ACIAD1464 / SwissProt Alignments

BLASTP 2.2.28+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: 86cad29ce5198d1ef75d651e309535be.SwissProt.fasta
           21 sequences; 6,428 total letters



Query= ACIAD1464

Length=281
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  Q57855 Uncharacterized ABC transporter ATP-binding protein MJ04...   180    9e-58
  Q65M64 Aliphatic sulfonates import ATP-binding protein SsuB [Ba...   175    5e-56
  Q81C68 Aliphatic sulfonates import ATP-binding protein SsuB [Ba...   174    1e-55
  Q1M7R4 Taurine import ATP-binding protein TauB [Rhizobium legum...   174    2e-55
  Q736E0 Aliphatic sulfonates import ATP-binding protein SsuB [Ba...   173    4e-55
  Q2YJB5 Putative ATP-binding protein BAB2_1147 [Brucella abortus...   173    5e-55
  Q8FUN3 Putative ATP-binding protein BRA1187/BS1330_II1178 [Bruc...   173    5e-55
  A0RFA4 Aliphatic sulfonates import ATP-binding protein SsuB [Ba...   172    1e-54
  Q63A38 Aliphatic sulfonates import ATP-binding protein SsuB [Ba...   171    2e-54
  Q2K164 Taurine import ATP-binding protein TauB [Rhizobium etli ...   171    4e-54
  Q16BJ3 Taurine import ATP-binding protein TauB [Roseobacter den...   171    4e-54
  Q6RH47 Taurine import ATP-binding protein TauB [Paracoccus pant...   160    6e-50
  P97027 Aliphatic sulfonates import ATP-binding protein SsuB [Ba...   159    8e-50
  Q55108 Bicarbonate transport ATP-binding protein CmpD [Synechoc...   157    1e-48
  Q55107 Bicarbonate transport ATP-binding protein CmpC [Synechoc...   161    3e-48
  Q6W2B1 Taurine import ATP-binding protein TauB [Sinorhizobium f...   153    2e-47
  Q47538 Taurine import ATP-binding protein TauB [Escherichia col...   152    3e-47
  P38046 Nitrate import ATP-binding protein NrtD [Synechococcus e...   152    6e-47
  Q55462 Bicarbonate transport ATP-binding protein CmpC [Synechoc...   155    7e-46
  Q55463 Bicarbonate transport ATP-binding protein CmpD [Synechoc...   148    2e-45
  O34992 Glycine betaine/carnitine/choline transport ATP-binding ...   150    2e-45


> Q57855 Uncharacterized ABC transporter ATP-binding protein MJ0412 
[Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 
2661 / JAL-1 / JCM 10045 / NBRC 100440)]
Length=267

 Score =  180 bits (457),  Expect = 9e-58
 Identities = 98/246 (40%), Positives = 149/246 (61%), Gaps = 6/246 (2%)

Query  29   LMVRGVEKIYP---NGTHALQRFDLDIQRGEIISLLGPSGCGKSTLLKMFADLEQPSAGQ  85
            L V  + KI+    N   AL   +L++   E ++++GPSGCGK+TLL++ A L+ P+ G+
Sbjct  17   LKVENLTKIFEFNGNRVKALDNINLEVYENEFLTVMGPSGCGKTTLLRIIAGLDYPTEGK  76

Query  86   VRWNGKTDMQSQCKMAMVFQEATLMPWANIQDNVRLPLDLRHVAKSASNEKVAEALTSVG  145
            V  +GK          +VFQ+ TLMPW  +  NV   L+L+ + K+   E   + +  VG
Sbjct  77   VLLDGKEVKGPGADRGVVFQQYTLMPWRTVLKNVTFGLELKGIPKNERIEIAKKFIKMVG  136

Query  146  LGKFGASFPKELSGGMQMRASLARALVTEPDLLLMDEPFGALDEFTRHRLDSDIRTLWSE  205
            L  F  ++P +LSGGMQ R ++AR L  +P+++LMDEPF ALD  TR+ L +++  +W +
Sbjct  137  LEGFEDAYPYQLSGGMQQRVAIARTLANDPEIVLMDEPFAALDAQTRNILQNELLKIWQK  196

Query  206  RDLTVVFVTHSIYEAVFLSSRVIVMGARPGRVVADISIEGPEYRDEHFRTSDIFMKQCAH  265
               TV FVTHS+ EAV+LS RV+V+ ARPGR+   + I+    RD   RTS  F++    
Sbjct  197  EKKTVFFVTHSVDEAVYLSDRVVVLTARPGRIKEIVKIDLERPRD---RTSIEFLEYRKK  253

Query  266  LSEILE  271
            +  IL+
Sbjct  254  ILNILK  259


> Q65M64 Aliphatic sulfonates import ATP-binding protein SsuB [Bacillus 
licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 
/ NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46)]
Length=255

 Score =  175 bits (444),  Expect = 5e-56
 Identities = 93/234 (40%), Positives = 143/234 (61%), Gaps = 9/234 (4%)

Query  29   LMVRGVEKIYPNG---THALQRFDLDIQRGEIISLLGPSGCGKSTLLKMFADLEQPSAGQ  85
            L +R  EK +  G   T  LQ  +L ++ GE ++++GPSGCGKSTLLK+ A L+    G+
Sbjct  3    LSIRVNEKAFGKGSFKTSVLQDVNLTVENGEFLTVIGPSGCGKSTLLKIAAGLDGDYEGR  62

Query  86   VRWNGKTDMQSQCKMAMVFQEATLMPWANIQDNVRLPLDLRHVAKSASNEKVAEALTSVG  145
            +  NG+       +   +FQE  L PW  ++ N+   L L+   + A  +KV E + +V 
Sbjct  63   ISMNGREIKGPGIQQGFIFQEHRLFPWMTVEQNIAADLSLK---EPAVRKKVDELIETVR  119

Query  146  LGKFGASFPKELSGGMQMRASLARALVTEPDLLLMDEPFGALDEFTRHRLDSDIRTLWSE  205
            L      +P+ELSGGM  R ++ARAL+ EP++LL+DEPFGALD FTR  L   +  +W E
Sbjct  120  LKGAEKQYPRELSGGMSQRVAIARALLREPEILLLDEPFGALDAFTRKHLQDVLTDIWRE  179

Query  206  RDLTVVFVTHSIYEAVFLSSRVIVMGARPGRVVADISIEGPEYRDEHFRTSDIF  259
            + +T++ VTH I E+V+L++R+ ++ A+PGR+   I ++ P  R    RTS +F
Sbjct  180  KKMTMILVTHDIDESVYLANRIAILTAKPGRIHKLIPVDLPFPRS---RTSPVF  230


> Q81C68 Aliphatic sulfonates import ATP-binding protein SsuB [Bacillus 
cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 
15305 / NCIMB 9373 / NRRL B-3711)]
Length=251

 Score =  174 bits (441),  Expect = 1e-55
 Identities = 84/210 (40%), Positives = 134/210 (64%), Gaps = 6/210 (3%)

Query  31   VRGVEKIYPNGT---HALQRFDLDIQRGEIISLLGPSGCGKSTLLKMFADLEQPSAGQVR  87
            + GV K +   T     L+  +  ++ G+ ++++GPSGCGKSTLLK+ A L+    G+V 
Sbjct  5    IDGVSKYFLKQTGTVQVLENINFQLEEGDFVTVIGPSGCGKSTLLKIVAGLDNDFEGEVV  64

Query  88   WNGKTDMQSQCKMAMVFQEATLMPWANIQDNVRLPLDLRHVAKSASNEKVAEALTSVGLG  147
             +G+  +++  K   +FQE  L PW  +++N+   L L+        +KV E +  V L 
Sbjct  65   IDGEPILKTSKKQGFIFQEHRLFPWLTVEENIAADLSLKD---KYVKDKVREWVEIVRLD  121

Query  148  KFGASFPKELSGGMQMRASLARALVTEPDLLLMDEPFGALDEFTRHRLDSDIRTLWSERD  207
             F  S+PKE+SGGM  R ++ARAL+ +P++LL+DEPFGALD FTR  L   +  +W ++ 
Sbjct  122  GFEKSYPKEISGGMSQRVAIARALLRDPNVLLLDEPFGALDAFTRSHLQEVLLNIWEQKK  181

Query  208  LTVVFVTHSIYEAVFLSSRVIVMGARPGRV  237
             T++FVTH I EA++LS+R+I+M A+PG++
Sbjct  182  TTMIFVTHDIDEAIYLSNRIIIMSAKPGKI  211


> Q1M7R4 Taurine import ATP-binding protein TauB [Rhizobium leguminosarum 
bv. viciae (strain 3841)]
Length=262

 Score =  174 bits (441),  Expect = 2e-55
 Identities = 91/207 (44%), Positives = 122/207 (59%), Gaps = 0/207 (0%)

Query  38   YPNGTHALQRFDLDIQRGEIISLLGPSGCGKSTLLKMFADLEQPSAGQVRWNGKTDMQSQ  97
            Y    HAL R   DI     +  LG SGCGKSTLL   A     S G++  +G+   Q  
Sbjct  15   YGRTVHALDRVSFDIPERGFVVALGASGCGKSTLLNAIAGFLPLSDGRITLDGRAVEQPG  74

Query  98   CKMAMVFQEATLMPWANIQDNVRLPLDLRHVAKSASNEKVAEALTSVGLGKFGASFPKEL  157
                +VFQ+ +L+PW ++ DNV L L    V +     +  E L  VGL +F  +FP EL
Sbjct  75   ADRGVVFQKDSLLPWKSVIDNVALGLKFAGVKRRERQARALELLRLVGLDEFAGAFPYEL  134

Query  158  SGGMQMRASLARALVTEPDLLLMDEPFGALDEFTRHRLDSDIRTLWSERDLTVVFVTHSI  217
            SGGM+ R  +ARAL T PD+LLMDEPFGALD  TR ++   + ++W +    V F+THSI
Sbjct  135  SGGMRQRVGIARALATNPDILLMDEPFGALDSLTREQMQELLVSIWDKTAKKVFFITHSI  194

Query  218  YEAVFLSSRVIVMGARPGRVVADISIE  244
             EA+FL ++V+VM  RPGRVVA   ++
Sbjct  195  EEALFLGTQVLVMSPRPGRVVARFDLD  221


> Q736E0 Aliphatic sulfonates import ATP-binding protein SsuB [Bacillus 
cereus (strain ATCC 10987 / NRS 248)]
Length=251

 Score =  173 bits (438),  Expect = 4e-55
 Identities = 88/234 (38%), Positives = 142/234 (61%), Gaps = 9/234 (4%)

Query  31   VRGVEKIYPNGTHALQ---RFDLDIQRGEIISLLGPSGCGKSTLLKMFADLEQPSAGQVR  87
            + GV K +   T  +Q     +  +++G+ ++++GPSGCGKSTLLK+ A L+    G++ 
Sbjct  5    IDGVSKYFSKQTRTVQVLENINFQLEKGDFVTVIGPSGCGKSTLLKIIAGLDGEFEGEII  64

Query  88   WNGKTDMQSQCKMAMVFQEATLMPWANIQDNVRLPLDLRHVAKSASNEKVAEALTSVGLG  147
             +G+   +   K   +FQE  L PW  +++N+   L L+        +KV E +  V L 
Sbjct  65   IDGERITKPSKKQGFIFQEHRLFPWLTVEENIAADLSLKD---KYVKDKVKEWVEIVRLD  121

Query  148  KFGASFPKELSGGMQMRASLARALVTEPDLLLMDEPFGALDEFTRHRLDSDIRTLWSERD  207
             F  S+PKE+SGGM  R ++ARAL+ +P++LL+DEPFGALD FTR  L   +  +W ++ 
Sbjct  122  GFEKSYPKEISGGMSQRVAIARALLRDPNVLLLDEPFGALDAFTRSHLQEVLLNIWEQKK  181

Query  208  LTVVFVTHSIYEAVFLSSRVIVMGARPGRVVADISIEGPEYRDEHFRTSDIFMK  261
             T++FVTH I EA++LS+R+++M A+PG++   I    P  R    +TS+ F +
Sbjct  182  TTMIFVTHDIDEAIYLSNRIVIMSAKPGKIHKVIENNLPYPRS---KTSESFQE  232


> Q2YJB5 Putative ATP-binding protein BAB2_1147 [Brucella abortus 
(strain 2308)]
Length=260

 Score =  173 bits (438),  Expect = 5e-55
 Identities = 92/219 (42%), Positives = 129/219 (59%), Gaps = 0/219 (0%)

Query  41   GTHALQRFDLDIQRGEIISLLGPSGCGKSTLLKMFADLEQPSAGQVRWNGKTDMQSQCKM  100
            G  AL R +LDI  GE ++++GPSGCGKST + + A L QPS G++    K       + 
Sbjct  16   GFLALDRLNLDIADGEFVTVVGPSGCGKSTAMNIAAGLLQPSGGEILVGDKPVTGPGPER  75

Query  101  AMVFQEATLMPWANIQDNVRLPLDLRHVAKSASNEKVAEALTSVGLGKFGASFPKELSGG  160
             ++FQ+  L PW  ++ NV   L +  +++    E     L+ VGL  F  + PK LSGG
Sbjct  76   GVIFQQYALFPWLTVRQNVEFGLSVAGMSRVKRREISDHYLSLVGLTDFADALPKALSGG  135

Query  161  MQMRASLARALVTEPDLLLMDEPFGALDEFTRHRLDSDIRTLWSERDLTVVFVTHSIYEA  220
            M+ R ++ARA    P++LLMDEPFGALD  TR  +   +   WS    TV+F+TH + EA
Sbjct  136  MKQRCAIARAYAAAPEILLMDEPFGALDALTRVHMQDQLLDAWSRERRTVMFITHDVDEA  195

Query  221  VFLSSRVIVMGARPGRVVADISIEGPEYRDEHFRTSDIF  259
            V+L++RVIVM ARPGR+   I ++ P  R E  R S  F
Sbjct  196  VYLANRVIVMAARPGRLDQIIPVDLPYPRTEAIRLSPEF  234


> Q8FUN3 Putative ATP-binding protein BRA1187/BS1330_II1178 [Brucella 
suis biovar 1 (strain 1330)]
Length=260

 Score =  173 bits (438),  Expect = 5e-55
 Identities = 92/219 (42%), Positives = 129/219 (59%), Gaps = 0/219 (0%)

Query  41   GTHALQRFDLDIQRGEIISLLGPSGCGKSTLLKMFADLEQPSAGQVRWNGKTDMQSQCKM  100
            G  AL R +LDI  GE ++++GPSGCGKST + + A L QPS G++    K       + 
Sbjct  16   GFLALDRLNLDIADGEFVTVVGPSGCGKSTAMNIAAGLLQPSGGEILVGDKPVTGPGPER  75

Query  101  AMVFQEATLMPWANIQDNVRLPLDLRHVAKSASNEKVAEALTSVGLGKFGASFPKELSGG  160
             ++FQ+  L PW  ++ NV   L +  +++    E     L+ VGL  F  + PK LSGG
Sbjct  76   GVIFQQYALFPWLTVRQNVEFGLSVAGMSRVKRREISDHYLSLVGLTDFADALPKALSGG  135

Query  161  MQMRASLARALVTEPDLLLMDEPFGALDEFTRHRLDSDIRTLWSERDLTVVFVTHSIYEA  220
            M+ R ++ARA    P++LLMDEPFGALD  TR  +   +   WS    TV+F+TH + EA
Sbjct  136  MKQRCAIARAYAAAPEILLMDEPFGALDALTRVHMQDQLLDAWSRERRTVMFITHDVDEA  195

Query  221  VFLSSRVIVMGARPGRVVADISIEGPEYRDEHFRTSDIF  259
            V+L++RVIVM ARPGR+   I ++ P  R E  R S  F
Sbjct  196  VYLANRVIVMAARPGRLDQIIPVDLPYPRTEAIRLSPEF  234


> A0RFA4 Aliphatic sulfonates import ATP-binding protein SsuB [Bacillus 
thuringiensis (strain Al Hakam)]
Length=251

 Score =  172 bits (435),  Expect = 1e-54
 Identities = 87/236 (37%), Positives = 142/236 (60%), Gaps = 9/236 (4%)

Query  29   LMVRGVEKIYPNGT---HALQRFDLDIQRGEIISLLGPSGCGKSTLLKMFADLEQPSAGQ  85
            +++  V K +   T     L+  +  +++G+ ++++GPSGCGKSTLLK+ A L+    G+
Sbjct  3    VLINEVSKYFSKQTGTVQVLENINFQLEKGDFVTVIGPSGCGKSTLLKIVAGLDNDFEGE  62

Query  86   VRWNGKTDMQSQCKMAMVFQEATLMPWANIQDNVRLPLDLRHVAKSASNEKVAEALTSVG  145
            +  +G+   +   K   +FQE  L PW  +++N+   L L+        +KV E +  V 
Sbjct  63   IIIDGERITKPSKKQGFIFQEHRLFPWLTVEENIAADLSLKD---KYVKDKVKEWVEIVR  119

Query  146  LGKFGASFPKELSGGMQMRASLARALVTEPDLLLMDEPFGALDEFTRHRLDSDIRTLWSE  205
            L  F  S+PKE+SGGM  R ++ARAL+ +P +LL+DEPFGALD FTR  L   +  +W +
Sbjct  120  LDGFEKSYPKEISGGMSQRVAIARALLRDPSVLLLDEPFGALDAFTRSHLQEVLLNIWEQ  179

Query  206  RDLTVVFVTHSIYEAVFLSSRVIVMGARPGRVVADISIEGPEYRDEHFRTSDIFMK  261
            +  T++FVTH I EA++LS+R+++M A+PG++   I    P  R    +TS+ F +
Sbjct  180  KKTTMIFVTHDIDEAIYLSNRIVIMSAKPGKIHKVIENNLPYPRS---KTSESFQE  232


> Q63A38 Aliphatic sulfonates import ATP-binding protein SsuB [Bacillus 
cereus (strain ZK / E33L)]
Length=251

 Score =  171 bits (433),  Expect = 2e-54
 Identities = 78/193 (40%), Positives = 127/193 (66%), Gaps = 3/193 (2%)

Query  45   LQRFDLDIQRGEIISLLGPSGCGKSTLLKMFADLEQPSAGQVRWNGKTDMQSQCKMAMVF  104
            L+  +  +++G+ ++++GPSGCGKSTLLK+ A L+    G++  +G+   +   K   +F
Sbjct  22   LENINFQLEKGDFVTVIGPSGCGKSTLLKIIAGLDNDFEGEIIIDGERITKPSKKQGFIF  81

Query  105  QEATLMPWANIQDNVRLPLDLRHVAKSASNEKVAEALTSVGLGKFGASFPKELSGGMQMR  164
            QE  L PW  +++N+   L L+        +KV E +  V L  F  S+PKE+SGGM  R
Sbjct  82   QEHRLFPWLTVEENIAADLSLKD---KYVKDKVKEWVEIVRLDGFEKSYPKEISGGMSQR  138

Query  165  ASLARALVTEPDLLLMDEPFGALDEFTRHRLDSDIRTLWSERDLTVVFVTHSIYEAVFLS  224
             ++ARAL+ +P++LL+DEPFGALD FTR  L   +  +W ++  T++FVTH I EA++LS
Sbjct  139  VAIARALLRDPNVLLLDEPFGALDAFTRSHLQEVLLNIWEQKKTTMIFVTHDIDEAIYLS  198

Query  225  SRVIVMGARPGRV  237
            +R+++M A+PG++
Sbjct  199  NRIVIMSAKPGKI  211


> Q2K164 Taurine import ATP-binding protein TauB [Rhizobium etli 
(strain CFN 42 / ATCC 51251)]
Length=262

 Score =  171 bits (432),  Expect = 4e-54
 Identities = 89/202 (44%), Positives = 120/202 (59%), Gaps = 0/202 (0%)

Query  43   HALQRFDLDIQRGEIISLLGPSGCGKSTLLKMFADLEQPSAGQVRWNGKTDMQSQCKMAM  102
            HAL R   DI     +  LG SGCGKSTLL   A     S G++  +G+   +      +
Sbjct  20   HALDRVSFDIPERGFVVALGASGCGKSTLLNAIAGFLPLSDGRITLDGRAVERPGADRGV  79

Query  103  VFQEATLMPWANIQDNVRLPLDLRHVAKSASNEKVAEALTSVGLGKFGASFPKELSGGMQ  162
            VFQ+  L+PW ++ DNV L L    V +     +  E L  VGL +F  +FP ELSGGM+
Sbjct  80   VFQKDALLPWKSVADNVALGLKFAGVNRKERQTRALELLRLVGLDEFANAFPYELSGGMR  139

Query  163  MRASLARALVTEPDLLLMDEPFGALDEFTRHRLDSDIRTLWSERDLTVVFVTHSIYEAVF  222
             R  +ARAL T PD+LLMDEPFGALD  TR ++   + ++W +    V F+THSI EA+F
Sbjct  140  QRVGIARALATNPDILLMDEPFGALDSLTREQMQELLVSVWDKTAKKVFFITHSIEEALF  199

Query  223  LSSRVIVMGARPGRVVADISIE  244
            L ++V+VM  RPGRVVA   ++
Sbjct  200  LGTQVLVMSPRPGRVVARFDLD  221


> Q16BJ3 Taurine import ATP-binding protein TauB [Roseobacter denitrificans 
(strain ATCC 33942 / OCh 114)]
Length=268

 Score =  171 bits (432),  Expect = 4e-54
 Identities = 87/201 (43%), Positives = 122/201 (61%), Gaps = 2/201 (1%)

Query  39   PNGTH--ALQRFDLDIQRGEIISLLGPSGCGKSTLLKMFADLEQPSAGQVRWNGKTDMQS  96
            PNG H  ALQ   LD++ GE++S+LGPSGCGK+TLL + A    P++G++  NG      
Sbjct  16   PNGDHVQALQDVSLDLKAGELLSVLGPSGCGKTTLLNIVAGFLAPTSGELILNGHRITGP  75

Query  97   QCKMAMVFQEATLMPWANIQDNVRLPLDLRHVAKSASNEKVAEALTSVGLGKFGASFPKE  156
              +  MVFQ+  L  W ++++NV     ++   K   ++ V   L  VGL  F      E
Sbjct  76   DAERGMVFQQGALFEWMSVRENVAFGPSMKGTPKVDKDKTVDHLLDVVGLQDFKEKAVYE  135

Query  157  LSGGMQMRASLARALVTEPDLLLMDEPFGALDEFTRHRLDSDIRTLWSERDLTVVFVTHS  216
            LSGGMQ R +LAR L  +PD++LMDEP GALD  TR ++ S +  LW E   T++ +THS
Sbjct  136  LSGGMQQRVALARCLANDPDVILMDEPLGALDALTREKMQSLVLKLWKETGKTIILITHS  195

Query  217  IYEAVFLSSRVIVMGARPGRV  237
            + EA+ L  R+IVM  RPGR+
Sbjct  196  VEEALLLGERLIVMAPRPGRI  216


> Q6RH47 Taurine import ATP-binding protein TauB [Paracoccus pantotrophus]
Length=269

 Score =  160 bits (404),  Expect = 6e-50
 Identities = 89/215 (41%), Positives = 120/215 (56%), Gaps = 7/215 (3%)

Query  29   LMVRGVEKIYPNGTH------ALQRFDLDIQRGEIISLLGPSGCGKSTLLKMFADLEQPS  82
            L V  V  IYP G H      AL+  +L+++ G+ +  LG SGCGK+TLL + A    PS
Sbjct  4    LKVSDVSLIYP-GHHKGAPVTALKGVNLEVKSGDFVVALGASGCGKTTLLNLMAGFMAPS  62

Query  83   AGQVRWNGKTDMQSQCKMAMVFQEATLMPWANIQDNVRLPLDLRHVAKSASNEKVAEALT  142
            AGQ+    +       +  +VFQ+  L+PW N+ DNV   L L+ V      E+  + L 
Sbjct  63   AGQITLGDRPVAGPGAERGVVFQKHALLPWLNVIDNVEFGLKLQGVDARTRRERAVKNLA  122

Query  143  SVGLGKFGASFPKELSGGMQMRASLARALVTEPDLLLMDEPFGALDEFTRHRLDSDIRTL  202
             VGL  F       LSGGMQ R  +ARAL  +P +LLMDEP  ALD  TR  +   +  +
Sbjct  123  LVGLQDFHKHMIYHLSGGMQQRVGIARALTCDPAMLLMDEPMAALDALTRETVQELLLQI  182

Query  203  WSERDLTVVFVTHSIYEAVFLSSRVIVMGARPGRV  237
            W + D    F+THS+ EA+FL SR+IVM  RPGR+
Sbjct  183  WQQTDKMYFFITHSVEEALFLGSRLIVMSPRPGRI  217


 Score = 17.7 bits (34),  Expect = 6.3
 Identities = 7/15 (47%), Positives = 10/15 (67%), Gaps = 0/15 (0%)

Query  168  ARALVTEPDLLLMDE  182
            ARA+ + PD + M E
Sbjct  235  ARAIKSSPDFIEMRE  249


> P97027 Aliphatic sulfonates import ATP-binding protein SsuB [Bacillus 
subtilis (strain 168)]
Length=255

 Score =  159 bits (402),  Expect = 8e-50
 Identities = 78/193 (40%), Positives = 120/193 (62%), Gaps = 3/193 (2%)

Query  45   LQRFDLDIQRGEIISLLGPSGCGKSTLLKMFADLEQPSAGQVRWNGKTDMQSQCKMAMVF  104
            L+  +L I  GE ++L+GPSGCGKSTLLK+ A L+    G V  NG++      +   +F
Sbjct  22   LENIELSIAPGEFLTLIGPSGCGKSTLLKIIAGLDSEYDGSVEINGRSVTAPGIQQGFIF  81

Query  105  QEATLMPWANIQDNVRLPLDLRHVAKSASNEKVAEALTSVGLGKFGASFPKELSGGMQMR  164
            QE  L PW  ++ N+   L+L+        +KV E +  V L     ++P+ELSGGM  R
Sbjct  82   QEHRLFPWLTVEQNIAADLNLKD---PKVKQKVDELIEIVRLKGSEKAYPRELSGGMSQR  138

Query  165  ASLARALVTEPDLLLMDEPFGALDEFTRHRLDSDIRTLWSERDLTVVFVTHSIYEAVFLS  224
             ++ARAL+ EP++LL+DEPFGALD FTR  L   +  +W ++  T++ VTH I E+V+L 
Sbjct  139  VAIARALLREPEVLLLDEPFGALDAFTRKHLQDVLLDIWRKKKTTMILVTHDIDESVYLG  198

Query  225  SRVIVMGARPGRV  237
            + + ++ A+PG++
Sbjct  199  NELAILKAKPGKI  211


> Q55108 Bicarbonate transport ATP-binding protein CmpD [Synechococcus 
elongatus (strain PCC 7942 / FACHB-805)]
Length=278

 Score =  157 bits (396),  Expect = 1e-48
 Identities = 94/260 (36%), Positives = 137/260 (53%), Gaps = 18/260 (7%)

Query  27   PMLMVRGVEKIY--PNGTHA-LQRFDLDIQRGEIISLLGPSGCGKSTLLKMFADLEQPSA  83
            P L+V  V KIY  P G +  L   +L +Q GE I ++G SGCGKSTLL M +   QPS 
Sbjct  19   PFLIVENVSKIYETPKGPYTVLDGVNLTVQEGEFICVIGHSGCGKSTLLNMVSGFNQPSH  78

Query  84   GQVRWNGKTDMQSQCKMAMVFQEATLMPWANIQDNVRLPLDLRH--VAKSASNEKVAEAL  141
            G VR  GK   +      +VFQ   L+PW    +NV L +D  +  + +    E V E L
Sbjct  79   GSVRLKGKEIDRPGPDRMVVFQNYALLPWMTAYENVYLAVDCVNPQMREGEKREIVREHL  138

Query  142  TSVGLGKFGASFPKELSGGMQMRASLARALVTEPDLLLMDEPFGALDEFTRHRLDSDIRT  201
              VGL +       ++SGGM+ R ++ARAL   P++L++DEPFGALD  T+  L  ++  
Sbjct  139  AMVGLTEAAEKKITQISGGMKQRVAIARALSIRPEVLILDEPFGALDAITKEELQEELLK  198

Query  202  LWSERDLTVVFVTHSIYEAVFLSSRVIVMGARPGRVVADIS-------------IEGPEY  248
            +W++   TV+ +TH I EA+FL+ R+++M   P   + +I              +E P+Y
Sbjct  199  IWNDHRCTVLMITHDIDEALFLADRLVMMTNGPAANIGEIMTIPFPRPRDRERIMEDPQY  258

Query  249  RDEHFRTSDIFMKQCAHLSE  268
             D      D    + AH  E
Sbjct  259  YDLRNYALDFLYNRFAHDDE  278


> Q55107 Bicarbonate transport ATP-binding protein CmpC [Synechococcus 
elongatus (strain PCC 7942 / FACHB-805)]
Length=663

 Score =  161 bits (408),  Expect = 3e-48
 Identities = 92/223 (41%), Positives = 127/223 (57%), Gaps = 6/223 (3%)

Query  25   VSPMLMVRGVEKIYP----NGTHALQRFDLDIQRGEIISLLGPSGCGKSTLLKMFADLEQ  80
            +S  + V  +EK +P    N   AL+  DL+I++GE ISL+G SGCGKSTLL + A LE 
Sbjct  1    MSLFVAVENIEKSFPLSGGNEYLALKGIDLEIKQGEFISLIGHSGCGKSTLLNLIAGLEL  60

Query  81   PSAGQVRWNGKTDMQSQCKMAMVFQEATLMPWANIQDNVRLPLD--LRHVAKSASNEKVA  138
            P+ G V   G+          +VFQ  +L PW  +++N+ L +D  LR + K      V 
Sbjct  61   PTDGAVSLEGQQITAPGPDRMVVFQNYSLFPWLTVRENIALAVDEVLRDLPKEERQAIVE  120

Query  139  EALTSVGLGKFGASFPKELSGGMQMRASLARALVTEPDLLLMDEPFGALDEFTRHRLDSD  198
            E +  VGLG      P +LSGGM+ R ++AR L T P LLL+DEPFGALD  TR  L   
Sbjct  121  EHIQLVGLGHAADKPPAQLSGGMKQRVAIARGLATRPKLLLLDEPFGALDALTRGNLQEK  180

Query  199  IRTLWSERDLTVVFVTHSIYEAVFLSSRVIVMGARPGRVVADI  241
            +  +  E  +T V VTH + EAV LS R++++   PG  +  I
Sbjct  181  LMQICEENHVTAVMVTHDVDEAVLLSDRIVMLTNGPGSKIGGI  223


> Q6W2B1 Taurine import ATP-binding protein TauB [Sinorhizobium 
fredii (strain NBRC 101917 / NGR234)]
Length=267

 Score =  153 bits (387),  Expect = 2e-47
 Identities = 80/197 (41%), Positives = 117/197 (59%), Gaps = 0/197 (0%)

Query  45   LQRFDLDIQRGEIISLLGPSGCGKSTLLKMFADLEQPSAGQVRWNGKTDMQSQCKMAMVF  104
            L R +L +  GE + ++G SG GK++LL + A  ++PS G+V  +GK         A+VF
Sbjct  26   LDRINLSVSTGEFVVVIGRSGSGKTSLLNLAAGFQEPSEGKVALDGKIIEGPGSDRAVVF  85

Query  105  QEATLMPWANIQDNVRLPLDLRHVAKSASNEKVAEALTSVGLGKFGASFPKELSGGMQMR  164
            Q+  L PW + +DNV  PL ++ + +     +  E L  VGL + G     ELSGGM+ R
Sbjct  86   QDDALYPWLDARDNVAFPLRIKGMGERDRRARAGELLELVGLPEAGKRRIWELSGGMRQR  145

Query  165  ASLARALVTEPDLLLMDEPFGALDEFTRHRLDSDIRTLWSERDLTVVFVTHSIYEAVFLS  224
              +ARAL  EP  LL+DEP GALD  TR RL + +  +W +     + +THSI EA+ L+
Sbjct  146  VGIARALAAEPRFLLLDEPLGALDALTRSRLQTFLLDVWRKSRSGALLITHSIDEALLLA  205

Query  225  SRVIVMGARPGRVVADI  241
            +R++V+   PGRV ADI
Sbjct  206  TRIVVLSPNPGRVAADI  222


> Q47538 Taurine import ATP-binding protein TauB [Escherichia coli 
(strain K12)]
Length=255

 Score =  152 bits (385),  Expect = 3e-47
 Identities = 79/198 (40%), Positives = 116/198 (59%), Gaps = 0/198 (0%)

Query  41   GTHALQRFDLDIQRGEIISLLGPSGCGKSTLLKMFADLEQPSAGQVRWNGKTDMQSQCKM  100
            G  AL+  +L ++ GE++ +LGPSGCGK+TLL + A       G ++  GK       + 
Sbjct  13   GKPALEDINLTLESGELLVVLGPSGCGKTTLLNLIAGFVPYQHGSIQLAGKRIEGPGAER  72

Query  101  AMVFQEATLMPWANIQDNVRLPLDLRHVAKSASNEKVAEALTSVGLGKFGASFPKELSGG  160
             +VFQ   L+PW N+QDNV   L L  + K    E   + L  VGL      +  +LSGG
Sbjct  73   GVVFQNEGLLPWRNVQDNVAFGLQLAGIEKMQRLEIAHQMLKKVGLEGAEKRYIWQLSGG  132

Query  161  MQMRASLARALVTEPDLLLMDEPFGALDEFTRHRLDSDIRTLWSERDLTVVFVTHSIYEA  220
             + R  +ARAL   P LLL+DEPFGALD FTR ++ + +  LW E    V+ +TH I EA
Sbjct  133  QRQRVGIARALAANPQLLLLDEPFGALDAFTRDQMQTLLLKLWQETGKQVLLITHDIEEA  192

Query  221  VFLSSRVIVMGARPGRVV  238
            VF+++ ++++ + PGRV+
Sbjct  193  VFMATELVLLSSGPGRVL  210


> P38046 Nitrate import ATP-binding protein NrtD [Synechococcus 
elongatus (strain PCC 7942 / FACHB-805)]
Length=274

 Score =  152 bits (384),  Expect = 6e-47
 Identities = 83/243 (34%), Positives = 133/243 (55%), Gaps = 16/243 (7%)

Query  39   PNGTH-ALQRFDLDIQRGEIISLLGPSGCGKSTLLKMFADLEQPSAGQVRWNGKTDMQSQ  97
            P G + A++  +L +Q+GE I ++G SGCGKSTLL + +   QP++G V  +G+   +  
Sbjct  29   PRGPYVAIEDVNLSVQQGEFICVIGHSGCGKSTLLNLVSGFSQPTSGGVYLDGQPIQEPG  88

Query  98   CKMAMVFQEATLMPWANIQDNVRLPLDLR--HVAKSASNEKVAEALTSVGLGKFGASFPK  155
                +VFQ  +L+PW + +DN+ L +     H++ S   + V   L  VGL +     P 
Sbjct  89   PDRMVVFQNYSLLPWKSARDNIALAVKAARPHLSTSEQRQVVDHHLELVGLTEAQHKRPD  148

Query  156  ELSGGMQMRASLARALVTEPDLLLMDEPFGALDEFTRHRLDSDIRTLWSERDLTVVFVTH  215
            +LSGGM+ R ++ARAL   P++L++DEPFGALD  T+  L  ++  +W E   TV+ +TH
Sbjct  149  QLSGGMKQRVAIARALSIRPEVLILDEPFGALDAITKEELQEELLNIWEEARPTVLMITH  208

Query  216  SIYEAVFLSSRVIVMGARPGRVVADI-------------SIEGPEYRDEHFRTSDIFMKQ  262
             I EA+FL+ RV++M   P   + ++              +E P Y        D   ++
Sbjct  209  DIDEALFLADRVVMMTNGPAATIGEVLEIPFDRPREREAVVEDPRYAQLRTEALDFLYRR  268

Query  263  CAH  265
             AH
Sbjct  269  FAH  271


> Q55462 Bicarbonate transport ATP-binding protein CmpC [Synechocystis 
sp. (strain PCC 6803 / Kazusa)]
Length=667

 Score =  155 bits (391),  Expect = 7e-46
 Identities = 88/213 (41%), Positives = 123/213 (58%), Gaps = 5/213 (2%)

Query  44   ALQRFDLDIQRGEIISLLGPSGCGKSTLLKMFADLEQPSAGQVRWNGKTDMQSQCKMAMV  103
            AL+  +L+I++GE +SL+G SGCGKSTLL M A L+ PS G V   G+   Q      ++
Sbjct  24   ALKGINLEIKKGEFVSLIGHSGCGKSTLLNMIAGLDLPSEGIVTLEGQRIKQPGPDKMVI  83

Query  104  FQEATLMPWANIQDNVRLPLDLRHVAKSASNEK--VAEALTSVGLGKFGASFPKELSGGM  161
            FQ  +L+PW  ++ N+ L +D      SA+  K  V E +  VGLG      P ELSGGM
Sbjct  84   FQNYSLLPWLTVKQNIALAVDEVMKGASAAERKAIVEEHINLVGLGHAVDKRPGELSGGM  143

Query  162  QMRASLARALVTEPDLLLMDEPFGALDEFTRHRLDSDIRTLWSERDLTVVFVTHSIYEAV  221
            + R ++ARAL   P LLL+DEPFGALD  TR  L   +  +  +  +T V VTH + EAV
Sbjct  144  KQRVAIARALAIRPKLLLLDEPFGALDALTRGNLQEQLMRICEQYQVTAVMVTHDVDEAV  203

Query  222  FLSSRVIVMGARPGRVVA---DISIEGPEYRDE  251
             LS R++++   PG  +    ++ I  P  R E
Sbjct  204  LLSDRIVMLTNGPGSNIGGILEVDIPRPRKRME  236


> Q55463 Bicarbonate transport ATP-binding protein CmpD [Synechocystis 
sp. (strain PCC 6803 / Kazusa)]
Length=282

 Score =  148 bits (374),  Expect = 2e-45
 Identities = 78/218 (36%), Positives = 122/218 (56%), Gaps = 5/218 (2%)

Query  29   LMVRGVEKIYPNGTH---ALQRFDLDIQRGEIISLLGPSGCGKSTLLKMFADLEQPSAGQ  85
            L +  V K+YP        L+  +L +  GE I ++G SGCGKSTLL M +    P+ G 
Sbjct  24   LTIENVSKVYPTAKGPYTVLENVNLTVNEGEFICVIGHSGCGKSTLLNMVSGFASPTDGS  83

Query  86   VRWNGKTDMQSQCKMAMVFQEATLMPWANIQDNVRLPLDLRHVAKSASNEKVA--EALTS  143
            V+  GK   +      +VFQ   L+PW    +NV + +D  H  K+ + ++    + L  
Sbjct  84   VQVGGKIITEPGPDRMVVFQNYALLPWLTALENVYIAVDAVHSQKTEAEKRAIAKDHLAM  143

Query  144  VGLGKFGASFPKELSGGMQMRASLARALVTEPDLLLMDEPFGALDEFTRHRLDSDIRTLW  203
            VGL       P ++SGGM+ R S+ARAL   P++L++DEPFGALD  T+  L  ++  +W
Sbjct  144  VGLTDSMDKKPGQISGGMKQRVSIARALAIRPEVLILDEPFGALDAITKEELQEELLQIW  203

Query  204  SERDLTVVFVTHSIYEAVFLSSRVIVMGARPGRVVADI  241
            ++   TV+ +TH I EA+FL+ R+++M   P   + +I
Sbjct  204  NDHRCTVLMITHDIDEALFLADRLVMMTNGPHANIGEI  241


> O34992 Glycine betaine/carnitine/choline transport ATP-binding 
protein OpuCA [Bacillus subtilis (strain 168)]
Length=380

 Score =  150 bits (380),  Expect = 2e-45
 Identities = 84/211 (40%), Positives = 121/211 (57%), Gaps = 6/211 (3%)

Query  28   MLMVRGVEKIYPNGTHALQRFDLDIQRGEIISLLGPSGCGKSTLLKMFADLEQPSAGQVR  87
            ML +  V K+Y  G  A+   DLDI +GE I  +GPSGCGK+T +KM   L +PS+G++ 
Sbjct  1    MLKLEQVSKVYKGGKKAVNSIDLDIAKGEFICFIGPSGCGKTTTMKMINRLIEPSSGRIF  60

Query  88   WNGKTDMQS-----QCKMAMVFQEATLMPWANIQDNVRLPLDLRHVAKSASNEKVAEALT  142
             +G+  M+      + K+  V Q+  L P   IQ N+ L   L    +    E+  E L 
Sbjct  61   IDGENIMEQDPVELRRKIGYVIQQIGLFPHMTIQQNISLVPKLLKWPEEKRKERARELLK  120

Query  143  SVGLG-KFGASFPKELSGGMQMRASLARALVTEPDLLLMDEPFGALDEFTRHRLDSDIRT  201
             V +G ++   +P ELSGG Q R  + RAL  EP L+LMDEPFGALD  TR  L  + + 
Sbjct  121  LVDMGPEYLDRYPHELSGGQQQRIGVLRALAAEPPLILMDEPFGALDPITRDSLQEEFKK  180

Query  202  LWSERDLTVVFVTHSIYEAVFLSSRVIVMGA  232
            L    + T+VFVTH + EA+ L+ R++++ A
Sbjct  181  LQRTLNKTIVFVTHDMDEAIKLADRIVILKA  211



Lambda      K        H        a         alpha
   0.321    0.135    0.395    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1273194


  Database: 86cad29ce5198d1ef75d651e309535be.SwissProt.fasta
    Posted date:  Sep 26, 2020  7:02 PM
  Number of letters in database: 6,428
  Number of sequences in database:  21



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40