...   156    8e-47
  P0A4N8 Oligopeptide transport system permease protein OppB [Lac...   151    6e-45
  P0A4N7 Oligopeptide transport system permease protein OppB [Lac...   151    6e-45
  P0AFH2 Oligopeptide transport system permease protein OppB [Esc...   149    2e-44
  P0AEF8 Dipeptide transport system permease protein DppB [Escher...   148    1e-43


> Q53191 Probable peptide ABC transporter permease protein y4tP 
[Sinorhizobium fredii (strain NBRC 101917 / NGR234)]
Length=313

 Score =  206 bits (524),  Expect = 9e-66
 Identities = 109/310 (35%), Positives = 183/310 (59%), Gaps = 1/310 (0%)

Query  29   WFLTRLVSGILVVFVISLVVFIATQALPSDPARVILGPEASEATVQILREQLGLNDPILL  88
            + L RLVS I V+ ++ + +F+  +  P DPA VI GP A+E  V  +RE+LGLN+P+ +
Sbjct  4    YILRRLVSTIAVMAMVGIFIFLLLRLAPGDPAAVIAGPTATEQMVANIREELGLNEPLPV  63

Query  89   QYWHWLSQLLQGNFGQSIDSNVPVLQIIQNYFGNTVALTSLVIVVTVPLSVVLGVWLSLH  148
            Q+ HW S +L+GNFG S+ + VPVLQ++      T++L+ L ++++V + V  GV  +  
Sbjct  64   QFVHWASDVLRGNFGASVFTGVPVLQLLSQRLEPTISLSVLTMILSVTVGVSFGVLAAWR  123

Query  149  RDSKLDRIVVSSSIVFKAVPGFVIAIWLMMFFSTSVLHVLPAASLLIPNESPYSQLEFLI  208
                +DR + + S +  +VP FVI   L+ FF+      LP       N+        LI
Sbjct  124  SGGFVDRALATFSAIGYSVPVFVIGYILIYFFAIQT-RWLPVQGYTSINQGVAPWFLHLI  182

Query  209  LPILTLALSLTPYLMRLVRGSMIDALESEYVTSARLRGIPERRIIWKHVLPNALVPVVQG  268
            LP +TL++    ++ R+ RGSM++ L  +Y+ +A  +G     +++ H L NA VP++  
Sbjct  183  LPTVTLSVPYIAFIARITRGSMLEVLSEDYMRTAAAKGASPFAMLFHHALKNAGVPILTV  242

Query  269  TALTIRVLLSGALIIEVVFSYPGIGNALNAAIEMRDIPTIQAIVLLLTICVVMVNLIADL  328
              ++   ++ G ++ E VF+ PGIG  +  AI+ RD P IQ +++L++   V++NL+ DL
Sbjct  243  IGISFAYMIGGVVLTETVFNVPGIGRLVVDAIKNRDYPIIQTVLVLISGLYVLINLLVDL  302

Query  329  ITTLLTPKIR  338
              TL+ P+IR
Sbjct  303  AYTLIDPRIR  312


> Q0T6D1 Glutathione transport system permease protein GsiC [Shigella 
flexneri serotype 5b (strain 8401)]
Length=306

 Score =  200 bits (509),  Expect = 1e-63
 Identities = 107/312 (34%), Positives = 181/312 (58%), Gaps = 9/312 (3%)

Query  27   LPWFLTRLVSGILVVFVISLVVFIATQALPSDPARVILGPEASEATVQILREQLGLNDPI  86
            L + + RL+  I  +F++S++VF+    LP DPAR+I GPEA    ++++R+QLGL+ P+
Sbjct  2    LNYVIKRLLGLIPTLFIVSVLVFLFVHMLPGDPARLIAGPEADAQVIELVRQQLGLDQPL  61

Query  87   LLQYWHWLSQLLQGNFGQSIDSNVPVLQIIQNYFGNTVALTSLVIVVTVPLSVVLGVWLS  146
              Q+WH++S  +QG+FG S+ S  PV   I + F  T+ LT   +V  V   +  G+  +
Sbjct  62   YHQFWHYISNAVQGDFGLSMVSRRPVADEIASRFMPTLWLTITSMVWAVIFGMAAGIIAA  121

Query  147  LHRDSKLDRIVVSSSIVFKAVPGFVIAIWLMMFFSTSVLHVLPAASLLIPNESPYSQLEF  206
            + R+   DR+ ++ ++   + P F + ++L+  FS   L  LP               + 
Sbjct  122  VWRNRWPDRLSMTIAVSGISFPAFALGMFLIQVFSVE-LGWLPTVGA--------DSWQH  172

Query  207  LILPILTLALSLTPYLMRLVRGSMIDALESEYVTSARLRGIPERRIIWKHVLPNALVPVV  266
             ILP LTL  ++   + R  R S +D L  +Y+ +AR +G+ E  ++ KH L NA++PVV
Sbjct  173  YILPSLTLGAAVAAVMARFTRASFVDVLSEDYMRTARAKGVSETWVVLKHGLRNAMIPVV  232

Query  267  QGTALTIRVLLSGALIIEVVFSYPGIGNALNAAIEMRDIPTIQAIVLLLTICVVMVNLIA  326
                L    LL G++++E VF++PG+G  L  ++EMRD P IQA +LL ++  +++NL+ 
Sbjct  233  TMMGLQFGFLLGGSIVVEKVFNWPGLGRLLVDSVEMRDYPVIQAEILLFSLEFILINLVV  292

Query  327  DLITTLLTPKIR  338
            D++   + P IR
Sbjct  293  DVLYAAINPAIR  304


> Q57RB0 Glutathione transport system permease protein GsiC [Salmonella 
choleraesuis (strain SC-B67)]
Length=306

 Score =  200 bits (508),  Expect = 2e-63
 Identities = 106/312 (34%), Positives = 182/312 (58%), Gaps = 9/312 (3%)

Query  27   LPWFLTRLVSGILVVFVISLVVFIATQALPSDPARVILGPEASEATVQILREQLGLNDPI  86
            L + L RL+  I  + +++++VF+    LP DPAR+I GPEA    + ++R+QLGL+ P+
Sbjct  2    LNYVLKRLLGLIPTLLIVAVLVFLFVHLLPGDPARLIAGPEADAQVIALVRQQLGLDQPL  61

Query  87   LLQYWHWLSQLLQGNFGQSIDSNVPVLQIIQNYFGNTVALTSLVIVVTVPLSVVLGVWLS  146
             +Q+WH+++ +LQG+FG S+ S  PV + I + F  T+ LT   ++  V   + +G+  +
Sbjct  62   HVQFWHYITHVLQGDFGTSMVSRRPVSEEIASRFLPTLWLTITSMIWAVLFGMAIGIAAA  121

Query  147  LHRDSKLDRIVVSSSIVFKAVPGFVIAIWLMMFFSTSVLHVLPAASLLIPNESPYSQLEF  206
            + R+   DR+ ++ ++   + P F + + LM  FS   L  LP               + 
Sbjct  122  VWRNRWPDRVGMTLAVTGISFPAFALGMLLMQIFSVD-LGWLPTVGA--------DSWQH  172

Query  207  LILPILTLALSLTPYLMRLVRGSMIDALESEYVTSARLRGIPERRIIWKHVLPNALVPVV  266
             ILP LTL  ++   + R  R S +D L  +Y+ +AR +G+ E  ++ KH L NA++PVV
Sbjct  173  YILPSLTLGAAVASVMARFTRSSFVDVLSEDYMRTARAKGVSETWVVLKHGLRNAMIPVV  232

Query  267  QGTALTIRVLLSGALIIEVVFSYPGIGNALNAAIEMRDIPTIQAIVLLLTICVVMVNLIA  326
                L    LL G++++E VF++PG+G  L  +++MRD P IQA VLL ++  +++NL+ 
Sbjct  233  TMMGLQFGFLLGGSIVVEKVFNWPGLGRLLVDSVDMRDYPVIQAEVLLFSLEFILINLVV  292

Query  327  DLITTLLTPKIR  338
            D++   + P IR
Sbjct  293  DVLYAAINPAIR  304


> Q8Z862 Glutathione transport system permease protein GsiC [Salmonella 
typhi]
Length=306

 Score =  200 bits (508),  Expect = 2e-63
 Identities = 106/312 (34%), Positives = 182/312 (58%), Gaps = 9/312 (3%)

Query  27   LPWFLTRLVSGILVVFVISLVVFIATQALPSDPARVILGPEASEATVQILREQLGLNDPI  86
            L + L RL+  I  + +++++VF+    LP DPAR+I GPEA    + ++R+QLGL+ P+
Sbjct  2    LNYVLKRLLGLIPTLLIVAVLVFLFVHLLPGDPARLIAGPEADAQVIALVRQQLGLDQPL  61

Query  87   LLQYWHWLSQLLQGNFGQSIDSNVPVLQIIQNYFGNTVALTSLVIVVTVPLSVVLGVWLS  146
             +Q+WH+++ +LQG+FG S+ S  PV + I + F  T+ LT   ++  V   + +G+  +
Sbjct  62   HVQFWHYITHVLQGDFGTSMVSRRPVSEEIASRFLPTLWLTITSMIWAVLFGMAIGIAAA  121

Query  147  LHRDSKLDRIVVSSSIVFKAVPGFVIAIWLMMFFSTSVLHVLPAASLLIPNESPYSQLEF  206
            + R+   DR+ ++ ++   + P F + + LM  FS   L  LP               + 
Sbjct  122  VWRNRWPDRVGMTLAVTGISFPAFALGMLLMQIFSVD-LGWLPTVGA--------DSWQH  172

Query  207  LILPILTLALSLTPYLMRLVRGSMIDALESEYVTSARLRGIPERRIIWKHVLPNALVPVV  266
             ILP LTL  ++   + R  R S +D L  +Y+ +AR +G+ E  ++ KH L NA++PVV
Sbjct  173  YILPSLTLGAAVASVMARFTRSSFVDVLSEDYMRTARAKGVSETWVVLKHGLRNAMIPVV  232

Query  267  QGTALTIRVLLSGALIIEVVFSYPGIGNALNAAIEMRDIPTIQAIVLLLTICVVMVNLIA  326
                L    LL G++++E VF++PG+G  L  +++MRD P IQA VLL ++  +++NL+ 
Sbjct  233  TMMGLQFGFLLGGSIVVEKVFNWPGLGRLLVDSVDMRDYPVIQAEVLLFSLEFILINLVV  292

Query  327  DLITTLLTPKIR  338
            D++   + P IR
Sbjct  293  DVLYAAINPAIR  304


> Q83S26 Glutathione transport system permease protein GsiC [Shigella 
flexneri]
Length=306

 Score =  200 bits (508),  Expect = 2e-63
 Identities = 107/312 (34%), Positives = 181/312 (58%), Gaps = 9/312 (3%)

Query  27   LPWFLTRLVSGILVVFVISLVVFIATQALPSDPARVILGPEASEATVQILREQLGLNDPI  86
            L + + RL+  I  +F++S++VF+    LP DPAR+I GPEA    ++++R+QLGL+ P+
Sbjct  2    LYYVIKRLLGLIPTLFIVSVLVFLFVHMLPGDPARLIAGPEADAQVIELVRQQLGLDQPL  61

Query  87   LLQYWHWLSQLLQGNFGQSIDSNVPVLQIIQNYFGNTVALTSLVIVVTVPLSVVLGVWLS  146
              Q+WH++S  +QG+FG S+ S  PV   I + F  T+ LT   +V  V   +  G+  +
Sbjct  62   YHQFWHYISNAVQGDFGLSMVSRRPVADEIASRFMPTLWLTITSMVWAVIFGMAAGIIAA  121

Query  147  LHRDSKLDRIVVSSSIVFKAVPGFVIAIWLMMFFSTSVLHVLPAASLLIPNESPYSQLEF  206
            + R+   DR+ ++ ++   + P F + ++L+  FS   L  LP               + 
Sbjct  122  VWRNRWPDRLSMTIAVSGISFPAFALGMFLIQVFSVE-LGWLPTVGA--------DSWQH  172

Query  207  LILPILTLALSLTPYLMRLVRGSMIDALESEYVTSARLRGIPERRIIWKHVLPNALVPVV  266
             ILP LTL  ++   + R  R S +D L  +Y+ +AR +G+ E  ++ KH L NA++PVV
Sbjct  173  YILPSLTLGAAVAAVMARFTRASFVDVLSEDYMRTARAKGVSETWVVLKHGLRNAMIPVV  232

Query  267  QGTALTIRVLLSGALIIEVVFSYPGIGNALNAAIEMRDIPTIQAIVLLLTICVVMVNLIA  326
                L    LL G++++E VF++PG+G  L  ++EMRD P IQA +LL ++  +++NL+ 
Sbjct  233  TMMGLQFGFLLGGSIVVEKVFNWPGLGRLLVDSVEMRDYPVIQAEILLFSLEFILINLVV  292

Query  327  DLITTLLTPKIR  338
            D++   + P IR
Sbjct  293  DVLYAAINPAIR  304


> Q8ZQM2 Glutathione transport system permease protein GsiC [Salmonella 
typhimurium (strain LT2 / SGSC1412 / ATCC 700720)]
Length=306

 Score =  199 bits (507),  Expect = 2e-63
 Identities = 106/312 (34%), Positives = 182/312 (58%), Gaps = 9/312 (3%)

Query  27   LPWFLTRLVSGILVVFVISLVVFIATQALPSDPARVILGPEASEATVQILREQLGLNDPI  86
            L + L RL+  I  + +++++VF+    LP DPAR+I GPEA    + ++R+QLGL+ P+
Sbjct  2    LNYVLKRLLGLIPTLLIVAVLVFLFVHLLPGDPARLIAGPEADAQVIALVRQQLGLDQPL  61

Query  87   LLQYWHWLSQLLQGNFGQSIDSNVPVLQIIQNYFGNTVALTSLVIVVTVPLSVVLGVWLS  146
             +Q+WH+++ +LQG+FG S+ S  PV + I + F  T+ LT   ++  V   + +G+  +
Sbjct  62   HVQFWHYITHVLQGDFGTSMVSRRPVSEEIASRFLPTLWLTITSMIWAVLFGMAIGIAAA  121

Query  147  LHRDSKLDRIVVSSSIVFKAVPGFVIAIWLMMFFSTSVLHVLPAASLLIPNESPYSQLEF  206
            + R+   DR+ ++ ++   + P F + + LM  FS   L  LP               + 
Sbjct  122  VWRNRWPDRLGMTLAVTGISFPAFALGMLLMQIFSVD-LGWLPTVGA--------DSWQH  172

Query  207  LILPILTLALSLTPYLMRLVRGSMIDALESEYVTSARLRGIPERRIIWKHVLPNALVPVV  266
             ILP LTL  ++   + R  R S +D L  +Y+ +AR +G+ E  ++ KH L NA++PVV
Sbjct  173  YILPSLTLGAAVASVMARFTRSSFVDVLSEDYMRTARAKGVSETWVVLKHGLRNAMIPVV  232

Query  267  QGTALTIRVLLSGALIIEVVFSYPGIGNALNAAIEMRDIPTIQAIVLLLTICVVMVNLIA  326
                L    LL G++++E VF++PG+G  L  +++MRD P IQA VLL ++  +++NL+ 
Sbjct  233  TMMGLQFGFLLGGSIVVEKVFNWPGLGRLLVDSVDMRDYPVIQAEVLLFSLEFILINLVV  292

Query  327  DLITTLLTPKIR  338
            D++   + P IR
Sbjct  293  DVLYAAINPAIR  304


> A1A970 Glutathione transport system permease protein GsiC [Escherichia 
coli O1:K1 / APEC]
Length=306

 Score =  199 bits (506),  Expect = 3e-63
 Identities = 107/312 (34%), Positives = 180/312 (58%), Gaps = 9/312 (3%)

Query  27   LPWFLTRLVSGILVVFVISLVVFIATQALPSDPARVILGPEASEATVQILREQLGLNDPI  86
            L + + RL+  I  +F++S++VF+    LP DPAR+I GPEA    ++++R+QLGL+ P+
Sbjct  2    LNYVIKRLLGLIPTLFIVSVLVFLFVHMLPGDPARLIAGPEADAQVIELVRQQLGLDQPL  61

Query  87   LLQYWHWLSQLLQGNFGQSIDSNVPVLQIIQNYFGNTVALTSLVIVVTVPLSVVLGVWLS  146
              Q+WH++S  +QG+FG S+ S  PV   I + F  T+ LT   +V  V   +  G+  +
Sbjct  62   YHQFWHYISNAVQGDFGLSMVSRRPVADEIASRFMPTLWLTITSMVWAVIFGMAAGIIAA  121

Query  147  LHRDSKLDRIVVSSSIVFKAVPGFVIAIWLMMFFSTSVLHVLPAASLLIPNESPYSQLEF  206
            + R+   DR+ ++ ++   + P F + + L+  FS   L  LP               + 
Sbjct  122  VWRNRWPDRLSMTIAVSGISFPAFALGMLLIQVFSVE-LGWLPTVGA--------DSWQH  172

Query  207  LILPILTLALSLTPYLMRLVRGSMIDALESEYVTSARLRGIPERRIIWKHVLPNALVPVV  266
             ILP LTL  ++   + R  R S +D L  +Y+ +AR +G+ E  ++ KH L NA++PVV
Sbjct  173  YILPSLTLGAAVAAVMARFTRASFVDVLSEDYMRTARAKGVSETWVVLKHGLRNAMIPVV  232

Query  267  QGTALTIRVLLSGALIIEVVFSYPGIGNALNAAIEMRDIPTIQAIVLLLTICVVMVNLIA  326
                L    LL G++++E VF++PG+G  L  ++EMRD P IQA +LL ++  +++NL+ 
Sbjct  233  TMMGLQFGFLLGGSIVVEKVFNWPGLGRLLVDSVEMRDYPVIQAEILLFSLEFILINLVV  292

Query  327  DLITTLLTPKIR  338
            D++   + P IR
Sbjct  293  DVLYAAINPAIR  304


> Q0TJL7 Glutathione transport system permease protein GsiC [Escherichia 
coli O6:K15:H31 (strain 536 / UPEC)]
Length=306

 Score =  199 bits (506),  Expect = 3e-63
 Identities = 107/312 (34%), Positives = 180/312 (58%), Gaps = 9/312 (3%)

Query  27   LPWFLTRLVSGILVVFVISLVVFIATQALPSDPARVILGPEASEATVQILREQLGLNDPI  86
            L + + RL+  I  +F++S++VF+    LP DPAR+I GPEA    ++++R+QLGL+ P+
Sbjct  2    LNYVIKRLLGLIPTLFIVSVLVFLFVHMLPGDPARLIAGPEADAQVIELVRQQLGLDQPL  61

Query  87   LLQYWHWLSQLLQGNFGQSIDSNVPVLQIIQNYFGNTVALTSLVIVVTVPLSVVLGVWLS  146
              Q+WH++S  +QG+FG S+ S  PV   I + F  T+ LT   +V  V   +  G+  +
Sbjct  62   YHQFWHYISNAVQGDFGLSMVSRRPVADEIASRFMPTLWLTITSMVWAVIFGMAAGIIAA  121

Query  147  LHRDSKLDRIVVSSSIVFKAVPGFVIAIWLMMFFSTSVLHVLPAASLLIPNESPYSQLEF  206
            + R+   DR+ ++ ++   + P F + + L+  FS   L  LP               + 
Sbjct  122  VWRNRWPDRLSMTIAVSGISFPAFALGMLLIQVFSVE-LGWLPTVGA--------DSWQH  172

Query  207  LILPILTLALSLTPYLMRLVRGSMIDALESEYVTSARLRGIPERRIIWKHVLPNALVPVV  266
             ILP LTL  ++   + R  R S +D L  +Y+ +AR +G+ E  ++ KH L NA++PVV
Sbjct  173  YILPSLTLGAAVAAVMARFTRASFVDVLSEDYMRTARAKGVSETWVVLKHGLRNAMIPVV  232

Query  267  QGTALTIRVLLSGALIIEVVFSYPGIGNALNAAIEMRDIPTIQAIVLLLTICVVMVNLIA  326
                L    LL G++++E VF++PG+G  L  ++EMRD P IQA +LL ++  +++NL+ 
Sbjct  233  TMMGLQFGFLLGGSIVVEKVFNWPGLGRLLVDSVEMRDYPVIQAEILLFSLEFILINLVV  292

Query  327  DLITTLLTPKIR  338
            D++   + P IR
Sbjct  293  DVLYAAINPAIR  304


> Q1RE94 Glutathione transport system permease protein GsiC [Escherichia 
coli (strain UTI89 / UPEC)]
Length=306

 Score =  199 bits (506),  Expect = 3e-63
 Identities = 107/312 (34%), Positives = 180/312 (58%), Gaps = 9/312 (3%)

Query  27   LPWFLTRLVSGILVVFVISLVVFIATQALPSDPARVILGPEASEATVQILREQLGLNDPI  86
            L + + RL+  I  +F++S++VF+    LP DPAR+I GPEA    ++++R+QLGL+ P+
Sbjct  2    LNYVIKRLLGLIPTLFIVSVLVFLFVHMLPGDPARLIAGPEADAQVIELVRQQLGLDQPL  61

Query  87   LLQYWHWLSQLLQGNFGQSIDSNVPVLQIIQNYFGNTVALTSLVIVVTVPLSVVLGVWLS  146
              Q+WH++S  +QG+FG S+ S  PV   I + F  T+ LT   +V  V   +  G+  +
Sbjct  62   YHQFWHYISNAVQGDFGLSMVSRRPVADEIASRFMPTLWLTITSMVWAVIFGMAAGIIAA  121

Query  147  LHRDSKLDRIVVSSSIVFKAVPGFVIAIWLMMFFSTSVLHVLPAASLLIPNESPYSQLEF  206
            + R+   DR+ ++ ++   + P F + + L+  FS   L  LP               + 
Sbjct  122  VWRNRWPDRLSMTIAVSGISFPAFALGMLLIQVFSVE-LGWLPTVGA--------DSWQH  172

Query  207  LILPILTLALSLTPYLMRLVRGSMIDALESEYVTSARLRGIPERRIIWKHVLPNALVPVV  266
             ILP LTL  ++   + R  R S +D L  +Y+ +AR +G+ E  ++ KH L NA++PVV
Sbjct  173  YILPSLTLGAAVAAVMARFTRASFVDVLSEDYMRTARAKGVSETWVVLKHGLRNAMIPVV  232

Query  267  QGTALTIRVLLSGALIIEVVFSYPGIGNALNAAIEMRDIPTIQAIVLLLTICVVMVNLIA  326
                L    LL G++++E VF++PG+G  L  ++EMRD P IQA +LL ++  +++NL+ 
Sbjct  233  TMMGLQFGFLLGGSIVVEKVFNWPGLGRLLVDSVEMRDYPVIQAEILLFSLEFILINLVV  292

Query  327  DLITTLLTPKIR  338
            D++   + P IR
Sbjct  293  DVLYAAINPAIR  304


> Q32IB7 Glutathione transport system permease protein GsiC [Shigella 
dysenteriae serotype 1 (strain Sd197)]
Length=306

 Score =  199 bits (506),  Expect = 3e-63
 Identities = 107/312 (34%), Positives = 180/312 (58%), Gaps = 9/312 (3%)

Query  27   LPWFLTRLVSGILVVFVISLVVFIATQALPSDPARVILGPEASEATVQILREQLGLNDPI  86
            L + + RL+  I  +F++S++VF+    LP DPAR+I GPEA    ++++R+QLGL+ P+
Sbjct  2    LNYVIKRLLGLIPTLFIVSVLVFLFVHMLPGDPARLIAGPEADAQVIELVRQQLGLDQPL  61

Query  87   LLQYWHWLSQLLQGNFGQSIDSNVPVLQIIQNYFGNTVALTSLVIVVTVPLSVVLGVWLS  146
              Q+WH++S  +QG+FG S+ S  PV   I + F  T+ LT   +V  V   +  G+  +
Sbjct  62   YHQFWHYISNAVQGDFGLSMVSRRPVADEIASRFMPTLWLTITSMVWAVIFGMAAGIIAA  121

Query  147  LHRDSKLDRIVVSSSIVFKAVPGFVIAIWLMMFFSTSVLHVLPAASLLIPNESPYSQLEF  206
            + R+   DR+ ++ ++   + P F + + L+  FS   L  LP               + 
Sbjct  122  VWRNRWPDRLSMTIAVSGISFPAFALGMLLIQVFSVE-LGWLPTVGA--------DSWQH  172

Query  207  LILPILTLALSLTPYLMRLVRGSMIDALESEYVTSARLRGIPERRIIWKHVLPNALVPVV  266
             ILP LTL  ++   + R  R S +D L  +Y+ +AR +G+ E  ++ KH L NA++PVV
Sbjct  173  YILPSLTLGAAVAAVMARFTRASFVDVLSEDYMRTARAKGVSETWVVLKHGLRNAMIPVV  232

Query  267  QGTALTIRVLLSGALIIEVVFSYPGIGNALNAAIEMRDIPTIQAIVLLLTICVVMVNLIA  326
                L    LL G++++E VF++PG+G  L  ++EMRD P IQA +LL ++  +++NL+ 
Sbjct  233  TMMGLQFGFLLGGSIVVEKVFNWPGLGRLLVDSVEMRDYPVIQAEILLFSLEFILINLVV  292

Query  327  DLITTLLTPKIR  338
            D++   + P IR
Sbjct  293  DVLYAAINPAIR  304


> P75798 Glutathione transport system permease protein GsiC [Escherichia 
coli (strain K12)]
Length=306

 Score =  199 bits (506),  Expect = 3e-63
 Identities = 107/312 (34%), Positives = 180/312 (58%), Gaps = 9/312 (3%)

Query  27   LPWFLTRLVSGILVVFVISLVVFIATQALPSDPARVILGPEASEATVQILREQLGLNDPI  86
            L + + RL+  I  +F++S++VF+    LP DPAR+I GPEA    ++++R+QLGL+ P+
Sbjct  2    LNYVIKRLLGLIPTLFIVSVLVFLFVHMLPGDPARLIAGPEADAQVIELVRQQLGLDQPL  61

Query  87   LLQYWHWLSQLLQGNFGQSIDSNVPVLQIIQNYFGNTVALTSLVIVVTVPLSVVLGVWLS  146
              Q+WH++S  +QG+FG S+ S  PV   I + F  T+ LT   +V  V   +  G+  +
Sbjct  62   YHQFWHYISNAVQGDFGLSMVSRRPVADEIASRFMPTLWLTITSMVWAVIFGMAAGIIAA  121

Query  147  LHRDSKLDRIVVSSSIVFKAVPGFVIAIWLMMFFSTSVLHVLPAASLLIPNESPYSQLEF  206
            + R+   DR+ ++ ++   + P F + + L+  FS   L  LP               + 
Sbjct  122  VWRNRWPDRLSMTIAVSGISFPAFALGMLLIQVFSVE-LGWLPTVGA--------DSWQH  172

Query  207  LILPILTLALSLTPYLMRLVRGSMIDALESEYVTSARLRGIPERRIIWKHVLPNALVPVV  266
             ILP LTL  ++   + R  R S +D L  +Y+ +AR +G+ E  ++ KH L NA++PVV
Sbjct  173  YILPSLTLGAAVAAVMARFTRASFVDVLSEDYMRTARAKGVSETWVVLKHGLRNAMIPVV  232

Query  267  QGTALTIRVLLSGALIIEVVFSYPGIGNALNAAIEMRDIPTIQAIVLLLTICVVMVNLIA  326
                L    LL G++++E VF++PG+G  L  ++EMRD P IQA +LL ++  +++NL+ 
Sbjct  233  TMMGLQFGFLLGGSIVVEKVFNWPGLGRLLVDSVEMRDYPVIQAEILLFSLEFILINLVV  292

Query  327  DLITTLLTPKIR  338
            D++   + P IR
Sbjct  293  DVLYAAINPAIR  304


> Q8X6V7 Glutathione transport system permease protein GsiC [Escherichia 
coli O157:H7]
Length=306

 Score =  199 bits (505),  Expect = 5e-63
 Identities = 107/312 (34%), Positives = 179/312 (57%), Gaps = 9/312 (3%)

Query  27   LPWFLTRLVSGILVVFVISLVVFIATQALPSDPARVILGPEASEATVQILREQLGLNDPI  86
            L + + RL+  I  +F++S++VF+    LP DPAR+I GPEA    ++++R+QLGL+ P+
Sbjct  2    LNYVIKRLLGLIPTLFIVSVLVFLFVHMLPGDPARLIAGPEADAQVIELVRQQLGLDQPL  61

Query  87   LLQYWHWLSQLLQGNFGQSIDSNVPVLQIIQNYFGNTVALTSLVIVVTVPLSVVLGVWLS  146
              Q+WH++S  +QG+FG S+ S  PV   I   F  T+ LT   +V  V   +  G+  +
Sbjct  62   YHQFWHYISNAVQGDFGLSMVSRRPVADEIARRFMPTLWLTITSMVWAVIFGMAAGIIAA  121

Query  147  LHRDSKLDRIVVSSSIVFKAVPGFVIAIWLMMFFSTSVLHVLPAASLLIPNESPYSQLEF  206
            + R+   DR+ ++ ++   + P F + + L+  FS   L  LP               + 
Sbjct  122  VWRNRWPDRLSMTIAVSGISFPAFALGMLLIQVFSVE-LGWLPTVGA--------DSWQH  172

Query  207  LILPILTLALSLTPYLMRLVRGSMIDALESEYVTSARLRGIPERRIIWKHVLPNALVPVV  266
             ILP LTL  ++   + R  R S +D L  +Y+ +AR +G+ E  ++ KH L NA++PVV
Sbjct  173  YILPSLTLGAAVAAVMARFTRASFVDVLSEDYMRTARAKGVSETWVVLKHGLRNAMIPVV  232

Query  267  QGTALTIRVLLSGALIIEVVFSYPGIGNALNAAIEMRDIPTIQAIVLLLTICVVMVNLIA  326
                L    LL G++++E VF++PG+G  L  ++EMRD P IQA +LL ++  +++NL+ 
Sbjct  233  TMMGLQFGFLLGGSIVVEKVFNWPGLGRLLVDSVEMRDYPVIQAEILLFSLEFILINLVV  292

Query  327  DLITTLLTPKIR  338
            D++   + P IR
Sbjct  293  DVLYAAINPAIR  304


> Q8FJK9 Glutathione transport system permease protein GsiC [Escherichia 
coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)]
Length=306

 Score =  197 bits (500),  Expect = 3e-62
 Identities = 106/312 (34%), Positives = 179/312 (57%), Gaps = 9/312 (3%)

Query  27   LPWFLTRLVSGILVVFVISLVVFIATQALPSDPARVILGPEASEATVQILREQLGLNDPI  86
            L + + RL+  I  +F++S++VF+    LP DPAR+I GPEA    ++++R+QLGL+ P+
Sbjct  2    LNYVIKRLLGLIPTLFIVSVLVFLFVHMLPGDPARLIAGPEADAQVIELVRQQLGLDQPL  61

Query  87   LLQYWHWLSQLLQGNFGQSIDSNVPVLQIIQNYFGNTVALTSLVIVVTVPLSVVLGVWLS  146
              Q+WH++S  +QG+ G S+ S  PV   I + F  T+ LT   +V  V   +  G+  +
Sbjct  62   YHQFWHYISNAVQGDLGLSMVSRRPVADEIASRFMPTLWLTITSMVWAVIFGMAAGIIAA  121

Query  147  LHRDSKLDRIVVSSSIVFKAVPGFVIAIWLMMFFSTSVLHVLPAASLLIPNESPYSQLEF  206
            + R+   DR+ ++ ++   + P F + + L+  FS   L  LP               + 
Sbjct  122  VWRNRWPDRLSMTIAVSGISFPAFALGMLLIQVFSVE-LGWLPTVGA--------DSWQH  172

Query  207  LILPILTLALSLTPYLMRLVRGSMIDALESEYVTSARLRGIPERRIIWKHVLPNALVPVV  266
             ILP LTL  ++   + R  R S +D L  +Y+ +AR +G+ E  ++ KH L NA++PVV
Sbjct  173  YILPSLTLGAAVAAVMARFTRASFVDVLSEDYMRTARAKGVSETWVVLKHGLRNAMIPVV  232

Query  267  QGTALTIRVLLSGALIIEVVFSYPGIGNALNAAIEMRDIPTIQAIVLLLTICVVMVNLIA  326
                L    LL G++++E VF++PG+G  L  ++EMRD P IQA +LL ++  +++NL+ 
Sbjct  233  TMMGLQFGFLLGGSIVVEKVFNWPGLGRLLVDSVEMRDYPVIQAEILLFSLEFILINLVV  292

Query  327  DLITTLLTPKIR  338
            D++   + P IR
Sbjct  293  DVLYAAINPAIR  304


> Q5PGP5 Glutathione transport system permease protein GsiC [Salmonella 
paratyphi A (strain ATCC 9150 / SARB42)]
Length=306

 Score =  196 bits (499),  Expect = 4e-62
 Identities = 105/312 (34%), Positives = 181/312 (58%), Gaps = 9/312 (3%)

Query  27   LPWFLTRLVSGILVVFVISLVVFIATQALPSDPARVILGPEASEATVQILREQLGLNDPI  86
            L + L RL+  I  + +++++VF+    LP DPAR+I GPEA    + ++R+QLGL+ P+
Sbjct  2    LNYVLKRLLGLIPTLLIVAVLVFLFVHLLPGDPARLIAGPEADAQVIALVRQQLGLDQPL  61

Query  87   LLQYWHWLSQLLQGNFGQSIDSNVPVLQIIQNYFGNTVALTSLVIVVTVPLSVVLGVWLS  146
             +Q+W +++ +LQG+FG S+ S  PV + I + F  T+ LT   ++  V   + +G+  +
Sbjct  62   HVQFWRYITHVLQGDFGTSMVSRRPVSEEIASRFLPTLWLTITSMIWAVLFGMAIGIAAA  121

Query  147  LHRDSKLDRIVVSSSIVFKAVPGFVIAIWLMMFFSTSVLHVLPAASLLIPNESPYSQLEF  206
            + R+   DR+ ++ ++   + P F + + LM  FS   L  LP               + 
Sbjct  122  VWRNRWPDRLGMTLAVTGISFPAFALGMLLMQIFSVD-LGWLPTVGA--------DSWQH  172

Query  207  LILPILTLALSLTPYLMRLVRGSMIDALESEYVTSARLRGIPERRIIWKHVLPNALVPVV  266
             ILP LTL  ++   + R  R S +D L  +Y+ +AR +G+ E  ++ KH L NA++PVV
Sbjct  173  YILPSLTLGAAVASVMARFTRSSFVDVLSEDYMRTARAKGVSETWVVLKHGLRNAMIPVV  232

Query  267  QGTALTIRVLLSGALIIEVVFSYPGIGNALNAAIEMRDIPTIQAIVLLLTICVVMVNLIA  326
                L    LL G++++E VF++PG+G  L  +++MRD P IQA VLL ++  +++NL+ 
Sbjct  233  TMMGLQFGFLLGGSIVVEKVFNWPGLGRLLVDSVDMRDYPVIQAEVLLFSLEFILINLVV  292

Query  327  DLITTLLTPKIR  338
            D++   + P IR
Sbjct  293  DVLYAAINPAIR  304


> Q323W3 Glutathione transport system permease protein GsiC [Shigella 
boydii serotype 4 (strain Sb227)]
Length=306

 Score =  196 bits (498),  Expect = 5e-62
 Identities = 106/312 (34%), Positives = 179/312 (57%), Gaps = 9/312 (3%)

Query  27   LPWFLTRLVSGILVVFVISLVVFIATQALPSDPARVILGPEASEATVQILREQLGLNDPI  86
            L + + RL+  I  +F++S++VF+    LP DPAR+I GPEA    ++++R+QLGL+ P+
Sbjct  2    LNYVIKRLLGLIPTLFIVSVLVFLFVHMLPGDPARLIAGPEADAQVIELVRQQLGLDQPL  61

Query  87   LLQYWHWLSQLLQGNFGQSIDSNVPVLQIIQNYFGNTVALTSLVIVVTVPLSVVLGVWLS  146
              Q+WH++S  +QG+FG S+ S  PV   I + F  T+ LT   +V  V   +  G+  +
Sbjct  62   YHQFWHYISNAVQGDFGLSMVSRRPVADEIASRFMPTLWLTITSMVWAVIFGMAAGIIAA  121

Query  147  LHRDSKLDRIVVSSSIVFKAVPGFVIAIWLMMFFSTSVLHVLPAASLLIPNESPYSQLEF  206
            + R+   DR+ ++ ++   + P F + + L+  FS   L  LP               + 
Sbjct  122  VWRNRWPDRLSMTIAVSGISFPAFALGMLLIQVFSVE-LGWLPTVGA--------DSWQH  172

Query  207  LILPILTLALSLTPYLMRLVRGSMIDALESEYVTSARLRGIPERRIIWKHVLPNALVPVV  266
             IL  LTL  ++   + R  R S +D L  +Y+ +AR +G+ E  ++ KH L NA++PVV
Sbjct  173  YILSSLTLGAAVAAVMARFTRASFVDVLSEDYMRTARAKGVSETWVVLKHGLRNAMIPVV  232

Query  267  QGTALTIRVLLSGALIIEVVFSYPGIGNALNAAIEMRDIPTIQAIVLLLTICVVMVNLIA  326
                L    LL G++++E VF++PG+G  L  ++EMRD P IQA +LL ++  +++NL+ 
Sbjct  233  TMMGLQFGFLLGGSIVVEKVFNWPGLGRLLVDSVEMRDYPVIQAEILLFSLEFILINLVV  292

Query  327  DLITTLLTPKIR  338
            D++   + P IR
Sbjct  293  DVLYAAINPAIR  304


> Q2FYQ5 Nickel import system permease protein NikB [Staphylococcus 
aureus (strain NCTC 8325)]
Length=328

 Score =  186 bits (472),  Expect = 6e-58
 Identities = 106/311 (34%), Positives = 185/311 (59%), Gaps = 16/311 (5%)

Query  31   LTRLVSGILVVFVISLVVFIATQALPSDPARVILGPEASEATVQIL---REQLGLNDPIL  87
            L RL+  I+V+FVIS + FI  +  P +P   IL  + ++ + + +   +++LGLND +L
Sbjct  8    LYRLMQMIVVLFVISTLTFILMKLSPGNPVDKILHLDVAQVSTEQINATKDKLGLNDSLL  67

Query  88   LQYWHWLSQLLQGNFGQSIDSNVPVLQIIQNYFGNTVALTSLVIVVTVPLSVVLGVWLSL  147
            +Q+WHW++ LL  N G+S +S  PV QI+ NY   T+ ++   +VV++ +S+ LG+  + 
Sbjct  68   VQWWHWMNHLLHFNLGKSFESKEPVTQILFNYAPITLLISFSTLVVSLCISIPLGIIAAK  127

Query  148  HRDSKLDRIVVSSSIVFKAVPGFVIAIWLMMFFSTSVLHVLPAASLLIPNESPYSQLEFL  207
                  D+++   S +  ++P F I I +++F  T+++++                L   
Sbjct  128  RFHKWTDKVIRVISTLSISLPAFFIGI-ILLFIVTNLMNIDSVI------------LSQF  174

Query  208  ILPILTLALSLTPYLMRLVRGSMIDALESEYVTSARLRGIPERRIIWKHVLPNALVPVVQ  267
            ILP++TL+L +  Y++RLVR +++  L+S  V ++RLRG+ ER I+   +L   ++P++ 
Sbjct  175  ILPVITLSLGMCAYIIRLVRSNLLMLLQSNIVQASRLRGMNERYILIHDLLKPTILPIIP  234

Query  268  GTALTIRVLLSGALIIEVVFSYPGIGNALNAAIEMRDIPTIQAIVLLLTICVVMVNLIAD  327
               +++  L+ G ++IE +F  PGIG  L  +I+ RD P IQ  VL +   VV++N IAD
Sbjct  235  LLGISLGSLIGGTVVIENLFDIPGIGYLLMDSIKSRDYPVIQGCVLFIGFFVVIINTIAD  294

Query  328  LITTLLTPKIR  338
            L+T LL PK R
Sbjct  295  LLTLLLDPKQR  305


> P42062 Oligopeptide transport system permease protein AppB [Bacillus 
subtilis (strain 168)]
Length=316

 Score =  172 bits (436),  Expect = 7e-53
 Identities = 97/312 (31%), Positives = 173/312 (55%), Gaps = 4/312 (1%)

Query  29   WFLTRLVSGILVVFVISLVVFIATQALPSDPARVILGPEASEATVQILREQLGLNDPILL  88
            + + R +  I ++  I+++ F+  +A P DP  +++ P+ S+A  +   E+ GLNDP  +
Sbjct  4    YIIRRTLMSIPILLGITILSFVIMKAAPGDPMTLMMDPKISQADREQFIEKYGLNDPQYV  63

Query  89   QYWHWLSQLLQGNFGQSI-DSNVPVLQIIQNYFGNTVALTSLVIVVTVPLSVVLGVWLSL  147
            QY  WL  ++QG+FG SI     PV ++I     NT+ L  +  ++ + +S+  GV  + 
Sbjct  64   QYLKWLGNMVQGDFGTSIVRKGTPVSELIMARLPNTLLLMLVSTILALMISIPFGVLSAK  123

Query  148  HRDSKLDRIVVSSSIVFKAVPGFVIAIWLMMFFSTSVLHVLPAASLLIPNE--SPYSQLE  205
               SK+D  +  +S +  A+P F   + L+M  S + L   P   +   N   + + ++ 
Sbjct  124  RPYSKIDYGITFTSFIGLAIPNFWFGLILIMVLSVN-LGWFPTGGVETLNTEFNIFDRIH  182

Query  206  FLILPILTLALSLTPYLMRLVRGSMIDALESEYVTSARLRGIPERRIIWKHVLPNALVPV  265
             LILP   LA +    L R  R +M+D L  +Y+ +AR +G  E R+++KH L NAL+PV
Sbjct  183  HLILPAFVLATADMAGLTRYTRSNMLDVLNQDYIRTARAKGFKENRVLFKHGLRNALLPV  242

Query  266  VQGTALTIRVLLSGALIIEVVFSYPGIGNALNAAIEMRDIPTIQAIVLLLTICVVMVNLI  325
            +    L I   + G++++E +F++PG+G     +   RD P I A+ ++  + VV+ NLI
Sbjct  243  ITIFGLMIPSFIGGSVVVEQIFTWPGLGKLFVDSAFQRDYPVIMAMTVISAVLVVVGNLI  302

Query  326  ADLITTLLTPKI  337
            AD++  ++ P+I
Sbjct  303  ADILYAIVDPRI  314


 Score = 21.6 bits (44),  Expect = 0.69
 Identities = 14/42 (33%), Positives = 22/42 (52%), Gaps = 4/42 (10%)

Query  307  TIQAIVLLLTIC----VVMVNLIADLITTLLTPKIRTAKRHK  344
            T+ +I +LL I     V+M     D +T ++ PKI  A R +
Sbjct  9    TLMSIPILLGITILSFVIMKAAPGDPMTLMMDPKISQADREQ  50


> P77308 Probable D,D-dipeptide transport system permease protein 
DdpB [Escherichia coli (strain K12)]
Length=340

 Score =  169 bits (427),  Expect = 2e-51
 Identities = 96/321 (30%), Positives = 176/321 (55%), Gaps = 22/321 (7%)

Query  38   ILVVFVISLVVFIATQALPSDPARVILGPEASEATVQILREQLGLNDPILLQYWHWLSQL  97
            +LVV  + ++ FI +  +P DPAR++ G  AS+A V+ +R+QLGL+ P+ +Q++ ++S L
Sbjct  15   VLVVAGVCVITFIISHLIPGDPARLLAGDRASDAIVENIRQQLGLDQPLYVQFYRYVSDL  74

Query  98   LQGNFGQSIDSNVPVLQIIQNYFGNTVALTSLVIVVTVPLSVVLGVWLSLHRDSKLDRIV  157
              G+ G SI +  PVL+ ++ +F  T+ L    +++ + + + LG+  ++ R+  LD +V
Sbjct  75   FHGDLGTSIRTGRPVLEELRIFFPATLELAFGALLLALLIGIPLGILSAVWRNRWLDHLV  134

Query  158  VSSSIVFKAVPGFVIAIWLMMFFSTSVLHVLPAASLLIPNESP-----------------  200
               +I   + P F + + +++ F    L +LP    L     P                 
Sbjct  135  RIMAITGISTPAFWLGLGVIVLFYGH-LQILPGGGRLDDWLDPPTHVTGFYLLDALLEGN  193

Query  201  ----YSQLEFLILPILTLALSLTPYLMRLVRGSMIDALESEYVTSARLRGIPERRIIWKH  256
                ++ L+ LILP LTLA      + R +R +M++ L  +Y+ +AR  G+P   I+  +
Sbjct  194  GEVFFNALQHLILPALTLAFVHLGIVARQIRSAMLEQLSEDYIRTARASGLPGWYIVLCY  253

Query  257  VLPNALVPVVQGTALTIRVLLSGALIIEVVFSYPGIGNALNAAIEMRDIPTIQAIVLLLT  316
             LPNAL+P +    L +  LL GA++ E VF++PG+G  +  +I+  D P +    ++++
Sbjct  254  ALPNALIPSITVLGLALGDLLYGAVLTETVFAWPGMGAWVVTSIQALDFPAVMGFAVVVS  313

Query  317  ICVVMVNLIADLITTLLTPKI  337
               V+VNL+ DL+   + P+I
Sbjct  314  FAYVLVNLVVDLLYLWIDPRI  334


> P33591 Nickel transport system permease protein NikB [Escherichia 
coli (strain K12)]
Length=314

 Score =  165 bits (417),  Expect = 4e-50
 Identities = 106/315 (34%), Positives = 166/315 (53%), Gaps = 12/315 (4%)

Query  27   LPWFLTRLVSGILVVFVISLVVFIATQALPSDPARVILGPEASEATVQIL---REQLGLN  83
            L + L R +  I +V   S+++F+  +    DPA   L       T ++L   R  LGL+
Sbjct  2    LRYVLRRFLLLIPMVLAASVIIFLMLRLGTGDPALDYLRLSNLPPTPEMLASTRTMLGLD  61

Query  84   DPILLQYWHWLSQLLQGNFGQSIDSNVPVLQIIQNYFGNTVALTSLVIVVTVPLSVVLGV  143
             P+ +QY  WL + L  +FG S  S  PVL  + N+   T+ L    +V+ +  SV LG+
Sbjct  62   QPLYVQYGTWLWKALHLDFGISFASQRPVLDDMLNFLPATLELAGAALVLILLTSVPLGI  121

Query  144  WLSLHRDSKLDRIVVSSSIVFKAVPGFVIAIWLMMFFSTSVLHVLPAASLLIPNESPYSQ  203
            W + HRD   D  V   + +  ++P F +A  L+M FS   L  LPA          Y  
Sbjct  122  WAARHRDRLPDFAVRFIAFLGVSMPNFWLAFLLVMAFSV-YLQWLPAMG--------YGG  172

Query  204  LEFLILPILTLALSLTPYLMRLVRGSMIDALESEYVTSARLRGIPERRIIWKHVLPNALV  263
             + +ILP +++A        RL+R SM+D     +VT ARLRG+ +++   +H+L NA +
Sbjct  173  WQHIILPAVSIAFMSLAINARLLRASMLDVAGQRHVTWARLRGLNDKQTERRHILRNASL  232

Query  264  PVVQGTALTIRVLLSGALIIEVVFSYPGIGNALNAAIEMRDIPTIQAIVLLLTICVVMVN  323
            P++    + I  L+ G +IIE +F++PG+G    +AI  RD P IQ   L++ +  V+ N
Sbjct  233  PMITAVGMHIGELIGGTMIIENIFAWPGVGRYAVSAIFNRDYPVIQCFTLMMVVVFVVCN  292

Query  324  LIADLITTLLTPKIR  338
            LI DL+   L P+IR
Sbjct  293  LIVDLLNAALDPRIR  307


 Score = 18.1 bits (35),  Expect = 8.5
 Identities = 7/20 (35%), Positives = 11/20 (55%), Gaps = 0/20 (0%)

Query  357  WKSGRPITVKPVDRRNALKN  376
            W   R +  K  +RR+ L+N
Sbjct  210  WARLRGLNDKQTERRHILRN  229


> P94311 Dipeptide transport system permease protein DppB [Bacillus 
pseudofirmus (strain OF4)]
Length=333

 Score =  164 bits (414),  Expect = 2e-49
 Identities = 99/332 (30%), Positives = 176/332 (53%), Gaps = 21/332 (6%)

Query  27   LPWFLTRLVSGILVVFVISLVVFIATQALPSDPARVILGPEASEATVQILREQLGLNDPI  86
            L + + RL+  I V+  +++V F     +P +PA+ ILG +AS   +  L E+LGLN+P 
Sbjct  2    LAYAMRRLLLLIPVLIGMTIVTFSIIHLIPGNPAQTILGEQASPQAIADLEERLGLNEPY  61

Query  87   LLQYWHWLSQLLQGNFGQSIDSNVPVLQIIQNYFGNTVALTSLVIVVTVPLSVVLGVWLS  146
             +QY  ++  L  G+ G S+ +N P+++ I  Y   T+ LT   ++  + + V  G+  +
Sbjct  62   WVQYGLYMKDLATGDLGTSLRTNKPIMEEIWPYLAATIELTIFAMIFAIIIGVNAGIVSA  121

Query  147  LHRDSKLDRIVVSSSIVFKAVPGFVIAI-----------WLMMF---------FSTSVLH  186
              ++S  D + +  ++V  ++P F +A+           WL  F          ST+ L+
Sbjct  122  WKQNSWFDYLSMFIALVGVSMPIFWLALMEQWIFAQELGWLPAFGRDNPRDPIISTTGLY  181

Query  187  VLPAASLLIPNESPYSQLEFLILPILTLALSLTPYLMRLVRGSMIDALESEYVTSARLRG  246
            V     +    +  +  ++ LILP + L       + R+ R SM++ L S+Y+ +   +G
Sbjct  182  VFDTI-ISGQFDKTWESIKHLILPGIALGTIPMAIIARMTRSSMLEVLRSDYIRTVNAKG  240

Query  247  IPERRIIWKHVLPNALVPVVQGTALTIRVLLSGALIIEVVFSYPGIGNALNAAIEMRDIP  306
              +  +I+KH L NAL+PV+    L    LL GA++ E +FS+PGIG  +  AI  RD P
Sbjct  241  SGQGVVIYKHALKNALIPVLTVVGLQTGNLLGGAILTETIFSWPGIGRYIFEAINYRDYP  300

Query  307  TIQAIVLLLTICVVMVNLIADLITTLLTPKIR  338
             IQ+ +L++    V++NL  DL+ + + P+I+
Sbjct  301  VIQSGILVVATIFVLINLFVDLLYSYIDPRIK  332


> P45096 Dipeptide transport system permease protein DppB [Haemophilus 
influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)]
Length=333

 Score =  156 bits (395),  Expect = 8e-47
 Identities = 95/325 (29%), Positives = 169/325 (52%), Gaps = 19/325 (6%)

Query  33   RLVSGILVVFVISLVVFIATQALPSDPARVILGPEASEATV-QILREQLGLNDPILLQYW  91
            R++  I     I+L+ F     +P DP  +++G     A V Q +  QLGL+ P+  QY+
Sbjct  8    RILMVIPTFIAITLITFALVHFIPGDPVEIMMGERGLTAEVHQQMMHQLGLDLPLYQQYF  67

Query  92   HWLSQLLQGNFGQSIDSNVPVLQIIQNYFGNTVALTSLVIVVTVPLSVVLGVWLSLHRDS  151
            H++  ++QG+FG S  +  PVL      F  T  L    +  ++   ++LG   ++ +DS
Sbjct  68   HYIGNVIQGDFGASFRTQQPVLTEFFTLFPATAELAFFALFWSLLGGIILGTIAAVKKDS  127

Query  152  KLDRIVVSSSIVFKAVPGFVIAIWLMMFFSTSV------------LHVLPAASLLIPN--  197
             +   V ++S+   ++P F   + L+++ S  +                P   +LI +  
Sbjct  128  WISHTVTAASLTGYSMPIFWWGLILILYVSPQLGLPQGGRLDNEFWIDTPTGFMLIDSWL  187

Query  198  ----ESPYSQLEFLILPILTLALSLTPYLMRLVRGSMIDALESEYVTSARLRGIPERRII  253
                 +  + ++ LILP + L       + R+ R +M++ L  +Y+ +A+ +G+   RI+
Sbjct  188  SGVSGAFENAVKSLILPAIVLGTVPLAIITRMTRSAMLEVLGEDYIRTAKAKGLSYTRIV  247

Query  254  WKHVLPNALVPVVQGTALTIRVLLSGALIIEVVFSYPGIGNALNAAIEMRDIPTIQAIVL  313
              H L NAL+PVV    L +  LLSGA++ E +FS+PGIG  +  AI+ RD P +Q  VL
Sbjct  248  IVHALRNALIPVVTVVGLIVAQLLSGAVLTETIFSWPGIGKWIIDAIQARDYPVLQGSVL  307

Query  314  LLTICVVMVNLIADLITTLLTPKIR  338
            ++   +++VNL  DL+  ++ P+IR
Sbjct  308  IIATIIIVVNLTVDLLYGVVNPRIR  332


> P0A4N8 Oligopeptide transport system permease protein OppB [Lactococcus 
lactis subsp. cremoris (strain SK11)]
Length=319

 Score =  151 bits (381),  Expect = 6e-45
 Identities = 86/313 (27%), Positives = 161/313 (51%), Gaps = 6/313 (2%)

Query  31   LTRLVSGILVVFVISLVVFIATQALPSDPARVILGPEASEATVQILREQLGLNDPILLQY  90
            + R++  I  +F++S++VF   + +P DP   ++GP      V+ LR   GL DP   QY
Sbjct  6    IRRILLMIPQLFILSILVFFFAKLMPGDPFSGLIGPHTDPHEVEALRRAAGLYDPWWEQY  65

Query  91   WHWLSQLLQGNFGQSIDSNVPVLQIIQNYFGNTVALTSLVIVVTVPLSVVLGVWLSLHRD  150
              WL   + GN G S +   PV+ +I +   NT  ++ L +++T   ++ + +  + +  
Sbjct  66   LRWLGNAIHGNLGMSYNLKEPVMTVIGHRAINTFWMSLLSVILTYLFAIPMSIVAARNEG  125

Query  151  SKLDRIVVSSSIVFKAVPGFVIAIWLMMFFSTSVLHVLPAASLLIPNESP-----YSQLE  205
               D++ ++ + +   +P +V  + ++  F  S L+  P    + P+        +S++ 
Sbjct  126  KWQDQLWLTYNSITFGIPPYVFYLLIIFIFGYS-LNWFPTGGTVSPDAMGIIPVFFSKIY  184

Query  206  FLILPILTLALSLTPYLMRLVRGSMIDALESEYVTSARLRGIPERRIIWKHVLPNALVPV  265
             +ILP  +LA+  T  +    R  ++D    +YV +AR +G+ E+ I  +H+L NA +P+
Sbjct  185  HMILPAFSLAVFGTVGIFTYFRSGILDEQTQDYVRTARAKGVKEKVIFRRHILRNASLPI  244

Query  266  VQGTALTIRVLLSGALIIEVVFSYPGIGNALNAAIEMRDIPTIQAIVLLLTICVVMVNLI  325
                   I  LL GA+  E +F YPG+G     +I  RD   I A++LL     ++  L+
Sbjct  245  ASNFGFVITGLLGGAIFAETIFGYPGLGQLFITSISGRDYSMITALILLNGFLGLLGALL  304

Query  326  ADLITTLLTPKIR  338
            +D+I  ++ P+IR
Sbjct  305  SDIIMAMVDPRIR  317


> P0A4N7 Oligopeptide transport system permease protein OppB [Lactococcus 
lactis subsp. lactis (strain IL1403)]
Length=319

 Score =  151 bits (381),  Expect = 6e-45
 Identities = 86/313 (27%), Positives = 161/313 (51%), Gaps = 6/313 (2%)

Query  31   LTRLVSGILVVFVISLVVFIATQALPSDPARVILGPEASEATVQILREQLGLNDPILLQY  90
            + R++  I  +F++S++VF   + +P DP   ++GP      V+ LR   GL DP   QY
Sbjct  6    IRRILLMIPQLFILSILVFFFAKLMPGDPFSGLIGPHTDPHEVEALRRAAGLYDPWWEQY  65

Query  91   WHWLSQLLQGNFGQSIDSNVPVLQIIQNYFGNTVALTSLVIVVTVPLSVVLGVWLSLHRD  150
              WL   + GN G S +   PV+ +I +   NT  ++ L +++T   ++ + +  + +  
Sbjct  66   LRWLGNAIHGNLGMSYNLKEPVMTVIGHRAINTFWMSLLSVILTYLFAIPMSIVAARNEG  125

Query  151  SKLDRIVVSSSIVFKAVPGFVIAIWLMMFFSTSVLHVLPAASLLIPNESP-----YSQLE  205
               D++ ++ + +   +P +V  + ++  F  S L+  P    + P+        +S++ 
Sbjct  126  KWQDQLWLTYNSITFGIPPYVFYLLIIFIFGYS-LNWFPTGGTVSPDAMGIIPVFFSKIY  184

Query  206  FLILPILTLALSLTPYLMRLVRGSMIDALESEYVTSARLRGIPERRIIWKHVLPNALVPV  265
             +ILP  +LA+  T  +    R  ++D    +YV +AR +G+ E+ I  +H+L NA +P+
Sbjct  185  HMILPAFSLAVFGTVGIFTYFRSGILDEQTQDYVRTARAKGVKEKVIFRRHILRNASLPI  244

Query  266  VQGTALTIRVLLSGALIIEVVFSYPGIGNALNAAIEMRDIPTIQAIVLLLTICVVMVNLI  325
                   I  LL GA+  E +F YPG+G     +I  RD   I A++LL     ++  L+
Sbjct  245  ASNFGFVITGLLGGAIFAETIFGYPGLGQLFITSISGRDYSMITALILLNGFLGLLGALL  304

Query  326  ADLITTLLTPKIR  338
            +D+I  ++ P+IR
Sbjct  305  SDIIMAMVDPRIR  317


> P0AFH2 Oligopeptide transport system permease protein OppB [Escherichia 
coli (strain K12)]
Length=306

 Score =  149 bits (377),  Expect = 2e-44
 Identities = 94/315 (30%), Positives = 163/315 (52%), Gaps = 14/315 (4%)

Query  27   LPWFLTRLVSGILVVFVISLVVFIATQALPSDP--ARVILGPEASEATVQILREQLGLND  84
            L + L R +  I  +F++  + F   +  P  P      L PE     +  +  +  LND
Sbjct  2    LKFILRRCLEAIPTLFILITISFFMMRLAPGSPFTGERTLPPEV----MANIEAKYHLND  57

Query  85   PILLQYWHWLSQLLQGNFGQSID-SNVPVLQIIQNYFGNTVALTSLVIVVTVPLSVVLGV  143
            PI+ QY+ +L QL  G+FG S    +  V  ++ + F  +  L +    + V L V  GV
Sbjct  58   PIMTQYFSYLKQLAHGDFGPSFKYKDYSVNDLVASSFPVSAKLGAAAFFLAVILGVSAGV  117

Query  144  WLSLHRDSKLDRIVVSSSIVFKAVPGFVIAIWLMMFFSTSVLHVLPAASLLIPNESPYSQ  203
              +L +++K D  V+  ++    +P FV+A  L+M F+  +LH LP              
Sbjct  118  IAALKQNTKWDYTVMGLAMTGVVIPSFVVAPLLVMIFAI-ILHWLPGGGW------NGGA  170

Query  204  LEFLILPILTLALSLTPYLMRLVRGSMIDALESEYVTSARLRGIPERRIIWKHVLPNALV  263
            L+F+ILP++ L+L+    + R+ RGSMI+ L S ++ +AR +G+P RRII +H L  AL+
Sbjct  171  LKFMILPMVALSLAYIASIARITRGSMIEVLHSNFIRTARAKGLPMRRIILRHALKPALL  230

Query  264  PVVQGTALTIRVLLSGALIIEVVFSYPGIGNALNAAIEMRDIPTIQAIVLLLTICVVMVN  323
            PV+         +++G+++IE ++  PGIG         RD   + ++ +L+    ++ N
Sbjct  231  PVLSYMGPAFVGIITGSMVIETIYGLPGIGQLFVNGALNRDYSLVLSLTILVGALTILFN  290

Query  324  LIADLITTLLTPKIR  338
             I D++  ++ PKIR
Sbjct  291  AIVDVLYAVIDPKIR  305


> P0AEF8 Dipeptide transport system permease protein DppB [Escherichia 
coli (strain K12)]
Length=339

 Score =  148 bits (373),  Expect = 1e-43
 Identities = 94/338 (28%), Positives = 173/338 (51%), Gaps = 28/338 (8%)

Query  30   FLTRLVSGILVVFV-ISLVVFIATQALPSDPARVILGPE--ASEATVQILREQLGLNDPI  86
            F+ R +  ++  F+ I+L+ F     +P DP  ++ G    + E   Q+L E LGL+ P+
Sbjct  4    FILRRLGLVIPTFIGITLLTFAFVHMIPGDPVMIMAGERGISPERHAQLLAE-LGLDKPM  62

Query  87   LLQYWHWLSQLLQGNFGQSIDSNVPVLQIIQNYFGNTVALTSLVIVVTVPLSVVLGVWLS  146
              QY H++  ++ G+ G S+ S +PV +     F  T+ L    ++    + + +GV  +
Sbjct  63   WQQYLHYIWGVMHGDLGISMKSRIPVWEEFVPRFQATLELGVCAMIFATAVGIPVGVLAA  122

Query  147  LHRDSKLDRIVVSSSIVFKAVPGFVIAIWLMMFFSTSVLHVLPAAS-----LLIPNESPY  201
            + R S  D   V  ++   ++P F   + L+M  S    ++ P +      + + + +P 
Sbjct  123  VKRGSIFDHTAVGLALTGYSMPIFWWGMMLIMLVSVH-WNLTPVSGRVSDMVFLDDSNPL  181

Query  202  S------------------QLEFLILPILTLALSLTPYLMRLVRGSMIDALESEYVTSAR  243
            +                   +  +ILP + L       ++R+ R SM++ L  +Y+ +AR
Sbjct  182  TGFMLIDTAIWGEDGNFIDAVAHMILPAIVLGTIPLAVIVRMTRSSMLEVLGEDYIRTAR  241

Query  244  LRGIPERRIIWKHVLPNALVPVVQGTALTIRVLLSGALIIEVVFSYPGIGNALNAAIEMR  303
             +G+   R+I  H L NA++PVV    L +  LL+GA++ E +FS+PG+G  L  A++ R
Sbjct  242  AKGLTRMRVIIVHALRNAMLPVVTVIGLQVGTLLAGAILTETIFSWPGLGRWLIDALQRR  301

Query  304  DIPTIQAIVLLLTICVVMVNLIADLITTLLTPKIRTAK  341
            D P +Q  VLL+   +++VNL+ DL+  ++ P+IR  K
Sbjct  302  DYPVVQGGVLLVATMIILVNLLVDLLYGVVNPRIRHKK  339



Lambda      K        H        a         alpha
   0.326    0.140    0.412    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2187477


  Database: 02495870eaf542ce963b249e58b44f1e.SwissProt.fasta
    Posted date:  Sep 19, 2020  2:26 PM
  Number of letters in database: 7,844
  Number of sequences in database:  25



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40