ACIAD1464 / TrEMBL Alignments

BLASTP 2.2.28+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: bec2c6dcdfa4a8714cf3aaa0bd3b24e6.TrEMBL.fasta
           18 sequences; 4,951 total letters



Query= ACIAD1464

Length=281
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  Q6FC84 Putative transport protein (ABC superfamily, atp_bind) [...   556    0.0   
  N9S1U2 ABC transporter domain-containing protein [Acinetobacter...   501    0.0   
  N9C104 ABC transporter domain-containing protein [Acinetobacter...   501    0.0   
  A0A009ZMD7 ABC transporter family protein [Acinetobacter sp. 47...   499    0.0   
  N9AE70 ABC transporter domain-containing protein [Acinetobacter...   458    1e-166
  A0A1P8EHM0 Nitrate/sulfonate/bicarbonate ABC transporter ATP-bi...   457    2e-166
  A0A0M1I1A2 Nitrate ABC transporter ATPase [Acinetobacter sp. C15]    455    2e-165
  U7GAL7 Nitrate ABC transporter ATPase [Acinetobacter sp. COS3]       441    1e-159
  Q9WWU7 AtsC [Pseudomonas putida]                                     168    6e-53 
  Q50444 ORF3 [Mycolicibacterium smegmatis]                            161    7e-51 
  Q3LFK7 AbsT1 [Alcaligenes sp. O-1]                                   162    1e-50 
  Q4ZGZ7 NrtD [Thermoleptolyngbya oregonensis PCC 8501]                158    3e-49 
  O05347 MalK-like protein [Synechococcus elongatus (strain PCC 7...   157    8e-49 
  Q1T790 Putative ABC transporter subunit [Thiobacillus thioparus]     156    9e-49 
  O33418 ABC-type transporter, putative ATP-binding component [Ps...   155    5e-48 
  Q9AKT5 Putative ABC-transporter [Paenibacillus durus]                152    2e-47 
  W0S5H2 Aliphatic sulfonates import ATP-binding protein SsuB [Ge...   149    6e-46 
  Q5F4T8 Putative ABC MSA transporter ATP-binding component [Meth...   148    2e-45 


> Q6FC84 Putative transport protein (ABC superfamily, atp_bind) 
[Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)]
Length=280

 Score =  556 bits (1434),  Expect = 0.0
 Identities = 280/280 (100%), Positives = 280/280 (100%), Gaps = 0/280 (0%)

Query  1    MQEGNLIMNSAVSILTETEVHPNSVSPMLMVRGVEKIYPNGTHALQRFDLDIQRGEIISL  60
            MQEGNLIMNSAVSILTETEVHPNSVSPMLMVRGVEKIYPNGTHALQRFDLDIQRGEIISL
Sbjct  1    MQEGNLIMNSAVSILTETEVHPNSVSPMLMVRGVEKIYPNGTHALQRFDLDIQRGEIISL  60

Query  61   LGPSGCGKSTLLKMFADLEQPSAGQVRWNGKTDMQSQCKMAMVFQEATLMPWANIQDNVR  120
            LGPSGCGKSTLLKMFADLEQPSAGQVRWNGKTDMQSQCKMAMVFQEATLMPWANIQDNVR
Sbjct  61   LGPSGCGKSTLLKMFADLEQPSAGQVRWNGKTDMQSQCKMAMVFQEATLMPWANIQDNVR  120

Query  121  LPLDLRHVAKSASNEKVAEALTSVGLGKFGASFPKELSGGMQMRASLARALVTEPDLLLM  180
            LPLDLRHVAKSASNEKVAEALTSVGLGKFGASFPKELSGGMQMRASLARALVTEPDLLLM
Sbjct  121  LPLDLRHVAKSASNEKVAEALTSVGLGKFGASFPKELSGGMQMRASLARALVTEPDLLLM  180

Query  181  DEPFGALDEFTRHRLDSDIRTLWSERDLTVVFVTHSIYEAVFLSSRVIVMGARPGRVVAD  240
            DEPFGALDEFTRHRLDSDIRTLWSERDLTVVFVTHSIYEAVFLSSRVIVMGARPGRVVAD
Sbjct  181  DEPFGALDEFTRHRLDSDIRTLWSERDLTVVFVTHSIYEAVFLSSRVIVMGARPGRVVAD  240

Query  241  ISIEGPEYRDEHFRTSDIFMKQCAHLSEILEQASGGEHHG  280
            ISIEGPEYRDEHFRTSDIFMKQCAHLSEILEQASGGEHHG
Sbjct  241  ISIEGPEYRDEHFRTSDIFMKQCAHLSEILEQASGGEHHG  280


> N9S1U2 ABC transporter domain-containing protein [Acinetobacter 
ursingii NIPH 706]
Length=280

 Score =  501 bits (1291),  Expect = 0.0
 Identities = 249/280 (89%), Positives = 261/280 (93%), Gaps = 0/280 (0%)

Query  1    MQEGNLIMNSAVSILTETEVHPNSVSPMLMVRGVEKIYPNGTHALQRFDLDIQRGEIISL  60
            M +G   MNSAVS+   TE   N  SPMLMVRGVEK+YPNGTHALQRFDLDIQRGEI+SL
Sbjct  1    MPKGEPNMNSAVSVSIATEPSANLSSPMLMVRGVEKVYPNGTHALQRFDLDIQRGEIVSL  60

Query  61   LGPSGCGKSTLLKMFADLEQPSAGQVRWNGKTDMQSQCKMAMVFQEATLMPWANIQDNVR  120
            LGPSGCGKSTLLKMFADLEQPSAGQVRWNGK DMQSQCKMAMVFQEATLMPWANIQDNVR
Sbjct  61   LGPSGCGKSTLLKMFADLEQPSAGQVRWNGKADMQSQCKMAMVFQEATLMPWANIQDNVR  120

Query  121  LPLDLRHVAKSASNEKVAEALTSVGLGKFGASFPKELSGGMQMRASLARALVTEPDLLLM  180
            LPLDLRHV+K+ SN+KV  ALTSVGLGKFG S+PKELSGGMQMRASLARALVTEPDLLLM
Sbjct  121  LPLDLRHVSKNISNQKVTAALTSVGLGKFGESYPKELSGGMQMRASLARALVTEPDLLLM  180

Query  181  DEPFGALDEFTRHRLDSDIRTLWSERDLTVVFVTHSIYEAVFLSSRVIVMGARPGRVVAD  240
            DEPFGALDEFTRHRLDSDIRTLWSERDLT+VFVTHSIYEAVFLSSRVIVMGARPGRVVAD
Sbjct  181  DEPFGALDEFTRHRLDSDIRTLWSERDLTIVFVTHSIYEAVFLSSRVIVMGARPGRVVAD  240

Query  241  ISIEGPEYRDEHFRTSDIFMKQCAHLSEILEQASGGEHHG  280
            I IEGP++RDEHFR SDIFMKQCAHLSE+LEQASGGEHHG
Sbjct  241  IRIEGPDHRDEHFRNSDIFMKQCAHLSEVLEQASGGEHHG  280


> N9C104 ABC transporter domain-containing protein [Acinetobacter 
ursingii ANC 3649]
Length=280

 Score =  501 bits (1291),  Expect = 0.0
 Identities = 249/280 (89%), Positives = 261/280 (93%), Gaps = 0/280 (0%)

Query  1    MQEGNLIMNSAVSILTETEVHPNSVSPMLMVRGVEKIYPNGTHALQRFDLDIQRGEIISL  60
            M +G   MNSAVS+   TE   N  SPMLMVRGVEK+YPNGTHALQRFDLDIQRGEI+SL
Sbjct  1    MPKGEPNMNSAVSVSIATEPSANLSSPMLMVRGVEKVYPNGTHALQRFDLDIQRGEIVSL  60

Query  61   LGPSGCGKSTLLKMFADLEQPSAGQVRWNGKTDMQSQCKMAMVFQEATLMPWANIQDNVR  120
            LGPSGCGKSTLLKMFADLEQPSAGQVRWNGK DMQSQCKMAMVFQEATLMPWANIQDNVR
Sbjct  61   LGPSGCGKSTLLKMFADLEQPSAGQVRWNGKADMQSQCKMAMVFQEATLMPWANIQDNVR  120

Query  121  LPLDLRHVAKSASNEKVAEALTSVGLGKFGASFPKELSGGMQMRASLARALVTEPDLLLM  180
            LPLDLRHV+K+ SN+KV  ALTSVGLGKFG S+PKELSGGMQMRASLARALVTEPDLLLM
Sbjct  121  LPLDLRHVSKNISNQKVTAALTSVGLGKFGESYPKELSGGMQMRASLARALVTEPDLLLM  180

Query  181  DEPFGALDEFTRHRLDSDIRTLWSERDLTVVFVTHSIYEAVFLSSRVIVMGARPGRVVAD  240
            DEPFGALDEFTRHRLDSDIRTLWSERDLT+VFVTHSIYEAVFLSSRVIVMGARPGRVVAD
Sbjct  181  DEPFGALDEFTRHRLDSDIRTLWSERDLTIVFVTHSIYEAVFLSSRVIVMGARPGRVVAD  240

Query  241  ISIEGPEYRDEHFRTSDIFMKQCAHLSEILEQASGGEHHG  280
            I IEGP++RDEHFR SDIFMKQCAHLSE+LEQASGGEHHG
Sbjct  241  IRIEGPDHRDEHFRNSDIFMKQCAHLSEVLEQASGGEHHG  280


> A0A009ZMD7 ABC transporter family protein [Acinetobacter sp. 
479375]
Length=273

 Score =  499 bits (1286),  Expect = 0.0
 Identities = 247/273 (90%), Positives = 258/273 (95%), Gaps = 0/273 (0%)

Query  8    MNSAVSILTETEVHPNSVSPMLMVRGVEKIYPNGTHALQRFDLDIQRGEIISLLGPSGCG  67
            MNSAVS+   TE   N  SPMLMVRGVEK+YPNGTHALQRFDLDIQRGEI+SLLGPSGCG
Sbjct  1    MNSAVSVSIATEPSANLSSPMLMVRGVEKVYPNGTHALQRFDLDIQRGEIVSLLGPSGCG  60

Query  68   KSTLLKMFADLEQPSAGQVRWNGKTDMQSQCKMAMVFQEATLMPWANIQDNVRLPLDLRH  127
            KSTLLKMFADLEQPSAGQVRWNGK DMQSQCKMAMVFQEATLMPWANIQDNVRLPLDLRH
Sbjct  61   KSTLLKMFADLEQPSAGQVRWNGKADMQSQCKMAMVFQEATLMPWANIQDNVRLPLDLRH  120

Query  128  VAKSASNEKVAEALTSVGLGKFGASFPKELSGGMQMRASLARALVTEPDLLLMDEPFGAL  187
            V+K+ SN+KV  ALTSVGLGKFG S+PKELSGGMQMRASLARALVTEPDLLLMDEPFGAL
Sbjct  121  VSKNISNQKVTAALTSVGLGKFGESYPKELSGGMQMRASLARALVTEPDLLLMDEPFGAL  180

Query  188  DEFTRHRLDSDIRTLWSERDLTVVFVTHSIYEAVFLSSRVIVMGARPGRVVADISIEGPE  247
            DEFTRHRLDSDIRTLWSERDLT+VFVTHSIYEAVFLSSRVIVMGARPGRVVADI IEGP+
Sbjct  181  DEFTRHRLDSDIRTLWSERDLTIVFVTHSIYEAVFLSSRVIVMGARPGRVVADIRIEGPD  240

Query  248  YRDEHFRTSDIFMKQCAHLSEILEQASGGEHHG  280
            +RDEHFR SDIFMKQCAHLSE+LEQASGGEHHG
Sbjct  241  HRDEHFRNSDIFMKQCAHLSEVLEQASGGEHHG  273


> N9AE70 ABC transporter domain-containing protein [Acinetobacter 
soli NIPH 2899]
Length=272

 Score =  458 bits (1178),  Expect = 1e-166
 Identities = 229/273 (84%), Positives = 244/273 (89%), Gaps = 1/273 (0%)

Query  8    MNSAVSILTETEVHPNSVSPMLMVRGVEKIYPNGTHALQRFDLDIQRGEIISLLGPSGCG  67
            MNSAV +    E   N+V+PMLM RGVEK+YPNGTHALQR D+DIQRGEI+SLLGPSGCG
Sbjct  1    MNSAVFVSQNPEPQ-NTVAPMLMARGVEKVYPNGTHALQRLDVDIQRGEIVSLLGPSGCG  59

Query  68   KSTLLKMFADLEQPSAGQVRWNGKTDMQSQCKMAMVFQEATLMPWANIQDNVRLPLDLRH  127
            KSTLLKMFADLEQPSAGQVRW+GKTD+QSQCKMAMVFQEATLMPWANI +NVRLPLDLRH
Sbjct  60   KSTLLKMFADLEQPSAGQVRWHGKTDLQSQCKMAMVFQEATLMPWANIAENVRLPLDLRH  119

Query  128  VAKSASNEKVAEALTSVGLGKFGASFPKELSGGMQMRASLARALVTEPDLLLMDEPFGAL  187
            V K  S  KV  ALTSVGLG F AS+PKELSGGMQMRASLARALVTEPDLLLMDEPFGAL
Sbjct  120  VPKKISQPKVQAALTSVGLGNFAASYPKELSGGMQMRASLARALVTEPDLLLMDEPFGAL  179

Query  188  DEFTRHRLDSDIRTLWSERDLTVVFVTHSIYEAVFLSSRVIVMGARPGRVVADISIEGPE  247
            DEFTRHRLD DIRTLW+ERDLTVVFVTHSIYEAVFLSSRVIVMGARPGR+VADI+IEGP 
Sbjct  180  DEFTRHRLDQDIRTLWAERDLTVVFVTHSIYEAVFLSSRVIVMGARPGRIVADIAIEGPA  239

Query  248  YRDEHFRTSDIFMKQCAHLSEILEQASGGEHHG  280
             RD+HFR S+ FM QCA LS ILEQASGG HHG
Sbjct  240  QRDDHFRASERFMTQCAELSNILEQASGGHHHG  272


> A0A1P8EHM0 Nitrate/sulfonate/bicarbonate ABC transporter ATP-binding 
protein [Acinetobacter soli]
Length=272

 Score =  457 bits (1177),  Expect = 2e-166
 Identities = 228/273 (84%), Positives = 244/273 (89%), Gaps = 1/273 (0%)

Query  8    MNSAVSILTETEVHPNSVSPMLMVRGVEKIYPNGTHALQRFDLDIQRGEIISLLGPSGCG  67
            MNSAV +    E   N+V+PMLM RGVEK+YPNGTHALQR D+D+QRGEI+SLLGPSGCG
Sbjct  1    MNSAVFVSQNPEPQ-NTVAPMLMARGVEKVYPNGTHALQRLDVDVQRGEIVSLLGPSGCG  59

Query  68   KSTLLKMFADLEQPSAGQVRWNGKTDMQSQCKMAMVFQEATLMPWANIQDNVRLPLDLRH  127
            KSTLLKMFADLEQPSAGQVRW+GKTD+QSQCKMAMVFQEATLMPWANI +NVRLPLDLRH
Sbjct  60   KSTLLKMFADLEQPSAGQVRWHGKTDLQSQCKMAMVFQEATLMPWANIAENVRLPLDLRH  119

Query  128  VAKSASNEKVAEALTSVGLGKFGASFPKELSGGMQMRASLARALVTEPDLLLMDEPFGAL  187
            V K  S  KV  ALTSVGLG F AS+PKELSGGMQMRASLARALVTEPDLLLMDEPFGAL
Sbjct  120  VPKKISQPKVQAALTSVGLGNFAASYPKELSGGMQMRASLARALVTEPDLLLMDEPFGAL  179

Query  188  DEFTRHRLDSDIRTLWSERDLTVVFVTHSIYEAVFLSSRVIVMGARPGRVVADISIEGPE  247
            DEFTRHRLD DIRTLW+ERDLTVVFVTHSIYEAVFLSSRVIVMGARPGR+VADI+IEGP 
Sbjct  180  DEFTRHRLDQDIRTLWAERDLTVVFVTHSIYEAVFLSSRVIVMGARPGRIVADIAIEGPA  239

Query  248  YRDEHFRTSDIFMKQCAHLSEILEQASGGEHHG  280
             RD+HFR S+ FM QCA LS ILEQASGG HHG
Sbjct  240  QRDDHFRASERFMTQCAELSNILEQASGGHHHG  272


> A0A0M1I1A2 Nitrate ABC transporter ATPase [Acinetobacter sp. 
C15]
Length=272

 Score =  455 bits (1171),  Expect = 2e-165
 Identities = 228/273 (84%), Positives = 243/273 (89%), Gaps = 1/273 (0%)

Query  8    MNSAVSILTETEVHPNSVSPMLMVRGVEKIYPNGTHALQRFDLDIQRGEIISLLGPSGCG  67
            MNSAV +    E   N+V+PMLM RGVEK+YPNGTHALQR D+DIQRGEI+SLLGPSGCG
Sbjct  1    MNSAVFVSQNPEPQ-NTVAPMLMARGVEKVYPNGTHALQRLDVDIQRGEIVSLLGPSGCG  59

Query  68   KSTLLKMFADLEQPSAGQVRWNGKTDMQSQCKMAMVFQEATLMPWANIQDNVRLPLDLRH  127
            KSTLLKMFADLEQPSAGQVRW+GKTD+QSQCKMAMVFQEATLMPWANI +NVRLPLDLRH
Sbjct  60   KSTLLKMFADLEQPSAGQVRWHGKTDLQSQCKMAMVFQEATLMPWANIAENVRLPLDLRH  119

Query  128  VAKSASNEKVAEALTSVGLGKFGASFPKELSGGMQMRASLARALVTEPDLLLMDEPFGAL  187
            V K  S  KV  ALTSVGL  F AS+PKELSGGMQMRASLARALVTEPDLLLMDEPFGAL
Sbjct  120  VPKKISQPKVQAALTSVGLDNFAASYPKELSGGMQMRASLARALVTEPDLLLMDEPFGAL  179

Query  188  DEFTRHRLDSDIRTLWSERDLTVVFVTHSIYEAVFLSSRVIVMGARPGRVVADISIEGPE  247
            DEFTRHRLD DIRTLW+ERDLTVVFVTHSIYEAVFLSSRVIVMGARPGR+VADI+IEGP 
Sbjct  180  DEFTRHRLDQDIRTLWAERDLTVVFVTHSIYEAVFLSSRVIVMGARPGRIVADIAIEGPA  239

Query  248  YRDEHFRTSDIFMKQCAHLSEILEQASGGEHHG  280
             RD+HFR S+ FM QCA LS ILEQASGG HHG
Sbjct  240  QRDDHFRASERFMTQCAELSNILEQASGGHHHG  272


> U7GAL7 Nitrate ABC transporter ATPase [Acinetobacter sp. COS3]
Length=273

 Score =  441 bits (1133),  Expect = 1e-159
 Identities = 218/272 (80%), Positives = 241/272 (89%), Gaps = 0/272 (0%)

Query  8    MNSAVSILTETEVHPNSVSPMLMVRGVEKIYPNGTHALQRFDLDIQRGEIISLLGPSGCG  67
            MNSA+S+    +   N V+PM+MVRG EK YPNGTHALQR DL+I RGEI+SLLGPSGCG
Sbjct  1    MNSALSVDIPVKESSNFVTPMIMVRGAEKTYPNGTHALQRLDLNIARGEIVSLLGPSGCG  60

Query  68   KSTLLKMFADLEQPSAGQVRWNGKTDMQSQCKMAMVFQEATLMPWANIQDNVRLPLDLRH  127
            KSTLLKMFADLEQPSAG VRWNGK D+QSQCKMAMVFQEATLMPW+NI+DNVRLPLDLRH
Sbjct  61   KSTLLKMFADLEQPSAGHVRWNGKADIQSQCKMAMVFQEATLMPWSNIEDNVRLPLDLRH  120

Query  128  VAKSASNEKVAEALTSVGLGKFGASFPKELSGGMQMRASLARALVTEPDLLLMDEPFGAL  187
            VAKS S  KV EAL +VGL KF  ++P+ELSGGMQMRASLARALVTEPDLLLMDEPFGAL
Sbjct  121  VAKSESTPKVHEALKAVGLDKFAKAYPRELSGGMQMRASLARALVTEPDLLLMDEPFGAL  180

Query  188  DEFTRHRLDSDIRTLWSERDLTVVFVTHSIYEAVFLSSRVIVMGARPGRVVADISIEGPE  247
            DEFTRH+LDSDIR LWSERDLTVVFVTHSIYEAV+LSSRVIVMGARPGRVVAD+ ++GP 
Sbjct  181  DEFTRHKLDSDIRKLWSERDLTVVFVTHSIYEAVYLSSRVIVMGARPGRVVADLPVDGPY  240

Query  248  YRDEHFRTSDIFMKQCAHLSEILEQASGGEHH  279
             RDE FRTSD F+KQC+HLSE+L +ASGG  H
Sbjct  241  QRDESFRTSDGFIKQCSHLSELLAEASGGHDH  272


> Q9WWU7 AtsC [Pseudomonas putida]
Length=287

 Score =  168 bits (425),  Expect = 6e-53
 Identities = 87/231 (38%), Positives = 135/231 (58%), Gaps = 3/231 (1%)

Query  22   PNSVSPMLMVRGVEKIYPNGTH---ALQRFDLDIQRGEIISLLGPSGCGKSTLLKMFADL  78
            P++  P++   GV K++    H   A++ F+L I  GE I+++G SGCGKSTLL++   L
Sbjct  15   PDTTPPLVSFEGVGKVFTVDGHPMEAIRNFNLSINEGEFIAIVGASGCGKSTLLRLLVGL  74

Query  79   EQPSAGQVRWNGKTDMQSQCKMAMVFQEATLMPWANIQDNVRLPLDLRHVAKSASNEKVA  138
            +   +G +R +GK       +  +VFQE  L PW  ++ N+ L L    + +     +V 
Sbjct  75   DTDFSGSIRVDGKAVSGIGGERGIVFQEHRLFPWLTVEQNIALGLVNEPLTQGERARRVH  134

Query  139  EALTSVGLGKFGASFPKELSGGMQMRASLARALVTEPDLLLMDEPFGALDEFTRHRLDSD  198
            E +  VGL  F +++P +LSGGM  R ++AR LV  P +LL+DEPFGALD  TR +L  +
Sbjct  135  EFVLLVGLVGFESAYPHQLSGGMAQRVAIARGLVASPRILLLDEPFGALDALTRQQLQDE  194

Query  199  IRTLWSERDLTVVFVTHSIYEAVFLSSRVIVMGARPGRVVADISIEGPEYR  249
            +  +     +T + VTH   EA +L+ RV+V+  RPGR+ A + I+ P  R
Sbjct  195  LLAIRERAGITTLLVTHHAEEATYLADRVVVLEPRPGRIKAVVEIDLPHPR  245


> Q50444 ORF3 [Mycolicibacterium smegmatis]
Length=249

 Score =  161 bits (408),  Expect = 7e-51
 Identities = 84/207 (41%), Positives = 117/207 (57%), Gaps = 0/207 (0%)

Query  50   LDIQRGEIISLLGPSGCGKSTLLKMFADLEQPSAGQVRWNGKTDMQSQCKMAMVFQEATL  109
            L I  GE++  LGPSGCGKST+L+  A L +P  G    +G     +  + AMVFQE  L
Sbjct  25   LTIDPGEVVVFLGPSGCGKSTILRALAGLLKPMGGTATVDGAPVTGNAAQCAMVFQEDAL  84

Query  110  MPWANIQDNVRLPLDLRHVAKSASNEKVAEALTSVGLGKFGASFPKELSGGMQMRASLAR  169
            +PW     NV+ PL LR +            L  VGLG +    P +LSGGM+ R  LAR
Sbjct  85   LPWRTALKNVQFPLKLRGMRGKELKATATARLEQVGLGAYLDHLPSQLSGGMRQRVQLAR  144

Query  170  ALVTEPDLLLMDEPFGALDEFTRHRLDSDIRTLWSERDLTVVFVTHSIYEAVFLSSRVIV  229
             L  EP ++LMDEPFGALD  TR  +   + ++W  + +T++FVTH + EA+ L+ R+++
Sbjct  145  TLACEPHVMLMDEPFGALDAQTRLEMQQLLMSVWETQKMTLLFVTHDVDEALLLADRIVL  204

Query  230  MGARPGRVVADISIEGPEYRDEHFRTS  256
            +  RP  V   I+IE P   +  F  S
Sbjct  205  LSHRPATVADIITIEKPRTPEAQFEES  231


> Q3LFK7 AbsT1 [Alcaligenes sp. O-1]
Length=307

 Score =  162 bits (411),  Expect = 1e-50
 Identities = 96/275 (35%), Positives = 144/275 (52%), Gaps = 14/275 (5%)

Query  8    MNSAVSILTETEVHPNSVSPM----LMVRGVEKIYPNG-----THALQRFDLDIQRGEII  58
            + S  S +  T+    + +PM    + ++G+   YP          L   DLD++ GE +
Sbjct  33   VTSKTSSMVNTQAGLRTANPMPPPRIHIKGLRLEYPGAGARPPLTVLGGIDLDVRAGEFV  92

Query  59   SLLGPSGCGKSTLLKMFADLEQPSAGQVRWNGKTDMQSQCKMAMVFQEATLMPWANIQDN  118
             L+GPSGCGKS+L+ + A   +P+AG +  +G           MVFQ+ +L PW  ++ N
Sbjct  93   CLIGPSGCGKSSLITLLAGYGKPTAGTLSVDGVKVEGPAPDRVMVFQQPSLFPWYTVRAN  152

Query  119  VRLPLDLR--HVAKSASNEKVAEALTSVGLGKFGASFPKELSGGMQMRASLARALVTEPD  176
            +   + L+      S S  +  E +  VGL  FG   P ELSGGM+ R  +ARAL  +P 
Sbjct  153  ITFGMKLKANRGRFSDSGARADELIQLVGLNGFGDHLPNELSGGMRQRVEIARALAVDPA  212

Query  177  LLLMDEPFGALDEFTRHRLDSDIRTLWSERDLTVVFVTHSIYEAVFLSSRVIVMGARPGR  236
            +LLMDEPFGALD  TR  L  ++  +W     TV+FVTH I EAV L+  ++V   RP  
Sbjct  213  ILLMDEPFGALDALTRLTLQREMLRIWQATSKTVLFVTHDIVEAVLLADSIVVFSPRPAT  272

Query  237  VVADISIEGPEYRDEHFRTSDIFMKQCAHLSEILE  271
            +   + I+ P  R    R S    +   H++++LE
Sbjct  273  IRERVKIDLPRPR---HRDSAEVGRVARHIADLLE  304


> Q4ZGZ7 NrtD [Thermoleptolyngbya oregonensis PCC 8501]
Length=280

 Score =  158 bits (399),  Expect = 3e-49
 Identities = 93/239 (39%), Positives = 136/239 (57%), Gaps = 15/239 (6%)

Query  15   LTETEVHPNSV---SPMLMVRGVEKIYPN---GTHA-LQRFDLDIQRGEIISLLGPSGCG  67
            L  T++ P  V      L++  V K+YP    GT+  L   +L +Q GE +S++G SGCG
Sbjct  4    LDSTQLQPQPVPTTDAFLVIENVSKVYPTPNGGTYTVLDGVNLAVQEGEFVSIIGHSGCG  63

Query  68   KSTLLKMFADLEQPSAGQVRWNGKTDMQSQCKMAMVFQEATLMPWANIQDNVRLPLDLRH  127
            KSTL+ M +    PS+G+VR   +   +      +VFQ  +L+PW    +NV L L   H
Sbjct  64   KSTLMDMVSGFRTPSSGEVRLRNQRITEPGPDRMVVFQNYSLLPWMTAYENVYLGL---H  120

Query  128  VAKS--ASNEKVAEA---LTSVGLGKFGASFPKELSGGMQMRASLARALVTEPDLLLMDE  182
             A+   + +EK A A   L  VGL       P+ LSGGM+ R S+ARAL   P++LL+DE
Sbjct  121  AARPELSKSEKAAIARDHLAMVGLSDAMDKKPRALSGGMKQRVSIARALALRPEVLLLDE  180

Query  183  PFGALDEFTRHRLDSDIRTLWSERDLTVVFVTHSIYEAVFLSSRVIVMGARPGRVVADI  241
            PFGALD  TR  L  ++  +W++  +TV+ +TH I EA+ LS R+++M   P   V +I
Sbjct  181  PFGALDPITREELQEELLKIWTDHRVTVLMITHDIDEALLLSDRIVMMTNGPAAKVGEI  239


> O05347 MalK-like protein [Synechococcus elongatus (strain PCC 
7942 / FACHB-805)]
Length=289

 Score =  157 bits (397),  Expect = 8e-49
 Identities = 87/218 (40%), Positives = 127/218 (58%), Gaps = 3/218 (1%)

Query  26   SPMLMVRGVEKIYPNGTHALQRFDLDIQRGEIISLLGPSGCGKSTLLKMFADLEQPSAGQ  85
            SP L+ R + +  P    AL+  +L I     +S++GPSGCGKSTLL + A L+ P++GQ
Sbjct  30   SPSLLDR-LRQRSPKRYVALEDVNLTIASNTFVSIIGPSGCGKSTLLNLIAGLDLPTSGQ  88

Query  86   VRWNGKTDMQSQCKMAMVFQEATLMPWANIQDNVRLPLDLR--HVAKSASNEKVAEALTS  143
            +  +G+          +VFQ   LMPW    +NV   ++    +++KS + E   E L  
Sbjct  89   ILLDGQRIRSPGPDRGIVFQNYALMPWMTALENVIFAVETARPNLSKSQAREVAREHLEL  148

Query  144  VGLGKFGASFPKELSGGMQMRASLARALVTEPDLLLMDEPFGALDEFTRHRLDSDIRTLW  203
            VGL K    +P ++SGGM+ R ++ARAL   P LLLMDEPFGALD  TR  L  ++  +W
Sbjct  149  VGLTKAADRYPGQISGGMKQRVAIARALSIRPKLLLMDEPFGALDALTRGYLQEEVLRIW  208

Query  204  SERDLTVVFVTHSIYEAVFLSSRVIVMGARPGRVVADI  241
                L+VV +THSI EA+ LS R++VM   P   + ++
Sbjct  209  EANKLSVVLITHSIDEALLLSDRIVVMSRGPRATIREV  246


> Q1T790 Putative ABC transporter subunit [Thiobacillus thioparus]
Length=266

 Score =  156 bits (395),  Expect = 9e-49
 Identities = 89/247 (36%), Positives = 134/247 (54%), Gaps = 4/247 (2%)

Query  29   LMVRGVEKIYPNG-THALQRFDLDIQRGEIISLLGPSGCGKSTLLKMFADLEQPSAGQVR  87
            + + G+ + YP        R DL    GE ++++G SGCGKSTLL + A + + + G+V 
Sbjct  8    IRIEGLSQRYPTRKVPTFNRVDLVSPPGEAMAIIGRSGCGKSTLLHILAGITKGTEGRVL  67

Query  88   WNGKTDMQSQCKMAMVFQEATLMPWANIQDNVRLPLDLRHVAKSASNEKVAEALTSVGLG  147
             NG        +  M+FQ   L PW  +  NV + L      K  + E+V +A+  V L 
Sbjct  68   LNGTVVNGPSPRWVMMFQAPHLYPWMTVTQNVGVGLTFARWGKKETEERVNDAIRLVELQ  127

Query  148  KFGASFPKELSGGMQMRASLARALVTEPDLLLMDEPFGALDEFTRHRLDSDIRTLWSERD  207
             F  +  ++LSGG Q R +LAR+LV EP+LLL+DEPF ALD FTR  L  D+R +     
Sbjct  128  DFAQANVQDLSGGQQQRVALARSLVMEPELLLLDEPFSALDAFTRAALQKDVRAISKRLG  187

Query  208  LTVVFVTHSIYEAVFLSSRVIVMGARPGRVVADISIEGPEYRDEHFRTSDIFMKQCAHLS  267
              +V VTH I EAV ++ R ++M   PG +V ++ ++ P+ RD   RT     +  A L 
Sbjct  188  FNIVIVTHDIDEAVIVADRAVIMAGSPGDIVHEMDVDLPDPRD---RTDPQVQQLRARLM  244

Query  268  EILEQAS  274
               ++A+
Sbjct  245  ATFQEAA  251


> O33418 ABC-type transporter, putative ATP-binding component [Pseudomonas 
aeruginosa]
Length=278

 Score =  155 bits (391),  Expect = 5e-48
 Identities = 88/233 (38%), Positives = 135/233 (58%), Gaps = 6/233 (3%)

Query  22   PNSVSPMLMVRGVEKIYP---NGTHALQRFDLDIQRGEIISLLGPSGCGKSTLLKMFADL  78
            P + +P++  R V K +        A+Q+FDL+I  GE I+++G SGCGKSTLL++   L
Sbjct  7    PATGTPLVSFRQVRKHFAVDGRRLEAIQQFDLEIGEGEFIAIVGASGCGKSTLLRLLIGL  66

Query  79   EQPSAGQVRWNGKTDMQSQCKMAMVFQEATLMPWANIQDNVRLPLDLRHVAKSASNEKVA  138
            ++   G++R +G+       +  +VFQE  L PW  +Q NV L L    + ++    ++ 
Sbjct  67   DRDYDGEIRVDGRPIACMGGERGIVFQEHRLFPWLTVQQNVALGLVNEALGETDKAARID  126

Query  139  EALTSVGLGKFGASFPKELSGGMQMRASLARALVTEPDLLLMDEPFGALDEFTRHRLDSD  198
            E +  VGL  F  ++P +LSGGM  R ++AR LV  P LLL+DEPF ALD  TR +    
Sbjct  127  EYIRLVGLHGFERAYPHQLSGGMAQRVAIARGLVASPRLLLLDEPFSALDALTRQQCRKS  186

Query  199  IRTLWSERDLTVVFVTHSIYEAVFLSSRVIVMGARPGRV--VADISIEGPEYR  249
                 + R +T + VTH + EA++L+ RV+VM  RPGR+  V ++ +  P  R
Sbjct  187  CCDPPAHR-ITTLLVTHDVEEALYLADRVVVMEPRPGRIRRVVEVGLAHPRER  238


> Q9AKT5 Putative ABC-transporter [Paenibacillus durus]
Length=248

 Score =  152 bits (384),  Expect = 2e-47
 Identities = 78/194 (40%), Positives = 113/194 (58%), Gaps = 0/194 (0%)

Query  56   EIISLLGPSGCGKSTLLKMFADLEQPSAGQVRWNGKTDMQSQCKMAMVFQEATLMPWANI  115
            E ++++GPSGCGKSTLL + A L  P+ G++  +GK          +V Q   L PW  +
Sbjct  1    EFLTIVGPSGCGKSTLLDLIAGLATPTEGELYIDGKKITGPALDRGIVMQGYALFPWRTV  60

Query  116  QDNVRLPLDLRHVAKSASNEKVAEALTSVGLGKFGASFPKELSGGMQMRASLARALVTEP  175
            + NV   L+++ V K          L  VGL  +   +P ELSGGM+ R ++ARAL  +P
Sbjct  61   RRNVEFGLEIKKVPKKDRKAISDRFLELVGLSNYADRYPYELSGGMKQRVAIARALAYDP  120

Query  176  DLLLMDEPFGALDEFTRHRLDSDIRTLWSERDLTVVFVTHSIYEAVFLSSRVIVMGARPG  235
            ++LLMDEPF A+D  TR  L  ++  +W +   T++FVTHSI EAV L+ RV+VM   PG
Sbjct  121  EVLLMDEPFAAVDAQTRETLQDELLRIWEQTGKTIIFVTHSIDEAVALADRVVVMSPNPG  180

Query  236  RVVADISIEGPEYR  249
            +V   + +  P  R
Sbjct  181  KVREIVPVSLPRPR  194


> W0S5H2 Aliphatic sulfonates import ATP-binding protein SsuB [Geobacillus 
thermoleovorans]
Length=260

 Score =  149 bits (375),  Expect = 6e-46
 Identities = 82/205 (40%), Positives = 118/205 (58%), Gaps = 8/205 (4%)

Query  45   LQRFDLDIQRGEIISLLGPSGCGKSTLLKMFADLEQPSAGQVRWNGKTDMQSQCKMAMVF  104
            L+R DL ++ GE I+++G SGCGKSTLL++ A LE P++G ++ +G+          ++F
Sbjct  24   LRRIDLTVKPGEFIAIIGRSGCGKSTLLRLAAGLETPTSGMIQLDGQLLHGLNTAARVMF  83

Query  105  QEATLMPWANIQDNVRLPLDLRHVAKSASNEKVAEALTSVGLGKFGASFPKELSGGMQMR  164
            Q+A L+PW  + DNV L L      K    E+    L  VGL      +P  LSGG + R
Sbjct  84   QDARLLPWRRVIDNVGLGL------KGDWKEQAITVLEQVGLADRANDWPSVLSGGQRQR  137

Query  165  ASLARALVTEPDLLLMDEPFGALDEFTRHRLDSDIRTLWSERDLTVVFVTHSIYEAVFLS  224
             +LARAL++ P LLL+DEP GALD  TR  +   I  LW E+  T + VTH + EAV L+
Sbjct  138  VALARALISRPQLLLLDEPLGALDALTRIEMQRLIERLWREQRFTALLVTHDVDEAVMLA  197

Query  225  SRVIVMGARPGRVVADISIEGPEYR  249
             RV+++    G    D+ +  P  R
Sbjct  198  DRVVLI--EDGECALDLPVRLPRPR  220


> Q5F4T8 Putative ABC MSA transporter ATP-binding component [Methylosulfonomonas 
methylovora]
Length=285

 Score =  148 bits (374),  Expect = 2e-45
 Identities = 87/257 (34%), Positives = 135/257 (53%), Gaps = 14/257 (5%)

Query  17   ETEVHPNSVSPM---LMVRGVEKIY-PNGTH--ALQRFDLDIQRGEIISLLGPSGCGKST  70
            ++ ++P   +P    + +R V K+Y P+G    A+    ++I  GE+  ++GPSGCGK+T
Sbjct  2    QSHLNPAGAAPSKGAISIRNVTKVYDPDGAQVMAVDNCSMEIAPGEVCMIVGPSGCGKTT  61

Query  71   LLKMFADLEQPSAGQVRWNGKTDMQSQCKMA-------MVFQEATLMPWANIQDNVRL-P  122
            LL   A     + G++  +G     ++  +A       +VFQ   L PW  + +NV   P
Sbjct  62   LLNAIAGFHSITGGEILLDGVPLCGAKKPLADQGSDRIVVFQNGALFPWKTLAENVAYGP  121

Query  123  LDLRHVAKSASNEKVAEALTSVGLGKFGASFPKELSGGMQMRASLARALVTEPDLLLMDE  182
            +      K+   E+   AL   GLG     +P E+S GM  RA + RAL+ EP +LL+DE
Sbjct  122  MVQGRWPKAECIERARTALQKAGLGAVADKYPGEVSSGMARRAEIVRALINEPKVLLLDE  181

Query  183  PFGALDEFTRHRLDSDIRTLWSERDLTVVFVTHSIYEAVFLSSRVIVMGARPGRVVADIS  242
            P+ A+D  T+  +   +  ++    +T+ F+TH + EA+FL  RV VM  RP RV   I 
Sbjct  182  PYRAMDALTKQIMHEALLEMYDRTKVTIYFITHDLEEAIFLGDRVYVMTTRPCRVKKVID  241

Query  243  IEGPEYRDEHFRTSDIF  259
            I  P  RD H  TS+ F
Sbjct  242  INLPRPRDYHTLTSEAF  258



Lambda      K        H        a         alpha
   0.321    0.135    0.395    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 977276


  Database: bec2c6dcdfa4a8714cf3aaa0bd3b24e6.TrEMBL.fasta
    Posted date:  Sep 21, 2020  5:48 AM
  Number of letters in database: 4,951
  Number of sequences in database:  18



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40