ACIAD1368 / TrEMBL Alignments

BLASTP 2.2.28+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: ed09eb68441ed5288bf3ed2bfc655f5f.TrEMBL.fasta
           25 sequences; 12,210 total letters



Query= ACIAD1368

Length=492
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  Q6FCH6 DNA-binding transcriptional regulator NtrC [Acinetobacte...   979    0.0   
  A0A1P8EHY8 DNA-binding transcriptional regulator NtrC [Acinetob...   951    0.0   
  N9BTL2 DNA-binding transcriptional regulator NtrC [Acinetobacte...   951    0.0   
  A0A0M1I0W2 DNA-binding transcriptional regulator NtrC [Acinetob...   949    0.0   
  N9D8U1 DNA-binding transcriptional regulator NtrC [Acinetobacte...   931    0.0   
  N9S075 DNA-binding transcriptional regulator NtrC [Acinetobacte...   931    0.0   
  A0A2T5QH79 DNA-binding transcriptional regulator NtrC [Acinetob...   917    0.0   
  R9AUE6 DNA-binding transcriptional regulator NtrC [Acinetobacte...   917    0.0   
  A0A255U9S5 DNA-binding transcriptional regulator NtrC [Acinetob...   916    0.0   
  A0A1A0GJV8 DNA-binding transcriptional regulator NtrC [Acinetob...   916    0.0   
  A0A1H8T6Y6 DNA-binding transcriptional regulator NtrC [Acinetob...   916    0.0   
  A0A127KF30 DNA-binding transcriptional regulator NtrC [Acinetob...   916    0.0   
  A0A022KRC7 DNA-binding transcriptional regulator NtrC [Acinetob...   916    0.0   
  A0A1V0KAC1 DNA-binding transcriptional regulator NtrC [Acinetob...   916    0.0   
  R8YMR8 DNA-binding transcriptional regulator NtrC [Acinetobacte...   916    0.0   
  Q5EG41 DNA-binding transcriptional regulator NtrC [Pseudomonas ...   632    0.0   
  Q56291 DNA-binding transcriptional regulator NtrC [Acidithiobac...   536    0.0   
  O86057 DNA-binding transcriptional regulator NtrC [Herbaspirill...   520    0.0   
  Q44430 DNA-binding transcriptional regulator NtrC [Rhizobium ra...   390    3e-133
  Q43912 DNA-binding transcriptional regulator NtrC [Azospirillum...   389    7e-133
  Q6REE4 DNA-binding transcriptional regulator NtrC [Azospirillum...   386    2e-131
  Q43898 DNA-binding transcriptional regulator NtrC [Azospirillum...   385    2e-131
  Q6REE5 DNA-binding transcriptional regulator NtrC [Azospirillum...   385    2e-131
  Q53023 DNA-binding transcriptional regulator NtrC [Rhodospirill...   384    1e-130
  O31412 DNA-binding transcriptional regulator NtrC [Brucella suis]    345    7e-116


> Q6FCH6 DNA-binding transcriptional regulator NtrC [Acinetobacter 
baylyi (strain ATCC 33305 / BD413 / ADP1)]
Length=491

 Score =  979 bits (2530),  Expect = 0.0
 Identities = 491/491 (100%), Positives = 491/491 (100%), Gaps = 0/491 (0%)

Query  1    MSRNKIWVIDDDRAMRWVLEKTFKEEGFDVTSFEEAQSALDQLLDDAPDVILTDIRMPGI  60
            MSRNKIWVIDDDRAMRWVLEKTFKEEGFDVTSFEEAQSALDQLLDDAPDVILTDIRMPGI
Sbjct  1    MSRNKIWVIDDDRAMRWVLEKTFKEEGFDVTSFEEAQSALDQLLDDAPDVILTDIRMPGI  60

Query  61   DGLTFLGKVKNNYPDLPVIIMTAHSDLESAVSSYQTGAFEYLPKPFDIDEALALVNRAIL  120
            DGLTFLGKVKNNYPDLPVIIMTAHSDLESAVSSYQTGAFEYLPKPFDIDEALALVNRAIL
Sbjct  61   DGLTFLGKVKNNYPDLPVIIMTAHSDLESAVSSYQTGAFEYLPKPFDIDEALALVNRAIL  120

Query  121  HINKLQQQEATKAASAAQSTEIIGESPAMQEVFRAIGRLSQSHITVLINGESGTGKELVA  180
            HINKLQQQEATKAASAAQSTEIIGESPAMQEVFRAIGRLSQSHITVLINGESGTGKELVA
Sbjct  121  HINKLQQQEATKAASAAQSTEIIGESPAMQEVFRAIGRLSQSHITVLINGESGTGKELVA  180

Query  181  HALHKHSPRSSKPFIALNMAAIPKDLIETELFGHEKGAFTGANTQRQGRFEQANGGTLFL  240
            HALHKHSPRSSKPFIALNMAAIPKDLIETELFGHEKGAFTGANTQRQGRFEQANGGTLFL
Sbjct  181  HALHKHSPRSSKPFIALNMAAIPKDLIETELFGHEKGAFTGANTQRQGRFEQANGGTLFL  240

Query  241  DEIGDMPFETQTRLLRVLADGEFYRVGGHIPVKVDVRIVAATHQDLEKLVNEGRFREDLY  300
            DEIGDMPFETQTRLLRVLADGEFYRVGGHIPVKVDVRIVAATHQDLEKLVNEGRFREDLY
Sbjct  241  DEIGDMPFETQTRLLRVLADGEFYRVGGHIPVKVDVRIVAATHQDLEKLVNEGRFREDLY  300

Query  301  HRLNVIRIHIPKLAHRSEDIPMLAQHFLARAGKELGVSPKILRTETTDYMQQLPWPGNVR  360
            HRLNVIRIHIPKLAHRSEDIPMLAQHFLARAGKELGVSPKILRTETTDYMQQLPWPGNVR
Sbjct  301  HRLNVIRIHIPKLAHRSEDIPMLAQHFLARAGKELGVSPKILRTETTDYMQQLPWPGNVR  360

Query  361  QLENTCRWLTVMITGREVYPEDLPSELKQIPIQKSVDQTGTPPSFDRISLHHWDELLGQW  420
            QLENTCRWLTVMITGREVYPEDLPSELKQIPIQKSVDQTGTPPSFDRISLHHWDELLGQW
Sbjct  361  QLENTCRWLTVMITGREVYPEDLPSELKQIPIQKSVDQTGTPPSFDRISLHHWDELLGQW  420

Query  421  AIQKLKNGEMKILDIATPMFERTLINAALQQTRGRKRHAAELLGWGRNTLTRKLKELGIS  480
            AIQKLKNGEMKILDIATPMFERTLINAALQQTRGRKRHAAELLGWGRNTLTRKLKELGIS
Sbjct  421  AIQKLKNGEMKILDIATPMFERTLINAALQQTRGRKRHAAELLGWGRNTLTRKLKELGIS  480

Query  481  AEDDTEEESEI  491
            AEDDTEEESEI
Sbjct  481  AEDDTEEESEI  491


> A0A1P8EHY8 DNA-binding transcriptional regulator NtrC [Acinetobacter 
soli]
Length=491

 Score =  951 bits (2457),  Expect = 0.0
 Identities = 477/491 (97%), Positives = 483/491 (98%), Gaps = 0/491 (0%)

Query  1    MSRNKIWVIDDDRAMRWVLEKTFKEEGFDVTSFEEAQSALDQLLDDAPDVILTDIRMPGI  60
            MSRNKIWVIDDDRAMRWVLEKTFKEEGFDVTSFEEAQ+ALDQLLDDAPDVILTDIRMPGI
Sbjct  1    MSRNKIWVIDDDRAMRWVLEKTFKEEGFDVTSFEEAQTALDQLLDDAPDVILTDIRMPGI  60

Query  61   DGLTFLGKVKNNYPDLPVIIMTAHSDLESAVSSYQTGAFEYLPKPFDIDEALALVNRAIL  120
            DGLTFLGKVKN+ PDLPVIIMTAHSDLESAVSSYQTGAFEYLPKPFDIDEALALVNRAIL
Sbjct  61   DGLTFLGKVKNSNPDLPVIIMTAHSDLESAVSSYQTGAFEYLPKPFDIDEALALVNRAIL  120

Query  121  HINKLQQQEATKAASAAQSTEIIGESPAMQEVFRAIGRLSQSHITVLINGESGTGKELVA  180
            HINKLQQQEA+K+AS AQSTEIIGESPAMQEVFRAIGRLSQSHITVLINGESGTGKELVA
Sbjct  121  HINKLQQQEASKSASVAQSTEIIGESPAMQEVFRAIGRLSQSHITVLINGESGTGKELVA  180

Query  181  HALHKHSPRSSKPFIALNMAAIPKDLIETELFGHEKGAFTGANTQRQGRFEQANGGTLFL  240
            HALHKHSPRSSKPFIALNMAAIPKDLIETELFGHEKGAFTGANTQRQGRFEQANGGTLFL
Sbjct  181  HALHKHSPRSSKPFIALNMAAIPKDLIETELFGHEKGAFTGANTQRQGRFEQANGGTLFL  240

Query  241  DEIGDMPFETQTRLLRVLADGEFYRVGGHIPVKVDVRIVAATHQDLEKLVNEGRFREDLY  300
            DEIGDMPFETQTRLLRVLADGEFYRVGGHIPVKVDVRIVAATHQDLEKLVNEGRFREDLY
Sbjct  241  DEIGDMPFETQTRLLRVLADGEFYRVGGHIPVKVDVRIVAATHQDLEKLVNEGRFREDLY  300

Query  301  HRLNVIRIHIPKLAHRSEDIPMLAQHFLARAGKELGVSPKILRTETTDYMQQLPWPGNVR  360
            HRLNVIRIHIPKLAHRSEDIPMLAQHFLARAGKELGVSPKILRTETTDYMQQLPWPGNVR
Sbjct  301  HRLNVIRIHIPKLAHRSEDIPMLAQHFLARAGKELGVSPKILRTETTDYMQQLPWPGNVR  360

Query  361  QLENTCRWLTVMITGREVYPEDLPSELKQIPIQKSVDQTGTPPSFDRISLHHWDELLGQW  420
            QLENTCRWLTVMITGREVYPEDLPSELKQIPIQKSVD     P+FDRISLHHWDELLGQW
Sbjct  361  QLENTCRWLTVMITGREVYPEDLPSELKQIPIQKSVDTNIATPNFDRISLHHWDELLGQW  420

Query  421  AIQKLKNGEMKILDIATPMFERTLINAALQQTRGRKRHAAELLGWGRNTLTRKLKELGIS  480
            AIQKLKNGEMKILDIATPMFERTLINAALQQTRGRKRHAAELLGWGRNTLTRKLKELGI+
Sbjct  421  AIQKLKNGEMKILDIATPMFERTLINAALQQTRGRKRHAAELLGWGRNTLTRKLKELGIA  480

Query  481  AEDDTEEESEI  491
            AEDD EEESEI
Sbjct  481  AEDDVEEESEI  491


> N9BTL2 DNA-binding transcriptional regulator NtrC [Acinetobacter 
soli NIPH 2899]
Length=491

 Score =  951 bits (2457),  Expect = 0.0
 Identities = 477/491 (97%), Positives = 483/491 (98%), Gaps = 0/491 (0%)

Query  1    MSRNKIWVIDDDRAMRWVLEKTFKEEGFDVTSFEEAQSALDQLLDDAPDVILTDIRMPGI  60
            MSRNKIWVIDDDRAMRWVLEKTFKEEGFDVTSFEEAQ+ALDQLLDDAPDVILTDIRMPGI
Sbjct  1    MSRNKIWVIDDDRAMRWVLEKTFKEEGFDVTSFEEAQTALDQLLDDAPDVILTDIRMPGI  60

Query  61   DGLTFLGKVKNNYPDLPVIIMTAHSDLESAVSSYQTGAFEYLPKPFDIDEALALVNRAIL  120
            DGLTFLGKVKN+ PDLPVIIMTAHSDLESAVSSYQTGAFEYLPKPFDIDEALALVNRAIL
Sbjct  61   DGLTFLGKVKNSNPDLPVIIMTAHSDLESAVSSYQTGAFEYLPKPFDIDEALALVNRAIL  120

Query  121  HINKLQQQEATKAASAAQSTEIIGESPAMQEVFRAIGRLSQSHITVLINGESGTGKELVA  180
            HINKLQQQEA+K+AS AQSTEIIGESPAMQEVFRAIGRLSQSHITVLINGESGTGKELVA
Sbjct  121  HINKLQQQEASKSASVAQSTEIIGESPAMQEVFRAIGRLSQSHITVLINGESGTGKELVA  180

Query  181  HALHKHSPRSSKPFIALNMAAIPKDLIETELFGHEKGAFTGANTQRQGRFEQANGGTLFL  240
            HALHKHSPRSSKPFIALNMAAIPKDLIETELFGHEKGAFTGANTQRQGRFEQANGGTLFL
Sbjct  181  HALHKHSPRSSKPFIALNMAAIPKDLIETELFGHEKGAFTGANTQRQGRFEQANGGTLFL  240

Query  241  DEIGDMPFETQTRLLRVLADGEFYRVGGHIPVKVDVRIVAATHQDLEKLVNEGRFREDLY  300
            DEIGDMPFETQTRLLRVLADGEFYRVGGHIPVKVDVRIVAATHQDLEKLVNEGRFREDLY
Sbjct  241  DEIGDMPFETQTRLLRVLADGEFYRVGGHIPVKVDVRIVAATHQDLEKLVNEGRFREDLY  300

Query  301  HRLNVIRIHIPKLAHRSEDIPMLAQHFLARAGKELGVSPKILRTETTDYMQQLPWPGNVR  360
            HRLNVIRIHIPKLAHRSEDIPMLAQHFLARAGKELGVSPKILRTETTDYMQQLPWPGNVR
Sbjct  301  HRLNVIRIHIPKLAHRSEDIPMLAQHFLARAGKELGVSPKILRTETTDYMQQLPWPGNVR  360

Query  361  QLENTCRWLTVMITGREVYPEDLPSELKQIPIQKSVDQTGTPPSFDRISLHHWDELLGQW  420
            QLENTCRWLTVMITGREVYPEDLPSELKQIPIQKSVD     P+FDRISLHHWDELLGQW
Sbjct  361  QLENTCRWLTVMITGREVYPEDLPSELKQIPIQKSVDTNIATPNFDRISLHHWDELLGQW  420

Query  421  AIQKLKNGEMKILDIATPMFERTLINAALQQTRGRKRHAAELLGWGRNTLTRKLKELGIS  480
            AIQKLKNGEMKILDIATPMFERTLINAALQQTRGRKRHAAELLGWGRNTLTRKLKELGI+
Sbjct  421  AIQKLKNGEMKILDIATPMFERTLINAALQQTRGRKRHAAELLGWGRNTLTRKLKELGIA  480

Query  481  AEDDTEEESEI  491
            AEDD EEESEI
Sbjct  481  AEDDVEEESEI  491


> A0A0M1I0W2 DNA-binding transcriptional regulator NtrC [Acinetobacter 
sp. C15]
Length=491

 Score =  949 bits (2453),  Expect = 0.0
 Identities = 476/491 (97%), Positives = 482/491 (98%), Gaps = 0/491 (0%)

Query  1    MSRNKIWVIDDDRAMRWVLEKTFKEEGFDVTSFEEAQSALDQLLDDAPDVILTDIRMPGI  60
            MSRNKIWVIDDDRAMRWVLEKTFKEEGFDVTSFEEAQ+ALDQLLDDAPDVILTDIRMPGI
Sbjct  1    MSRNKIWVIDDDRAMRWVLEKTFKEEGFDVTSFEEAQTALDQLLDDAPDVILTDIRMPGI  60

Query  61   DGLTFLGKVKNNYPDLPVIIMTAHSDLESAVSSYQTGAFEYLPKPFDIDEALALVNRAIL  120
            DGLTFLGKVKN+ PDLPVIIMTAHSDLESAVSSYQTGAFEYLPKPFDIDEALALVNRAIL
Sbjct  61   DGLTFLGKVKNSNPDLPVIIMTAHSDLESAVSSYQTGAFEYLPKPFDIDEALALVNRAIL  120

Query  121  HINKLQQQEATKAASAAQSTEIIGESPAMQEVFRAIGRLSQSHITVLINGESGTGKELVA  180
            HINKLQQQEA+K+AS AQSTEIIGESPAMQEVFRAIGRLSQSHITVLINGESGTGKELVA
Sbjct  121  HINKLQQQEASKSASVAQSTEIIGESPAMQEVFRAIGRLSQSHITVLINGESGTGKELVA  180

Query  181  HALHKHSPRSSKPFIALNMAAIPKDLIETELFGHEKGAFTGANTQRQGRFEQANGGTLFL  240
            HALHKHSPRSSKPFIALNMAAIPKDLIETELFGHEKGAFTGANTQRQGRFEQANGGTLFL
Sbjct  181  HALHKHSPRSSKPFIALNMAAIPKDLIETELFGHEKGAFTGANTQRQGRFEQANGGTLFL  240

Query  241  DEIGDMPFETQTRLLRVLADGEFYRVGGHIPVKVDVRIVAATHQDLEKLVNEGRFREDLY  300
            DEIGDMPFETQTRLLRVLADGEFYRVGGHIPVKVDVRIVAATHQDLEKLVNEGRFREDLY
Sbjct  241  DEIGDMPFETQTRLLRVLADGEFYRVGGHIPVKVDVRIVAATHQDLEKLVNEGRFREDLY  300

Query  301  HRLNVIRIHIPKLAHRSEDIPMLAQHFLARAGKELGVSPKILRTETTDYMQQLPWPGNVR  360
            HRLNVIRIHIPKLAHRSEDIPMLAQHFLARAGKELGVSPKILRTETTDYMQQLPWPGNVR
Sbjct  301  HRLNVIRIHIPKLAHRSEDIPMLAQHFLARAGKELGVSPKILRTETTDYMQQLPWPGNVR  360

Query  361  QLENTCRWLTVMITGREVYPEDLPSELKQIPIQKSVDQTGTPPSFDRISLHHWDELLGQW  420
            QLENTCRWLTVMITGREVYPEDLPSELKQIPIQKS D     P+FDRISLHHWDELLGQW
Sbjct  361  QLENTCRWLTVMITGREVYPEDLPSELKQIPIQKSADTNIATPNFDRISLHHWDELLGQW  420

Query  421  AIQKLKNGEMKILDIATPMFERTLINAALQQTRGRKRHAAELLGWGRNTLTRKLKELGIS  480
            AIQKLKNGEMKILDIATPMFERTLINAALQQTRGRKRHAAELLGWGRNTLTRKLKELGI+
Sbjct  421  AIQKLKNGEMKILDIATPMFERTLINAALQQTRGRKRHAAELLGWGRNTLTRKLKELGIA  480

Query  481  AEDDTEEESEI  491
            AEDD EEESEI
Sbjct  481  AEDDVEEESEI  491


> N9D8U1 DNA-binding transcriptional regulator NtrC [Acinetobacter 
ursingii ANC 3649]
Length=491

 Score =  931 bits (2407),  Expect = 0.0
 Identities = 465/491 (95%), Positives = 475/491 (97%), Gaps = 0/491 (0%)

Query  1    MSRNKIWVIDDDRAMRWVLEKTFKEEGFDVTSFEEAQSALDQLLDDAPDVILTDIRMPGI  60
            MSRNKIWVIDDDRAMRWVLEKTFKEEG DVTSFEEAQ+ALDQL +DAPDVILTDIRMPGI
Sbjct  1    MSRNKIWVIDDDRAMRWVLEKTFKEEGLDVTSFEEAQTALDQLAEDAPDVILTDIRMPGI  60

Query  61   DGLTFLGKVKNNYPDLPVIIMTAHSDLESAVSSYQTGAFEYLPKPFDIDEALALVNRAIL  120
            DGLTFLGKVKNNYPDLPVIIMTAHSDLESAVSSYQTGAFEYLPKPFDIDEALALV+RAIL
Sbjct  61   DGLTFLGKVKNNYPDLPVIIMTAHSDLESAVSSYQTGAFEYLPKPFDIDEALALVHRAIL  120

Query  121  HINKLQQQEATKAASAAQSTEIIGESPAMQEVFRAIGRLSQSHITVLINGESGTGKELVA  180
            H+NKLQQQEA K  +  QSTEIIGESPAMQEVFRAIGRLSQSHITVLINGESGTGKELVA
Sbjct  121  HVNKLQQQEAAKTTTPVQSTEIIGESPAMQEVFRAIGRLSQSHITVLINGESGTGKELVA  180

Query  181  HALHKHSPRSSKPFIALNMAAIPKDLIETELFGHEKGAFTGANTQRQGRFEQANGGTLFL  240
            HALHKHSPRSSKPFIALNMAAIPKDLIETELFGHEKGAFTGANTQRQGRFEQANGGTLFL
Sbjct  181  HALHKHSPRSSKPFIALNMAAIPKDLIETELFGHEKGAFTGANTQRQGRFEQANGGTLFL  240

Query  241  DEIGDMPFETQTRLLRVLADGEFYRVGGHIPVKVDVRIVAATHQDLEKLVNEGRFREDLY  300
            DEIGDMPFETQTRLLRVLADGEFYRVGGHIPV+VDVRIVAATHQDLEKLVNEGRFREDLY
Sbjct  241  DEIGDMPFETQTRLLRVLADGEFYRVGGHIPVRVDVRIVAATHQDLEKLVNEGRFREDLY  300

Query  301  HRLNVIRIHIPKLAHRSEDIPMLAQHFLARAGKELGVSPKILRTETTDYMQQLPWPGNVR  360
            HRLNVIRIHIPKLAHRSEDIPMLAQHFLARAGKELGVSPKILR ETTDYMQQLPWPGNVR
Sbjct  301  HRLNVIRIHIPKLAHRSEDIPMLAQHFLARAGKELGVSPKILRPETTDYMQQLPWPGNVR  360

Query  361  QLENTCRWLTVMITGREVYPEDLPSELKQIPIQKSVDQTGTPPSFDRISLHHWDELLGQW  420
            QLENTCRWLTVMITGR+VYPEDLPSELKQIPIQKS +Q  T    DRISLHHWDELLGQW
Sbjct  361  QLENTCRWLTVMITGRDVYPEDLPSELKQIPIQKSGEQATTAAGVDRISLHHWDELLGQW  420

Query  421  AIQKLKNGEMKILDIATPMFERTLINAALQQTRGRKRHAAELLGWGRNTLTRKLKELGIS  480
            AIQKLKNGEMKILDIATPMFERTLINAALQQTRGRKRHAAELLGWGRNTLTRKLKELGI+
Sbjct  421  AIQKLKNGEMKILDIATPMFERTLINAALQQTRGRKRHAAELLGWGRNTLTRKLKELGIA  480

Query  481  AEDDTEEESEI  491
            AEDD EEE+EI
Sbjct  481  AEDDAEEEAEI  491


> N9S075 DNA-binding transcriptional regulator NtrC [Acinetobacter 
ursingii NIPH 706]
Length=491

 Score =  931 bits (2406),  Expect = 0.0
 Identities = 464/491 (95%), Positives = 475/491 (97%), Gaps = 0/491 (0%)

Query  1    MSRNKIWVIDDDRAMRWVLEKTFKEEGFDVTSFEEAQSALDQLLDDAPDVILTDIRMPGI  60
            MSRNKIWVIDDDRAMRWVLEKTFKEEG DVTSFEEAQ+ALDQL +DAPDVILTDIRMPGI
Sbjct  1    MSRNKIWVIDDDRAMRWVLEKTFKEEGLDVTSFEEAQTALDQLAEDAPDVILTDIRMPGI  60

Query  61   DGLTFLGKVKNNYPDLPVIIMTAHSDLESAVSSYQTGAFEYLPKPFDIDEALALVNRAIL  120
            DGLTFLGKVKNNYPDLP+IIMTAHSDLESAVSSYQTGAFEYLPKPFDIDEALALV+RAIL
Sbjct  61   DGLTFLGKVKNNYPDLPIIIMTAHSDLESAVSSYQTGAFEYLPKPFDIDEALALVHRAIL  120

Query  121  HINKLQQQEATKAASAAQSTEIIGESPAMQEVFRAIGRLSQSHITVLINGESGTGKELVA  180
            H+NKLQQQEA K  +  QSTEIIGESPAMQEVFRAIGRLSQSHITVLINGESGTGKELVA
Sbjct  121  HVNKLQQQEAAKTTTPVQSTEIIGESPAMQEVFRAIGRLSQSHITVLINGESGTGKELVA  180

Query  181  HALHKHSPRSSKPFIALNMAAIPKDLIETELFGHEKGAFTGANTQRQGRFEQANGGTLFL  240
            HALHKHSPRSSKPFIALNMAAIPKDLIETELFGHEKGAFTGANTQRQGRFEQANGGTLFL
Sbjct  181  HALHKHSPRSSKPFIALNMAAIPKDLIETELFGHEKGAFTGANTQRQGRFEQANGGTLFL  240

Query  241  DEIGDMPFETQTRLLRVLADGEFYRVGGHIPVKVDVRIVAATHQDLEKLVNEGRFREDLY  300
            DEIGDMPFETQTRLLRVLADGEFYRVGGHIPV+VDVRIVAATHQDLEKLVNEGRFREDLY
Sbjct  241  DEIGDMPFETQTRLLRVLADGEFYRVGGHIPVRVDVRIVAATHQDLEKLVNEGRFREDLY  300

Query  301  HRLNVIRIHIPKLAHRSEDIPMLAQHFLARAGKELGVSPKILRTETTDYMQQLPWPGNVR  360
            HRLNVIRIHIPKLAHRSEDIPMLAQHFLARAGKELGVSPKILR ETTDYMQQLPWPGNVR
Sbjct  301  HRLNVIRIHIPKLAHRSEDIPMLAQHFLARAGKELGVSPKILRPETTDYMQQLPWPGNVR  360

Query  361  QLENTCRWLTVMITGREVYPEDLPSELKQIPIQKSVDQTGTPPSFDRISLHHWDELLGQW  420
            QLENTCRWLTVMITGR+VYPEDLPSELKQIPIQKS +Q  T    DRISLHHWDELLGQW
Sbjct  361  QLENTCRWLTVMITGRDVYPEDLPSELKQIPIQKSGEQATTAAGVDRISLHHWDELLGQW  420

Query  421  AIQKLKNGEMKILDIATPMFERTLINAALQQTRGRKRHAAELLGWGRNTLTRKLKELGIS  480
            AIQKLKNGEMKILDIATPMFERTLINAALQQTRGRKRHAAELLGWGRNTLTRKLKELGI+
Sbjct  421  AIQKLKNGEMKILDIATPMFERTLINAALQQTRGRKRHAAELLGWGRNTLTRKLKELGIA  480

Query  481  AEDDTEEESEI  491
            AEDD EEE+EI
Sbjct  481  AEDDAEEEAEI  491


> A0A2T5QH79 DNA-binding transcriptional regulator NtrC [Acinetobacter 
pittii]
Length=497

 Score =  917 bits (2371),  Expect = 0.0
 Identities = 459/492 (93%), Positives = 474/492 (96%), Gaps = 1/492 (0%)

Query  1    MSRNKIWVIDDDRAMRWVLEKTFKEEGFDVTSFEEAQSALDQLLDDAPDVILTDIRMPGI  60
            MSRNKIWVIDDDRAMRWVLEKTFKEEGFDVT+FEEAQ+AL++L  DAPDVILTDIRMPGI
Sbjct  1    MSRNKIWVIDDDRAMRWVLEKTFKEEGFDVTNFEEAQTALERLHHDAPDVILTDIRMPGI  60

Query  61   DGLTFLGKVKNNYPDLPVIIMTAHSDLESAVSSYQTGAFEYLPKPFDIDEALALVNRAIL  120
            DGLTFL KVKN +PDLPVIIMTAHSDLESAVSSYQTGAFEYLPKPFDIDEALALVNRAIL
Sbjct  61   DGLTFLSKVKNTHPDLPVIIMTAHSDLESAVSSYQTGAFEYLPKPFDIDEALALVNRAIL  120

Query  121  HINKLQQQEATKAASAAQSTEIIGESPAMQEVFRAIGRLSQSHITVLINGESGTGKELVA  180
            HINKLQQQEATK AS  QSTEIIGESPAMQEVFRAIGRLSQSHITVLINGESGTGKELVA
Sbjct  121  HINKLQQQEATKTASPLQSTEIIGESPAMQEVFRAIGRLSQSHITVLINGESGTGKELVA  180

Query  181  HALHKHSPRSSKPFIALNMAAIPKDLIETELFGHEKGAFTGANTQRQGRFEQANGGTLFL  240
            HALHKHSPR +KPFIALNMAAIPKDLIETELFGHEKGAFTGANTQ QGRFEQANGGTLFL
Sbjct  181  HALHKHSPRRAKPFIALNMAAIPKDLIETELFGHEKGAFTGANTQHQGRFEQANGGTLFL  240

Query  241  DEIGDMPFETQTRLLRVLADGEFYRVGGHIPVKVDVRIVAATHQDLEKLVNEGRFREDLY  300
            DEIGDMPFETQTRLLRVLADGEFYRVGGHIPVKVDVRIVAATHQDLEKLVNEGRFREDLY
Sbjct  241  DEIGDMPFETQTRLLRVLADGEFYRVGGHIPVKVDVRIVAATHQDLEKLVNEGRFREDLY  300

Query  301  HRLNVIRIHIPKLAHRSEDIPMLAQHFLARAGKELGVSPKILRTETTDYMQQLPWPGNVR  360
            HRLNVIRIHIPKLAHRSEDIPMLAQHFLARAGKELGVSPKILRTETTDYMQQLPWPGNVR
Sbjct  301  HRLNVIRIHIPKLAHRSEDIPMLAQHFLARAGKELGVSPKILRTETTDYMQQLPWPGNVR  360

Query  361  QLENTCRWLTVMITGREVYPEDLPSELKQIPIQKSVDQTGTPPSFDRISLHHWDELLGQW  420
            QLENTCRWLTVMITGREVYPEDLPSELKQ+P+QKS D +   PSF+RISLHHWDELL QW
Sbjct  361  QLENTCRWLTVMITGREVYPEDLPSELKQVPLQKSSDSSQPAPSFERISLHHWDELLNQW  420

Query  421  AIQKLKNGEMKILDIATPMFERTLINAALQQTRGRKRHAAELLGWGRNTLTRKLKELGI-  479
            AIQKLKNGEMKILDIATPMFERTLINAALQQTRGRKRHAAELLGWGRNTLTRKLKELG+ 
Sbjct  421  AIQKLKNGEMKILDIATPMFERTLINAALQQTRGRKRHAAELLGWGRNTLTRKLKELGMD  480

Query  480  SAEDDTEEESEI  491
            SA+DD E+E ++
Sbjct  481  SADDDEEDEHKV  492


> R9AUE6 DNA-binding transcriptional regulator NtrC [Acinetobacter 
tandoii DSM 14970 = CIP 107469]
Length=491

 Score =  917 bits (2371),  Expect = 0.0
 Identities = 463/491 (94%), Positives = 472/491 (96%), Gaps = 2/491 (0%)

Query  1    MSRNKIWVIDDDRAMRWVLEKTFKEEGFDVTSFEEAQSALDQLLDDAPDVILTDIRMPGI  60
            MSRNKIWVIDDDRAMRWVLEKTFKEEGFDVTSFEEAQSALDQL  DAPDVILTDIRMPGI
Sbjct  1    MSRNKIWVIDDDRAMRWVLEKTFKEEGFDVTSFEEAQSALDQLATDAPDVILTDIRMPGI  60

Query  61   DGLTFLGKVKNNYPDLPVIIMTAHSDLESAVSSYQTGAFEYLPKPFDIDEALALVNRAIL  120
            DGLTFL KVKNNYPDLPVIIMTAHSDLESAVSSYQTGAFEYLPKPFDIDEALALVNRAIL
Sbjct  61   DGLTFLAKVKNNYPDLPVIIMTAHSDLESAVSSYQTGAFEYLPKPFDIDEALALVNRAIL  120

Query  121  HINKLQQQEATKAASAAQSTEIIGESPAMQEVFRAIGRLSQSHITVLINGESGTGKELVA  180
            HI KLQQQE+ K AS  QSTEIIGESPAMQEVFRAIGRLSQSHITVLINGESGTGKELVA
Sbjct  121  HITKLQQQESAKIASPIQSTEIIGESPAMQEVFRAIGRLSQSHITVLINGESGTGKELVA  180

Query  181  HALHKHSPRSSKPFIALNMAAIPKDLIETELFGHEKGAFTGANTQRQGRFEQANGGTLFL  240
            HALH+HSPRSSKPFIALNMAAIPKDLIETELFGHEKGAFTGANTQRQGRFEQANGGTLFL
Sbjct  181  HALHRHSPRSSKPFIALNMAAIPKDLIETELFGHEKGAFTGANTQRQGRFEQANGGTLFL  240

Query  241  DEIGDMPFETQTRLLRVLADGEFYRVGGHIPVKVDVRIVAATHQDLEKLVNEGRFREDLY  300
            DEIGDMPFETQTRLLRVLADGEFYRVGGHIPVKVDVRIVAATHQDLEKLVNEGRFREDLY
Sbjct  241  DEIGDMPFETQTRLLRVLADGEFYRVGGHIPVKVDVRIVAATHQDLEKLVNEGRFREDLY  300

Query  301  HRLNVIRIHIPKLAHRSEDIPMLAQHFLARAGKELGVSPKILRTETTDYMQQLPWPGNVR  360
            HRLNVIRIHIPKLAHRSEDIPMLAQHFLARAGKELGVSPKILR ET +YMQQLPWPGNVR
Sbjct  301  HRLNVIRIHIPKLAHRSEDIPMLAQHFLARAGKELGVSPKILRPETQEYMQQLPWPGNVR  360

Query  361  QLENTCRWLTVMITGREVYPEDLPSELKQIPIQKSVDQTGTPPSFDRISLHHWDELLGQW  420
            QLENTCRWLTVMITGREVYPEDLPSELKQIPI+K+ +   T P FDRISLHHWDELLGQW
Sbjct  361  QLENTCRWLTVMITGREVYPEDLPSELKQIPIEKASEHAAT-PHFDRISLHHWDELLGQW  419

Query  421  AIQKLKNGEMKILDIATPMFERTLINAALQQTRGRKRHAAELLGWGRNTLTRKLKELGI-  479
            AIQKLKNGEMKILDIATPMFERTLINAALQQTRGRKRHAAELLGWGRNTLTRKLKELG+ 
Sbjct  420  AIQKLKNGEMKILDIATPMFERTLINAALQQTRGRKRHAAELLGWGRNTLTRKLKELGMD  479

Query  480  SAEDDTEEESE  490
            +A+DD EEE E
Sbjct  480  TADDDIEEEIE  490


> A0A255U9S5 DNA-binding transcriptional regulator NtrC [Acinetobacter 
sp. BS1]
Length=497

 Score =  916 bits (2368),  Expect = 0.0
 Identities = 458/492 (93%), Positives = 474/492 (96%), Gaps = 1/492 (0%)

Query  1    MSRNKIWVIDDDRAMRWVLEKTFKEEGFDVTSFEEAQSALDQLLDDAPDVILTDIRMPGI  60
            MSRNKIWVIDDDRAMRWVLEKTFKEEGFDVT+FEEAQ+AL++L  DAPDVILTDIRMPGI
Sbjct  1    MSRNKIWVIDDDRAMRWVLEKTFKEEGFDVTNFEEAQTALERLHHDAPDVILTDIRMPGI  60

Query  61   DGLTFLGKVKNNYPDLPVIIMTAHSDLESAVSSYQTGAFEYLPKPFDIDEALALVNRAIL  120
            DGLTFL KVKN +PDLPVIIMTAHSDLESAVSSYQTGAFEYLPKPFDIDEALALVNRAIL
Sbjct  61   DGLTFLSKVKNTHPDLPVIIMTAHSDLESAVSSYQTGAFEYLPKPFDIDEALALVNRAIL  120

Query  121  HINKLQQQEATKAASAAQSTEIIGESPAMQEVFRAIGRLSQSHITVLINGESGTGKELVA  180
            HINKLQQQEATK AS  QSTEIIGESPAMQEVFRAIGRLSQSHITVLINGESGTGKELVA
Sbjct  121  HINKLQQQEATKTASPLQSTEIIGESPAMQEVFRAIGRLSQSHITVLINGESGTGKELVA  180

Query  181  HALHKHSPRSSKPFIALNMAAIPKDLIETELFGHEKGAFTGANTQRQGRFEQANGGTLFL  240
            HALHKHSPR +KPFIALNMAAIPKDLIETELFGHEKGAFTGANTQ QGRFEQANGGTLFL
Sbjct  181  HALHKHSPRRAKPFIALNMAAIPKDLIETELFGHEKGAFTGANTQHQGRFEQANGGTLFL  240

Query  241  DEIGDMPFETQTRLLRVLADGEFYRVGGHIPVKVDVRIVAATHQDLEKLVNEGRFREDLY  300
            DEIGDMPFETQTRLLRVLADGEFYRVGGHIPVKVDVRIVAATHQDLEKLVNEGRFREDLY
Sbjct  241  DEIGDMPFETQTRLLRVLADGEFYRVGGHIPVKVDVRIVAATHQDLEKLVNEGRFREDLY  300

Query  301  HRLNVIRIHIPKLAHRSEDIPMLAQHFLARAGKELGVSPKILRTETTDYMQQLPWPGNVR  360
            HRLNVIRIHIPKLAHRSEDIPMLAQHFLARAGKELGVSPKILRTETTDYMQQLPWPGNVR
Sbjct  301  HRLNVIRIHIPKLAHRSEDIPMLAQHFLARAGKELGVSPKILRTETTDYMQQLPWPGNVR  360

Query  361  QLENTCRWLTVMITGREVYPEDLPSELKQIPIQKSVDQTGTPPSFDRISLHHWDELLGQW  420
            QLENTCRWLTVMITGREVYPEDLPSELKQ+P+QK+ D +   PSF+RISLHHWDELL QW
Sbjct  361  QLENTCRWLTVMITGREVYPEDLPSELKQVPLQKNSDSSQPAPSFERISLHHWDELLNQW  420

Query  421  AIQKLKNGEMKILDIATPMFERTLINAALQQTRGRKRHAAELLGWGRNTLTRKLKELGI-  479
            AIQKLKNGEMKILDIATPMFERTLINAALQQTRGRKRHAAELLGWGRNTLTRKLKELG+ 
Sbjct  421  AIQKLKNGEMKILDIATPMFERTLINAALQQTRGRKRHAAELLGWGRNTLTRKLKELGMD  480

Query  480  SAEDDTEEESEI  491
            SA+DD E+E ++
Sbjct  481  SADDDEEDEHKV  492


> A0A1A0GJV8 DNA-binding transcriptional regulator NtrC [Acinetobacter 
calcoaceticus]
Length=497

 Score =  916 bits (2368),  Expect = 0.0
 Identities = 458/492 (93%), Positives = 474/492 (96%), Gaps = 1/492 (0%)

Query  1    MSRNKIWVIDDDRAMRWVLEKTFKEEGFDVTSFEEAQSALDQLLDDAPDVILTDIRMPGI  60
            MSRNKIWVIDDDRAMRWVLEKTFKEEGFDVT+FEEAQ+AL++L  DAPDVILTDIRMPGI
Sbjct  1    MSRNKIWVIDDDRAMRWVLEKTFKEEGFDVTNFEEAQTALERLHHDAPDVILTDIRMPGI  60

Query  61   DGLTFLGKVKNNYPDLPVIIMTAHSDLESAVSSYQTGAFEYLPKPFDIDEALALVNRAIL  120
            DGLTFL KVKN +PDLPVIIMTAHSDLESAVSSYQTGAFEYLPKPFDIDEALALVNRAIL
Sbjct  61   DGLTFLSKVKNTHPDLPVIIMTAHSDLESAVSSYQTGAFEYLPKPFDIDEALALVNRAIL  120

Query  121  HINKLQQQEATKAASAAQSTEIIGESPAMQEVFRAIGRLSQSHITVLINGESGTGKELVA  180
            HINKLQQQEATK AS  QSTEIIGESPAMQEVFRAIGRLSQSHITVLINGESGTGKELVA
Sbjct  121  HINKLQQQEATKTASPLQSTEIIGESPAMQEVFRAIGRLSQSHITVLINGESGTGKELVA  180

Query  181  HALHKHSPRSSKPFIALNMAAIPKDLIETELFGHEKGAFTGANTQRQGRFEQANGGTLFL  240
            HALHKHSPR +KPFIALNMAAIPKDLIETELFGHEKGAFTGANTQ QGRFEQANGGTLFL
Sbjct  181  HALHKHSPRRAKPFIALNMAAIPKDLIETELFGHEKGAFTGANTQHQGRFEQANGGTLFL  240

Query  241  DEIGDMPFETQTRLLRVLADGEFYRVGGHIPVKVDVRIVAATHQDLEKLVNEGRFREDLY  300
            DEIGDMPFETQTRLLRVLADGEFYRVGGHIPVKVDVRIVAATHQDLEKLVNEGRFREDLY
Sbjct  241  DEIGDMPFETQTRLLRVLADGEFYRVGGHIPVKVDVRIVAATHQDLEKLVNEGRFREDLY  300

Query  301  HRLNVIRIHIPKLAHRSEDIPMLAQHFLARAGKELGVSPKILRTETTDYMQQLPWPGNVR  360
            HRLNVIRIHIPKLAHRSEDIPMLAQHFLARAGKELGVSPKILRTETTDYMQQLPWPGNVR
Sbjct  301  HRLNVIRIHIPKLAHRSEDIPMLAQHFLARAGKELGVSPKILRTETTDYMQQLPWPGNVR  360

Query  361  QLENTCRWLTVMITGREVYPEDLPSELKQIPIQKSVDQTGTPPSFDRISLHHWDELLGQW  420
            QLENTCRWLTVMITGREVYPEDLPSELKQ+P+QK+ D +   PSF+RISLHHWDELL QW
Sbjct  361  QLENTCRWLTVMITGREVYPEDLPSELKQVPLQKNSDSSQPAPSFERISLHHWDELLNQW  420

Query  421  AIQKLKNGEMKILDIATPMFERTLINAALQQTRGRKRHAAELLGWGRNTLTRKLKELGI-  479
            AIQKLKNGEMKILDIATPMFERTLINAALQQTRGRKRHAAELLGWGRNTLTRKLKELG+ 
Sbjct  421  AIQKLKNGEMKILDIATPMFERTLINAALQQTRGRKRHAAELLGWGRNTLTRKLKELGMD  480

Query  480  SAEDDTEEESEI  491
            SA+DD E+E ++
Sbjct  481  SADDDEEDEHKV  492


> A0A1H8T6Y6 DNA-binding transcriptional regulator NtrC [Acinetobacter 
sp. UNC434CL69Tsu2S25]
Length=497

 Score =  916 bits (2368),  Expect = 0.0
 Identities = 458/492 (93%), Positives = 474/492 (96%), Gaps = 1/492 (0%)

Query  1    MSRNKIWVIDDDRAMRWVLEKTFKEEGFDVTSFEEAQSALDQLLDDAPDVILTDIRMPGI  60
            MSRNKIWVIDDDRAMRWVLEKTFKEEGFDVT+FEEAQ+AL++L  DAPDVILTDIRMPGI
Sbjct  1    MSRNKIWVIDDDRAMRWVLEKTFKEEGFDVTNFEEAQTALERLHHDAPDVILTDIRMPGI  60

Query  61   DGLTFLGKVKNNYPDLPVIIMTAHSDLESAVSSYQTGAFEYLPKPFDIDEALALVNRAIL  120
            DGLTFL KVKN +PDLPVIIMTAHSDLESAVSSYQTGAFEYLPKPFDIDEALALVNRAIL
Sbjct  61   DGLTFLSKVKNTHPDLPVIIMTAHSDLESAVSSYQTGAFEYLPKPFDIDEALALVNRAIL  120

Query  121  HINKLQQQEATKAASAAQSTEIIGESPAMQEVFRAIGRLSQSHITVLINGESGTGKELVA  180
            HINKLQQQEATK AS  QSTEIIGESPAMQEVFRAIGRLSQSHITVLINGESGTGKELVA
Sbjct  121  HINKLQQQEATKTASPLQSTEIIGESPAMQEVFRAIGRLSQSHITVLINGESGTGKELVA  180

Query  181  HALHKHSPRSSKPFIALNMAAIPKDLIETELFGHEKGAFTGANTQRQGRFEQANGGTLFL  240
            HALHKHSPR +KPFIALNMAAIPKDLIETELFGHEKGAFTGANTQ QGRFEQANGGTLFL
Sbjct  181  HALHKHSPRRAKPFIALNMAAIPKDLIETELFGHEKGAFTGANTQHQGRFEQANGGTLFL  240

Query  241  DEIGDMPFETQTRLLRVLADGEFYRVGGHIPVKVDVRIVAATHQDLEKLVNEGRFREDLY  300
            DEIGDMPFETQTRLLRVLADGEFYRVGGHIPVKVDVRIVAATHQDLEKLVNEGRFREDLY
Sbjct  241  DEIGDMPFETQTRLLRVLADGEFYRVGGHIPVKVDVRIVAATHQDLEKLVNEGRFREDLY  300

Query  301  HRLNVIRIHIPKLAHRSEDIPMLAQHFLARAGKELGVSPKILRTETTDYMQQLPWPGNVR  360
            HRLNVIRIHIPKLAHRSEDIPMLAQHFLARAGKELGVSPKILRTETTDYMQQLPWPGNVR
Sbjct  301  HRLNVIRIHIPKLAHRSEDIPMLAQHFLARAGKELGVSPKILRTETTDYMQQLPWPGNVR  360

Query  361  QLENTCRWLTVMITGREVYPEDLPSELKQIPIQKSVDQTGTPPSFDRISLHHWDELLGQW  420
            QLENTCRWLTVMITGREVYPEDLPSELKQ+P+QK+ D +   PSF+RISLHHWDELL QW
Sbjct  361  QLENTCRWLTVMITGREVYPEDLPSELKQVPLQKNSDSSQPAPSFERISLHHWDELLNQW  420

Query  421  AIQKLKNGEMKILDIATPMFERTLINAALQQTRGRKRHAAELLGWGRNTLTRKLKELGI-  479
            AIQKLKNGEMKILDIATPMFERTLINAALQQTRGRKRHAAELLGWGRNTLTRKLKELG+ 
Sbjct  421  AIQKLKNGEMKILDIATPMFERTLINAALQQTRGRKRHAAELLGWGRNTLTRKLKELGMD  480

Query  480  SAEDDTEEESEI  491
            SA+DD E+E ++
Sbjct  481  SADDDEEDEHKV  492


> A0A127KF30 DNA-binding transcriptional regulator NtrC [Acinetobacter 
sp. DUT-2]
Length=497

 Score =  916 bits (2368),  Expect = 0.0
 Identities = 458/492 (93%), Positives = 474/492 (96%), Gaps = 1/492 (0%)

Query  1    MSRNKIWVIDDDRAMRWVLEKTFKEEGFDVTSFEEAQSALDQLLDDAPDVILTDIRMPGI  60
            MSRNKIWVIDDDRAMRWVLEKTFKEEGFDVT+FEEAQ+AL++L  DAPDVILTDIRMPGI
Sbjct  1    MSRNKIWVIDDDRAMRWVLEKTFKEEGFDVTNFEEAQTALERLHHDAPDVILTDIRMPGI  60

Query  61   DGLTFLGKVKNNYPDLPVIIMTAHSDLESAVSSYQTGAFEYLPKPFDIDEALALVNRAIL  120
            DGLTFL KVKN +PDLPVIIMTAHSDLESAVSSYQTGAFEYLPKPFDIDEALALVNRAIL
Sbjct  61   DGLTFLSKVKNTHPDLPVIIMTAHSDLESAVSSYQTGAFEYLPKPFDIDEALALVNRAIL  120

Query  121  HINKLQQQEATKAASAAQSTEIIGESPAMQEVFRAIGRLSQSHITVLINGESGTGKELVA  180
            HINKLQQQEATK AS  QSTEIIGESPAMQEVFRAIGRLSQSHITVLINGESGTGKELVA
Sbjct  121  HINKLQQQEATKTASPLQSTEIIGESPAMQEVFRAIGRLSQSHITVLINGESGTGKELVA  180

Query  181  HALHKHSPRSSKPFIALNMAAIPKDLIETELFGHEKGAFTGANTQRQGRFEQANGGTLFL  240
            HALHKHSPR +KPFIALNMAAIPKDLIETELFGHEKGAFTGANTQ QGRFEQANGGTLFL
Sbjct  181  HALHKHSPRRAKPFIALNMAAIPKDLIETELFGHEKGAFTGANTQHQGRFEQANGGTLFL  240

Query  241  DEIGDMPFETQTRLLRVLADGEFYRVGGHIPVKVDVRIVAATHQDLEKLVNEGRFREDLY  300
            DEIGDMPFETQTRLLRVLADGEFYRVGGHIPVKVDVRIVAATHQDLEKLVNEGRFREDLY
Sbjct  241  DEIGDMPFETQTRLLRVLADGEFYRVGGHIPVKVDVRIVAATHQDLEKLVNEGRFREDLY  300

Query  301  HRLNVIRIHIPKLAHRSEDIPMLAQHFLARAGKELGVSPKILRTETTDYMQQLPWPGNVR  360
            HRLNVIRIHIPKLAHRSEDIPMLAQHFLARAGKELGVSPKILRTETTDYMQQLPWPGNVR
Sbjct  301  HRLNVIRIHIPKLAHRSEDIPMLAQHFLARAGKELGVSPKILRTETTDYMQQLPWPGNVR  360

Query  361  QLENTCRWLTVMITGREVYPEDLPSELKQIPIQKSVDQTGTPPSFDRISLHHWDELLGQW  420
            QLENTCRWLTVMITGREVYPEDLPSELKQ+P+QK+ D +   PSF+RISLHHWDELL QW
Sbjct  361  QLENTCRWLTVMITGREVYPEDLPSELKQVPLQKNSDSSQPAPSFERISLHHWDELLNQW  420

Query  421  AIQKLKNGEMKILDIATPMFERTLINAALQQTRGRKRHAAELLGWGRNTLTRKLKELGI-  479
            AIQKLKNGEMKILDIATPMFERTLINAALQQTRGRKRHAAELLGWGRNTLTRKLKELG+ 
Sbjct  421  AIQKLKNGEMKILDIATPMFERTLINAALQQTRGRKRHAAELLGWGRNTLTRKLKELGMD  480

Query  480  SAEDDTEEESEI  491
            SA+DD E+E ++
Sbjct  481  SADDDEEDEHKV  492


> A0A022KRC7 DNA-binding transcriptional regulator NtrC [Acinetobacter 
sp. 478810]
Length=497

 Score =  916 bits (2368),  Expect = 0.0
 Identities = 458/492 (93%), Positives = 474/492 (96%), Gaps = 1/492 (0%)

Query  1    MSRNKIWVIDDDRAMRWVLEKTFKEEGFDVTSFEEAQSALDQLLDDAPDVILTDIRMPGI  60
            MSRNKIWVIDDDRAMRWVLEKTFKEEGFDVT+FEEAQ+AL++L  DAPDVILTDIRMPGI
Sbjct  1    MSRNKIWVIDDDRAMRWVLEKTFKEEGFDVTNFEEAQTALERLHHDAPDVILTDIRMPGI  60

Query  61   DGLTFLGKVKNNYPDLPVIIMTAHSDLESAVSSYQTGAFEYLPKPFDIDEALALVNRAIL  120
            DGLTFL KVKN +PDLPVIIMTAHSDLESAVSSYQTGAFEYLPKPFDIDEALALVNRAIL
Sbjct  61   DGLTFLSKVKNTHPDLPVIIMTAHSDLESAVSSYQTGAFEYLPKPFDIDEALALVNRAIL  120

Query  121  HINKLQQQEATKAASAAQSTEIIGESPAMQEVFRAIGRLSQSHITVLINGESGTGKELVA  180
            HINKLQQQEATK AS  QSTEIIGESPAMQEVFRAIGRLSQSHITVLINGESGTGKELVA
Sbjct  121  HINKLQQQEATKTASPLQSTEIIGESPAMQEVFRAIGRLSQSHITVLINGESGTGKELVA  180

Query  181  HALHKHSPRSSKPFIALNMAAIPKDLIETELFGHEKGAFTGANTQRQGRFEQANGGTLFL  240
            HALHKHSPR +KPFIALNMAAIPKDLIETELFGHEKGAFTGANTQ QGRFEQANGGTLFL
Sbjct  181  HALHKHSPRRAKPFIALNMAAIPKDLIETELFGHEKGAFTGANTQHQGRFEQANGGTLFL  240

Query  241  DEIGDMPFETQTRLLRVLADGEFYRVGGHIPVKVDVRIVAATHQDLEKLVNEGRFREDLY  300
            DEIGDMPFETQTRLLRVLADGEFYRVGGHIPVKVDVRIVAATHQDLEKLVNEGRFREDLY
Sbjct  241  DEIGDMPFETQTRLLRVLADGEFYRVGGHIPVKVDVRIVAATHQDLEKLVNEGRFREDLY  300

Query  301  HRLNVIRIHIPKLAHRSEDIPMLAQHFLARAGKELGVSPKILRTETTDYMQQLPWPGNVR  360
            HRLNVIRIHIPKLAHRSEDIPMLAQHFLARAGKELGVSPKILRTETTDYMQQLPWPGNVR
Sbjct  301  HRLNVIRIHIPKLAHRSEDIPMLAQHFLARAGKELGVSPKILRTETTDYMQQLPWPGNVR  360

Query  361  QLENTCRWLTVMITGREVYPEDLPSELKQIPIQKSVDQTGTPPSFDRISLHHWDELLGQW  420
            QLENTCRWLTVMITGREVYPEDLPSELKQ+P+QK+ D +   PSF+RISLHHWDELL QW
Sbjct  361  QLENTCRWLTVMITGREVYPEDLPSELKQVPLQKNSDSSQPAPSFERISLHHWDELLNQW  420

Query  421  AIQKLKNGEMKILDIATPMFERTLINAALQQTRGRKRHAAELLGWGRNTLTRKLKELGI-  479
            AIQKLKNGEMKILDIATPMFERTLINAALQQTRGRKRHAAELLGWGRNTLTRKLKELG+ 
Sbjct  421  AIQKLKNGEMKILDIATPMFERTLINAALQQTRGRKRHAAELLGWGRNTLTRKLKELGMD  480

Query  480  SAEDDTEEESEI  491
            SA+DD E+E ++
Sbjct  481  SADDDEEDEHKV  492


> A0A1V0KAC1 DNA-binding transcriptional regulator NtrC [Acinetobacter 
lactucae]
Length=497

 Score =  916 bits (2367),  Expect = 0.0
 Identities = 459/492 (93%), Positives = 473/492 (96%), Gaps = 1/492 (0%)

Query  1    MSRNKIWVIDDDRAMRWVLEKTFKEEGFDVTSFEEAQSALDQLLDDAPDVILTDIRMPGI  60
            MSRNKIWVIDDDRAMRWVLEKTFKEEGFDVT+FEEAQ+AL++L  DAPDVILTDIRMPGI
Sbjct  1    MSRNKIWVIDDDRAMRWVLEKTFKEEGFDVTNFEEAQTALERLHHDAPDVILTDIRMPGI  60

Query  61   DGLTFLGKVKNNYPDLPVIIMTAHSDLESAVSSYQTGAFEYLPKPFDIDEALALVNRAIL  120
            DGLTFL KVKN +PDLPVIIMTAHSDLESAVSSYQTGAFEYLPKPFDIDEALALVNRAIL
Sbjct  61   DGLTFLSKVKNTHPDLPVIIMTAHSDLESAVSSYQTGAFEYLPKPFDIDEALALVNRAIL  120

Query  121  HINKLQQQEATKAASAAQSTEIIGESPAMQEVFRAIGRLSQSHITVLINGESGTGKELVA  180
            HINKLQQQEATK AS  QSTEIIGESPAMQEVFRAIGRLSQSHITVLINGESGTGKELVA
Sbjct  121  HINKLQQQEATKTASPLQSTEIIGESPAMQEVFRAIGRLSQSHITVLINGESGTGKELVA  180

Query  181  HALHKHSPRSSKPFIALNMAAIPKDLIETELFGHEKGAFTGANTQRQGRFEQANGGTLFL  240
            HALHKHSPR +KPFIALNMAAIPKDLIETELFGHEKGAFTGANTQ QGRFEQANGGTLFL
Sbjct  181  HALHKHSPRRAKPFIALNMAAIPKDLIETELFGHEKGAFTGANTQHQGRFEQANGGTLFL  240

Query  241  DEIGDMPFETQTRLLRVLADGEFYRVGGHIPVKVDVRIVAATHQDLEKLVNEGRFREDLY  300
            DEIGDMPFETQTRLLRVLADGEFYRVGGHIPVKVDVRIVAATHQDLEKLVNEGRFREDLY
Sbjct  241  DEIGDMPFETQTRLLRVLADGEFYRVGGHIPVKVDVRIVAATHQDLEKLVNEGRFREDLY  300

Query  301  HRLNVIRIHIPKLAHRSEDIPMLAQHFLARAGKELGVSPKILRTETTDYMQQLPWPGNVR  360
            HRLNVIRIHIPKLAHRSEDIPMLAQHFLARAGKELGVSPKILRTETTDYMQQLPWPGNVR
Sbjct  301  HRLNVIRIHIPKLAHRSEDIPMLAQHFLARAGKELGVSPKILRTETTDYMQQLPWPGNVR  360

Query  361  QLENTCRWLTVMITGREVYPEDLPSELKQIPIQKSVDQTGTPPSFDRISLHHWDELLGQW  420
            QLENTCRWLTVMITGREVYPEDLPSELKQ+P+QKS D     PSF+RISLHHWDELL QW
Sbjct  361  QLENTCRWLTVMITGREVYPEDLPSELKQVPLQKSSDAGQPAPSFERISLHHWDELLNQW  420

Query  421  AIQKLKNGEMKILDIATPMFERTLINAALQQTRGRKRHAAELLGWGRNTLTRKLKELGI-  479
            AIQKLKNGEMKILDIATPMFERTLINAALQQTRGRKRHAAELLGWGRNTLTRKLKELG+ 
Sbjct  421  AIQKLKNGEMKILDIATPMFERTLINAALQQTRGRKRHAAELLGWGRNTLTRKLKELGMD  480

Query  480  SAEDDTEEESEI  491
            SA+DD E+E ++
Sbjct  481  SADDDEEDEHKV  492


> R8YMR8 DNA-binding transcriptional regulator NtrC [Acinetobacter 
pittii ANC 4050]
Length=497

 Score =  916 bits (2367),  Expect = 0.0
 Identities = 459/492 (93%), Positives = 474/492 (96%), Gaps = 1/492 (0%)

Query  1    MSRNKIWVIDDDRAMRWVLEKTFKEEGFDVTSFEEAQSALDQLLDDAPDVILTDIRMPGI  60
            MSRNKIWVIDDDRAMRWVLEKTFKEEGFDVT+FEEAQ+AL++L  DAPDVILTDIRMPGI
Sbjct  1    MSRNKIWVIDDDRAMRWVLEKTFKEEGFDVTNFEEAQTALERLHHDAPDVILTDIRMPGI  60

Query  61   DGLTFLGKVKNNYPDLPVIIMTAHSDLESAVSSYQTGAFEYLPKPFDIDEALALVNRAIL  120
            DGLTFL KVKN++PDLPVIIMTAHSDLESAVSSYQTGAFEYLPKPFDIDEALALVNRAIL
Sbjct  61   DGLTFLSKVKNSHPDLPVIIMTAHSDLESAVSSYQTGAFEYLPKPFDIDEALALVNRAIL  120

Query  121  HINKLQQQEATKAASAAQSTEIIGESPAMQEVFRAIGRLSQSHITVLINGESGTGKELVA  180
            HINKLQQQEATK AS  QSTEIIGESPAMQEVFRAIGRLSQSHITVLINGESGTGKELVA
Sbjct  121  HINKLQQQEATKTASPLQSTEIIGESPAMQEVFRAIGRLSQSHITVLINGESGTGKELVA  180

Query  181  HALHKHSPRSSKPFIALNMAAIPKDLIETELFGHEKGAFTGANTQRQGRFEQANGGTLFL  240
            HALHKHSPR +KPFIALNMAAIPKDLIETELFGHEKGAFTGANTQ QGRFEQANGGTLFL
Sbjct  181  HALHKHSPRRAKPFIALNMAAIPKDLIETELFGHEKGAFTGANTQHQGRFEQANGGTLFL  240

Query  241  DEIGDMPFETQTRLLRVLADGEFYRVGGHIPVKVDVRIVAATHQDLEKLVNEGRFREDLY  300
            DEIGDMPFETQTRLLRVLADGEFYRVGGHIPVKVDVRIVAATHQDLEKLVNEGRFREDLY
Sbjct  241  DEIGDMPFETQTRLLRVLADGEFYRVGGHIPVKVDVRIVAATHQDLEKLVNEGRFREDLY  300

Query  301  HRLNVIRIHIPKLAHRSEDIPMLAQHFLARAGKELGVSPKILRTETTDYMQQLPWPGNVR  360
            HRLNVIRIHIPKLAHRSEDIPMLAQHFLARAGKELGVSPKILRTETTDYMQQLPWPGNVR
Sbjct  301  HRLNVIRIHIPKLAHRSEDIPMLAQHFLARAGKELGVSPKILRTETTDYMQQLPWPGNVR  360

Query  361  QLENTCRWLTVMITGREVYPEDLPSELKQIPIQKSVDQTGTPPSFDRISLHHWDELLGQW  420
            QLENTCRWLTVMITGREVYPEDLPSELKQ+P+QK+ D     PSF+RISLHHWDELL QW
Sbjct  361  QLENTCRWLTVMITGREVYPEDLPSELKQVPLQKNSDSGQPAPSFERISLHHWDELLNQW  420

Query  421  AIQKLKNGEMKILDIATPMFERTLINAALQQTRGRKRHAAELLGWGRNTLTRKLKELGI-  479
            AIQKLKNGEMKILDIATPMFERTLINAALQQTRGRKRHAAELLGWGRNTLTRKLKELG+ 
Sbjct  421  AIQKLKNGEMKILDIATPMFERTLINAALQQTRGRKRHAAELLGWGRNTLTRKLKELGMD  480

Query  480  SAEDDTEEESEI  491
            SA+DD E+E +I
Sbjct  481  SADDDEEDEHKI  492


> Q5EG41 DNA-binding transcriptional regulator NtrC [Pseudomonas 
putida]
Length=478

 Score =  632 bits (1631),  Expect = 0.0
 Identities = 315/491 (64%), Positives = 383/491 (78%), Gaps = 16/491 (3%)

Query  1    MSRNK-IWVIDDDRAMRWVLEKTFKEEGFDVTSFEEAQSALDQLLDDAPDVILTDIRMPG  59
            MSR++ +W++DDDR++RWVLEK  ++EG    SF+ A   + +L    PDVI++DIRMPG
Sbjct  1    MSRSETVWIVDDDRSIRWVLEKALQQEGMTTQSFDSADGVMGRLARQQPDVIISDIRMPG  60

Query  60   IDGLTFLGKVKNNYPDLPVIIMTAHSDLESAVSSYQTGAFEYLPKPFDIDEALALVNRAI  119
              GL  L +++  +P LPVIIMTAHSDL+SAV+SYQ GAFEYLPKPFD+DEA++LV RA 
Sbjct  61   TSGLDLLAQIREQHPRLPVIIMTAHSDLDSAVASYQGGAFEYLPKPFDVDEAVSLVKRAN  120

Query  120  LHINKLQQQEATKAASAAQSTEIIGESPAMQEVFRAIGRLSQSHITVLINGESGTGKELV  179
             H    +QQ      + A++ EIIGE+PAMQEVFRAIGRLS S+ITVLINGESGTGKELV
Sbjct  121  QHAQ--EQQGLDVPQNLARTPEIIGEAPAMQEVFRAIGRLSHSNITVLINGESGTGKELV  178

Query  180  AHALHKHSPRSSKPFIALNMAAIPKDLIETELFGHEKGAFTGANTQRQGRFEQANGGTLF  239
            AHALH+HSPR++ PFIALNMAAIPKDL+E+ELFGHEKGAFTGA   R+GRFEQA+GGTLF
Sbjct  179  AHALHRHSPRAASPFIALNMAAIPKDLMESELFGHEKGAFTGAANLRRGRFEQADGGTLF  238

Query  240  LDEIGDMPFETQTRLLRVLADGEFYRVGGHIPVKVDVRIVAATHQDLEKLVNEGRFREDL  299
            LDEIGDMP +TQTRLLRVLADGEFYRVGGH+PVKVDVRI+AATHQ+LE LV  G+FREDL
Sbjct  239  LDEIGDMPADTQTRLLRVLADGEFYRVGGHVPVKVDVRIIAATHQNLESLVQAGKFREDL  298

Query  300  YHRLNVIRIHIPKLAHRSEDIPMLAQHFLARAGKELGVSPKILRTETTDYMQQLPWPGNV  359
            +HRLNVIRIHIP+LA R EDIP LA+HFLARA +EL V PKIL+ ET ++++ LPWPGNV
Sbjct  299  FHRLNVIRIHIPRLADRREDIPALARHFLARAAQELAVEPKILKPETEEFIRNLPWPGNV  358

Query  360  RQLENTCRWLTVMITGREVYPEDLPSELKQIPIQKSVDQTGTPPSFDRISLHHWDELLGQ  419
            RQ+ENTCRW+TVM + REV   DLP EL  +P              D   + +W++ L Q
Sbjct  359  RQMENTCRWITVMASSREVLIGDLPPELLNLP-------------HDAAPVTNWEQALRQ  405

Query  420  WAIQKLKNGEMKILDIATPMFERTLINAALQQTRGRKRHAAELLGWGRNTLTRKLKELGI  479
            WA Q L  G+  +LD A P FER +I  AL+ T GR+R AA LLGWGRNTLTRK+KELG+
Sbjct  406  WADQALARGQTSLLDSAVPSFERIMIETALKHTAGRRRDAALLLGWGRNTLTRKIKELGM  465

Query  480  SAEDDTEEESE  490
            +     +EE +
Sbjct  466  NVAGGDDEEGD  476


> Q56291 DNA-binding transcriptional regulator NtrC [Acidithiobacillus 
ferrooxidans]
Length=466

 Score =  536 bits (1381),  Expect = 0.0
 Identities = 282/481 (59%), Positives = 346/481 (72%), Gaps = 20/481 (4%)

Query  5    KIWVIDDDRAMRWVLEKTFKEEGFDVTSFEEAQSALDQLLDDAPDVILTDIRMPGIDGLT  64
            ++W+IDDD ++RWVLEK   +    V SF +A SAL  L  + P  ++TD+RMPG+DGL 
Sbjct  3    QVWIIDDDPSIRWVLEKALTQADILVRSFADADSALRALGREQPGAVVTDLRMPGLDGLA  62

Query  65   FLGKVKNNYPDLPVIIMTAHSDLESAVSSYQTGAFEYLPKPFDIDEALALVNRAILHINK  124
            FL +V++ +P LPVI+MTAHSDL++AV+++Q+GAFEYLPKPFD+DEA+ LV RA      
Sbjct  63   FLREVQSRWPKLPVIVMTAHSDLDNAVAAFQSGAFEYLPKPFDMDEAVTLVQRA------  116

Query  125  LQQQEATKAASAAQS--TEIIGESPAMQEVFRAIGRLSQSHITVLINGESGTGKELVAHA  182
            L  +    AA   +S   E+IGE+PAMQEVFRAIGRLS+S I VLI GESG+GKELVA A
Sbjct  117  LGSRAGPGAAGVEESDPAEMIGEAPAMQEVFRAIGRLSRSQINVLITGESGSGKELVASA  176

Query  183  LHKHSPRSSKPFIALNMAAIPKDLIETELFGHEKGAFTGANTQRQGRFEQANGGTLFLDE  242
            LH+HSPR+  PFIA+N AAIP +L+E+ELFGHEKGAFTGA   RQGRFEQA+GGTLFLDE
Sbjct  177  LHRHSPRARGPFIAINTAAIPAELLESELFGHEKGAFTGAVQTRQGRFEQASGGTLFLDE  236

Query  243  IGDMPFETQTRLLRVLADGEFYRVGGHIPVKVDVRIVAATHQDLEKLVNEGRFREDLYHR  302
            IGDMP   QTRLLRVL+DG FYRVGGH P + DVR++AATHQ+LE  V +G FREDLYHR
Sbjct  237  IGDMPAALQTRLLRVLSDGTFYRVGGHAPQRADVRVLAATHQNLEAKVRDGSFREDLYHR  296

Query  303  LNVIRIHIPKLAHRSEDIPMLAQHFLARAGKELGVSPKILRTETTDYMQQLPWPGNVRQL  362
            LNVI IH+P +  R EDIP LA+HFL R+ ++L V  +IL  E   +M    WPGNVRQL
Sbjct  297  LNVIHIHLPPIRERREDIPRLARHFLRRSAEQLDVERRILSPERVAFM-NWHWPGNVRQL  355

Query  363  ENTCRWLTVMITGREVYPEDLPSELKQIPIQKSVDQTGTPPSFDRISLHHWDELLGQWAI  422
            EN CRW+TVM   REV   DLP E+   P+   +    T           W  LLG   +
Sbjct  356  ENVCRWITVMAPTREVQVTDLPPEMAASPMSAMMPDPNT---------QDWRLLLGA-VV  405

Query  423  QKLKNGEMKILDIATPMFERTLINAALQQTRGRKRHAAELLGWGRNTLTRKLKELGISAE  482
            + +   E  +LD   P+FER L+ AALQ TRG K+ AA  LGWGRNTLTRKLKELG+ AE
Sbjct  406  RHVSRREEALLDKIQPLFERCLLEAALQHTRGHKQSAAHKLGWGRNTLTRKLKELGM-AE  464

Query  483  D  483
            D
Sbjct  465  D  465


> O86057 DNA-binding transcriptional regulator NtrC [Herbaspirillum 
seropedicae]
Length=500

 Score =  520 bits (1338),  Expect = 0.0
 Identities = 273/501 (54%), Positives = 349/501 (70%), Gaps = 26/501 (5%)

Query  6    IWVIDDDRAMRWVLEKTFKEEGFDVTSFEEAQSALDQLLDDAPDVILTDIRMPGIDGLTF  65
            IW++DDD ++RWVLEK    E     SF  A+ A+  L +  P V+++DIRMPG  GL  
Sbjct  4    IWIVDDDESIRWVLEKALARENLATQSFSSARDAIAALQNGTPQVLVSDIRMPGASGLEL  63

Query  66   LGKVKNNYPDLPVIIMTAHSDLESAVSSYQTGAFEYLPKPFDIDEALALVNRAILHINKL  125
            L  VK  +P +PVII+TA SDL+SAVS++Q GAFEYL KPFD+D+A+ L+ RA+      
Sbjct  64   LQTVKAKHPGIPVIIITAFSDLDSAVSAFQGGAFEYLAKPFDVDKAVELIRRALDE----  119

Query  126  QQQEATKAASAAQSTEIIGESPAMQEVFRAIGRLSQSHITVLINGESGTGKELVAHALHK  185
              +E      AAQ+ EI+G++PAMQ+VFRAIGRLSQS++TVLI GESG+GKELVA ALHK
Sbjct  120  SLRETDIEQGAAQTPEILGQAPAMQDVFRAIGRLSQSNVTVLITGESGSGKELVARALHK  179

Query  186  HSPRSSKPFIALNMAAIPKDLIETELFGHEKGAFTGANTQRQGRFEQANGGTLFLDEIGD  245
            HSPR+S+PF+ALN AAIPKDL+E+ELFGHE+GAFTGA   R+GRFEQA GGTLFLDEIGD
Sbjct  180  HSPRASQPFVALNTAAIPKDLLESELFGHERGAFTGAQAMRRGRFEQAEGGTLFLDEIGD  239

Query  246  MPFETQTRLLRVLADGEFYRVGGHIPVKVDVRIVAATHQDLEKLVNEGRFREDLYHRLNV  305
            MP + QTRLLRVL+DG FYRVGGH  +K +VR++AATHQ+LE+ V EG FREDLYHRLNV
Sbjct  240  MPLDLQTRLLRVLSDGHFYRVGGHQSLKANVRVIAATHQNLEQRVREGLFREDLYHRLNV  299

Query  306  IRIHIPKLAHRSEDIPMLAQHFLARAGKELGVSPKILRTETTDYMQQLPWPGNVRQLENT  365
            IR+ +P L  RSEDIP+LA++FLA++ ++LGV  K L  +   ++ QL +PGNVRQLEN 
Sbjct  300  IRLRLPSLRERSEDIPILARYFLAQSARQLGVEAKRLSPQAMQFLSQLEFPGNVRQLENL  359

Query  366  CRWLTVMITGREVYPEDLPSELKQIPI-------QKSVDQTGTPP--------------S  404
            C W+TVM  G+ V  +DLP +L +  +        +     G  P              S
Sbjct  360  CNWITVMAPGQTVEIKDLPQDLVEERVHAPQPAQNRGCSGIGGSPSDGLYRACPGVASAS  419

Query  405  FDRISLHHWDELLGQWAIQKLKNGEMKILDIATPMFERTLINAALQQTRGRKRHAAELLG  464
             D  +   W  LL   A Q L + + +++DI    FE  LI  AL+ T GRK  AA  LG
Sbjct  420  ADGAAGASWITLLETEAAQMLASEQPEVMDILGRQFEAALIKVALKHTHGRKNDAAVRLG  479

Query  465  WGRNTLTRKLKELGI-SAEDD  484
             GRNT+TRK+++LGI  AEDD
Sbjct  480  IGRNTITRKIQKLGIGGAEDD  500


> Q44430 DNA-binding transcriptional regulator NtrC [Rhizobium 
radiobacter]
Length=483

 Score =  390 bits (1003),  Expect = 3e-133
 Identities = 211/479 (44%), Positives = 301/479 (63%), Gaps = 12/479 (3%)

Query  6    IWVIDDDRAMRWVLEKTFKEEGFDVTSFEEAQSALDQLLDDAPDVILTDIRMPGIDGLTF  65
            I V DDD A+R VL +     G+DV     A +    +     D+++TD+ MP  +    
Sbjct  5    ILVADDDAAIRTVLNQALSRAGYDVRITSNAATLWRWVSAGEGDLVVTDVVMPDENAFDL  64

Query  66   LGKVKNNYPDLPVIIMTAHSDLESAVSSYQTGAFEYLPKPFDIDEALALVNRAILHINKL  125
            L ++K   PDLPV++M+A +   +A+ + + GA++YLPKPFD+ E +A++ RA+   ++ 
Sbjct  65   LPRIKKARPDLPVLVMSAQNTFMTAIKASEKGAYDYLPKPFDLTELIAIIGRAL---SEP  121

Query  126  QQQEATKAASAAQSTEIIGESPAMQEVFRAIGRLSQSHITVLINGESGTGKELVAHALHK  185
            +++ A           ++G S AMQE++R + RL Q+ +T++I GESGTGKELVA ALH 
Sbjct  122  KRKPAKLDDDMQDGMPLVGRSAAMQEIYRVLARLMQTDLTLMITGESGTGKELVARALHD  181

Query  186  HSPRSSKPFIALNMAAIPKDLIETELFGHEKGAFTGANTQRQGRFEQANGGTLFLDEIGD  245
            +  R + PF+A+NMAAIP+DLIE+ELFGHEKGAFTGA  +  GRFEQA GGTLFLDEIGD
Sbjct  182  YGKRRNGPFVAINMAAIPRDLIESELFGHEKGAFTGAQNRSTGRFEQAEGGTLFLDEIGD  241

Query  246  MPFETQTRLLRVLADGEFYRVGGHIPVKVDVRIVAATHQDLEKLVNEGRFREDLYHRLNV  305
            MP + QTRLLRVL  GE+  VGG  P++ DVRIVAAT++DL++ +N+G FREDLY+RLNV
Sbjct  242  MPMDAQTRLLRVLQQGEYTTVGGRTPIRTDVRIVAATNKDLKQSINQGLFREDLYYRLNV  301

Query  306  IRIHIPKLAHRSEDIPMLAQHFLARAGKELGVSPKILRTETTDYMQQLPWPGNVRQLENT  365
            + + +P L  R+EDIP L +HF+    KE G+  K   TE  + M+   WPGNVR+LEN 
Sbjct  302  VPLRLPPLRDRAEDIPDLVRHFIQTGEKE-GLEGKRFETEALEVMKAYAWPGNVRELENL  360

Query  366  CRWLTVM----ITGREVYPEDLPSELKQIPIQKSVDQTGTPPSFDRISLHHWDELLGQWA  421
             R L  +    +  RE+  ++L S++   P+ K   +TG+      +     + +   +A
Sbjct  361  IRRLMALYPQEVITREIIEQELQSDVPDSPLDKMAVRTGSLTISQAVE----ENMRDYFA  416

Query  422  IQKLKNGEMKILDIATPMFERTLINAALQQTRGRKRHAAELLGWGRNTLTRKLKELGIS  480
                      + D      E  LI AAL  TRG +  AA+LLG  RNTL +K++ELG+S
Sbjct  417  SFGDGLPPPGLYDRVLRELEYPLILAALTATRGNQIKAADLLGLNRNTLRKKIRELGVS  475


> Q43912 DNA-binding transcriptional regulator NtrC [Azospirillum 
brasilense]
Length=481

 Score =  389 bits (1000),  Expect = 7e-133
 Identities = 218/480 (45%), Positives = 301/480 (63%), Gaps = 7/480 (1%)

Query  1    MSRNKIWVIDDDRAMRWVLEKTFKEEGFDVTSFEEAQSALDQLLDDAPDVILTDIRMPGI  60
            MS   I V DDDRA+R VL +     G +V +   A +    + D   D+I+TD+ MP  
Sbjct  1    MSARTILVADDDRAIRTVLTQALARLGHEVRTTGNASTLWRWVADGQGDLIITDVVMPDE  60

Query  61   DGLTFLGKVKNNYPDLPVIIMTAHSDLESAVSSYQTGAFEYLPKPFDIDEALALVNRAIL  120
            +GL  + ++K   PDL +I+M+A + L +AV + + GAFEYLPKPFD+ E +++V RA L
Sbjct  61   NGLDLIPRIKKIRPDLRIIVMSAQNTLITAVKAAERGAFEYLPKPFDLKELVSVVERA-L  119

Query  121  HINKLQQQEATKAASAAQSTEIIGESPAMQEVFRAIGRLSQSHITVLINGESGTGKELVA  180
            + N         A  A +   +IG SPAMQE++R + RL  + +TV I GESGTGKELVA
Sbjct  120  NSNTPPAALPADAGEADEQLPLIGRSPAMQEIYRVLARLMGTDLTVTITGESGTGKELVA  179

Query  181  HALHKHSPRSSKPFIALNMAAIPKDLIETELFGHEKGAFTGANTQRQGRFEQANGGTLFL  240
             ALH +  R + PF+A+NMAAIP++LIE+ELFGHEKGAFTGA  +  GRFEQA GGTLFL
Sbjct  180  RALHDYGKRRNGPFVAINMAAIPRELIESELFGHEKGAFTGATNRSTGRFEQAQGGTLFL  239

Query  241  DEIGDMPFETQTRLLRVLADGEFYRVGGHIPVKVDVRIVAATHQDLEKLVNEGRFREDLY  300
            DEIGDMP E QTRLLRVL +GE+  VGG  P+K DVRIVAATH+DL  L+ +G FREDL+
Sbjct  240  DEIGDMPLEAQTRLLRVLQEGEYTTVGGRTPIKTDVRIVAATHRDLRTLIRQGLFREDLF  299

Query  301  HRLNVIRIHIPKLAHRSEDIPMLAQHFLARAGKELGVSPKILRTETTDYMQQLPWPGNVR  360
            +RL V+ I +P L  R+ED+P+L +HFL +   + G+  K +     D +++  WPGNVR
Sbjct  300  YRLCVVPIRLPPLRERTEDVPLLVRHFLNQCSAQ-GLPVKSIDQPAMDRLKRYRWPGNVR  358

Query  361  QLENTCRWLTVMITGREVYPEDLPSELKQ-IPIQKSVDQTGTPPSFDRISLHHWDELLGQ  419
            +LEN  R L  + +   +  + + +EL    P  + V++    P  + +S      L   
Sbjct  359  ELENLVRRLAALYSQEVIGLDVVEAELADTTPAAQPVEE----PQGEGLSAAVERHLKDY  414

Query  420  WAIQKLKNGEMKILDIATPMFERTLINAALQQTRGRKRHAAELLGWGRNTLTRKLKELGI  479
            +A  K       + D      ER LI+ +L  TRG +  AA+LLG  RNTL +K+++L I
Sbjct  415  FAAHKDGMPSNGLYDRVLREVERPLISLSLSATRGNQIKAAQLLGLNRNTLRKKIRDLDI  474


> Q6REE4 DNA-binding transcriptional regulator NtrC [Azospirillum 
brasilense]
Length=481

 Score =  386 bits (991),  Expect = 2e-131
 Identities = 217/480 (45%), Positives = 300/480 (63%), Gaps = 7/480 (1%)

Query  1    MSRNKIWVIDDDRAMRWVLEKTFKEEGFDVTSFEEAQSALDQLLDDAPDVILTDIRMPGI  60
            MS   I V DDDRA+R VL +     G +V +   A +    + D   D+I+TD+ MP  
Sbjct  1    MSAATILVADDDRAIRTVLTQALARLGHEVRTTGNASTLWRWVADGQGDLIITDVVMPDE  60

Query  61   DGLTFLGKVKNNYPDLPVIIMTAHSDLESAVSSYQTGAFEYLPKPFDIDEALALVNRAIL  120
            +GL  + ++K   PDL +I+M+A + L +AV + + GAFEYLPKPFD+ E +++V RA L
Sbjct  61   NGLDLIPRIKKIRPDLRIIVMSAQNTLITAVKAAERGAFEYLPKPFDLKELVSVVERA-L  119

Query  121  HINKLQQQEATKAASAAQSTEIIGESPAMQEVFRAIGRLSQSHITVLINGESGTGKELVA  180
            + N         A  A +   +IG SPAMQE++R + RL  + +TV I GESGT KELVA
Sbjct  120  NSNTPPAALPADAGEADEQLPLIGRSPAMQEIYRVLARLMGTDLTVTITGESGTDKELVA  179

Query  181  HALHKHSPRSSKPFIALNMAAIPKDLIETELFGHEKGAFTGANTQRQGRFEQANGGTLFL  240
             ALH +  R + PF+A+NMAAIP++LIE+ELFGHEKGAFTGA  +  GRFEQA GGTLFL
Sbjct  180  RALHDYGKRRNGPFVAINMAAIPRELIESELFGHEKGAFTGATNRSTGRFEQAQGGTLFL  239

Query  241  DEIGDMPFETQTRLLRVLADGEFYRVGGHIPVKVDVRIVAATHQDLEKLVNEGRFREDLY  300
            DEIGDMP E QTRLLRVL +GE+  VGG  P+K DVRIVAATH+DL  L+ +G FREDL+
Sbjct  240  DEIGDMPLEAQTRLLRVLQEGEYTTVGGRTPIKTDVRIVAATHRDLRTLIRQGLFREDLF  299

Query  301  HRLNVIRIHIPKLAHRSEDIPMLAQHFLARAGKELGVSPKILRTETTDYMQQLPWPGNVR  360
            +RL V+ I +P L  R+ED+P+L +HFL +   + G+  K +     D +++  WPGNVR
Sbjct  300  YRLCVVPIRLPPLRERTEDVPLLVRHFLNQCSAQ-GLPVKSIDQPAMDRLKRYRWPGNVR  358

Query  361  QLENTCRWLTVMITGREVYPEDLPSELKQ-IPIQKSVDQTGTPPSFDRISLHHWDELLGQ  419
            +LEN  R L  + +   +  + + +EL    P  + V++    P  + +S      L   
Sbjct  359  ELENLVRRLAALYSQEVIGLDVVEAELADTTPAAQPVEE----PQGEGLSAAVERHLKDY  414

Query  420  WAIQKLKNGEMKILDIATPMFERTLINAALQQTRGRKRHAAELLGWGRNTLTRKLKELGI  479
            +A  K       + D      ER LI+ +L  TRG +  AA+LLG  RNTL +K+++L I
Sbjct  415  FAAHKDGMPSNGLYDRVLREVERPLISLSLSATRGNQIKAAQLLGLNRNTLRKKIRDLDI  474


> Q43898 DNA-binding transcriptional regulator NtrC [Azospirillum 
brasilense]
Length=480

 Score =  385 bits (990),  Expect = 2e-131
 Identities = 219/485 (45%), Positives = 302/485 (62%), Gaps = 18/485 (4%)

Query  1    MSRNKIWVIDDDRAMRWVLEKTFKEEGFDVTSFEEAQSALDQLLDDAPDVILTDIRMPGI  60
            MS   I V DDDRA+R VL +     G +V +   A +    + D   D+I+TD+ MP  
Sbjct  1    MSAATILVADDDRAIRTVLTQALARLGHEVRTTGNASTLWRWVADGQGDLIITDVVMPDE  60

Query  61   DGLTFLGKVKNNYPDLPVIIMTAHSDLESAVSSYQTGAFEYLPKPFDIDEALALVNRAIL  120
            +GL  + ++K   PDL +I+M+A + L +AV + + GAFEYLPKPFD+ E +++V RA L
Sbjct  61   NGLDLIPRIKKIRPDLRIIVMSAQNTLITAVKAAERGAFEYLPKPFDLKELVSVVERA-L  119

Query  121  HINKLQQQEATKAASAAQSTEIIGESPAMQEVFRAIGRLSQSHITVLINGESGTGKELVA  180
            + N  +++    A  A +   +IG SPAMQE++R + RL  +  TV I GESGTGKELVA
Sbjct  120  NSNTPRRRLPADAGEADEQLPLIGRSPAMQEIYRVLARLMGTDSTVTITGESGTGKELVA  179

Query  181  HALHKHSPRSSKPFIALNMAAIPKDLIETELFGHEKGAFTGANTQRQGRFEQANGGTLFL  240
             ALH +  R + PF+A+NMAAIP++LIE+ELFGHEKGAFTGA  +  GRFEQA GGTLFL
Sbjct  180  RALHDYGKRRNGPFVAINMAAIPRELIESELFGHEKGAFTGATNRSTGRFEQAQGGTLFL  239

Query  241  DEIGDMPFETQTRLLRVLADGEFYRVGGHIPVKVDVRIVAATHQDLEKLVNEGRFREDLY  300
            DEIGDMP E QTRLLRVL +GE+  VGG  P+K DVRIVAATH+DL  L+ +G FREDL+
Sbjct  240  DEIGDMPLEAQTRLLRVLQEGEYTTVGGRTPIKTDVRIVAATHRDLRTLIRQGLFREDLF  299

Query  301  HRLNVIRIHIPKLAHRSEDIPMLAQHFLARAGKELGVSPKILRTETTDYMQQLPWPGNVR  360
            +RL V+ I +P L  R+ED+P+L +HFL +   + G+  K +     D +++  WPGNVR
Sbjct  300  YRLCVVPIRLPPLRERTEDVPLLVRHFLNQCSAQ-GLPVKSIDQPAMDRLKRYRWPGNVR  358

Query  361  QLENTCRWLTVM----ITGREVYPEDLPSELKQIPIQKSVDQ--TGTPPSFDRISLHHWD  414
            +LEN  R L  +    + G +V   D+       P  + V++   G   + +R       
Sbjct  359  ELENLVRRLAALYSQEVIGLDVVEADVAD---TTPAAQPVEEPHRGLSAAVER-------  408

Query  415  ELLGQWAIQKLKNGEMKILDIATPMFERTLINAALQQTRGRKRHAAELLGWGRNTLTRKL  474
             L   +A  K       + D      ER LI+ +L  TRG +  AA+LLG  RNTL +K+
Sbjct  409  HLKDYFAAHKDGMPSNGLYDRVLREVERPLISLSLSATRGNQIKAAQLLGLNRNTLRKKI  468

Query  475  KELGI  479
            ++L I
Sbjct  469  RDLDI  473


> Q6REE5 DNA-binding transcriptional regulator NtrC [Azospirillum 
brasilense]
Length=481

 Score =  385 bits (990),  Expect = 2e-131
 Identities = 217/480 (45%), Positives = 300/480 (63%), Gaps = 7/480 (1%)

Query  1    MSRNKIWVIDDDRAMRWVLEKTFKEEGFDVTSFEEAQSALDQLLDDAPDVILTDIRMPGI  60
            MS   I V DDDRA+R VL +     G +V +   A +    + D   D+I+TD+ MP  
Sbjct  1    MSAATILVADDDRAIRTVLTQALARLGHEVRTTGNASTLWRWVADGQGDLIITDVVMPDE  60

Query  61   DGLTFLGKVKNNYPDLPVIIMTAHSDLESAVSSYQTGAFEYLPKPFDIDEALALVNRAIL  120
            +GL  + ++K   PDL +I+M+A + L +AV + + GAFEYLPKPFD+ E +++V RA L
Sbjct  61   NGLDLIPRIKKIRPDLRIIVMSAQNTLITAVKAAERGAFEYLPKPFDLKELVSVVERA-L  119

Query  121  HINKLQQQEATKAASAAQSTEIIGESPAMQEVFRAIGRLSQSHITVLINGESGTGKELVA  180
            + N         A  A +   +IG SPAMQE++R + RL  + +TV I GES TGKELVA
Sbjct  120  NSNTPPAALPADAGEADEQLPLIGRSPAMQEIYRVLARLMGTDLTVTITGESETGKELVA  179

Query  181  HALHKHSPRSSKPFIALNMAAIPKDLIETELFGHEKGAFTGANTQRQGRFEQANGGTLFL  240
             ALH +  R + PF+A+NMAAIP++LIE+ELFGHEKGAFTGA  +  GRFEQA GGTLFL
Sbjct  180  RALHDYGKRRNGPFVAINMAAIPRELIESELFGHEKGAFTGATNRSTGRFEQAQGGTLFL  239

Query  241  DEIGDMPFETQTRLLRVLADGEFYRVGGHIPVKVDVRIVAATHQDLEKLVNEGRFREDLY  300
            DEIGDMP E QTRLLRVL +GE+  VGG  P+K DVRIVAATH+DL  L+ +G FREDL+
Sbjct  240  DEIGDMPLEAQTRLLRVLQEGEYTTVGGRTPIKTDVRIVAATHRDLRTLIRQGLFREDLF  299

Query  301  HRLNVIRIHIPKLAHRSEDIPMLAQHFLARAGKELGVSPKILRTETTDYMQQLPWPGNVR  360
            +RL V+ I +P L  R+ED+P+L +HFL +   + G+  K +     D +++  WPGNVR
Sbjct  300  YRLCVVPIRLPPLRERTEDVPLLVRHFLNQCSAQ-GLPVKSIDQPAMDRLKRYRWPGNVR  358

Query  361  QLENTCRWLTVMITGREVYPEDLPSELKQ-IPIQKSVDQTGTPPSFDRISLHHWDELLGQ  419
            +LEN  R L  + +   +  + + +EL    P  + V++    P  + +S      L   
Sbjct  359  ELENLVRRLAALYSQEVIGLDVVEAELADTTPAAQPVEE----PQGEGLSAAVERHLKDY  414

Query  420  WAIQKLKNGEMKILDIATPMFERTLINAALQQTRGRKRHAAELLGWGRNTLTRKLKELGI  479
            +A  K       + D      ER LI+ +L  TRG +  AA+LLG  RNTL +K+++L I
Sbjct  415  FAAHKDGMPSNGLYDRVLREVERPLISLSLSATRGNQIKAAQLLGLNRNTLRKKIRDLDI  474


> Q53023 DNA-binding transcriptional regulator NtrC [Rhodospirillum 
rubrum]
Length=481

 Score =  384 bits (985),  Expect = 1e-130
 Identities = 212/478 (44%), Positives = 300/478 (63%), Gaps = 12/478 (3%)

Query  6    IWVIDDDRAMRWVLEKTFKEEGFDVTSFEEAQSALDQLLDDAPDVILTDIRMPGIDGLTF  65
            I V DDDR +R VL +     G +V S   A +    + D   D+++TD+ MP  +GL  
Sbjct  4    ILVADDDRGIRTVLSQALTRAGHEVRSTGTASTLWSWVTDGQGDLVITDVIMPDENGLDL  63

Query  66   LGKVKNNYPDLPVIIMTAHSDLESAVSSYQTGAFEYLPKPFDIDEALALVNRAILHINKL  125
            + ++K   PDL +++M+A + L +AV + + GAFEYLPKPFD+ E + +V RA L + + 
Sbjct  64   IPRIKKIRPDLRIVVMSAQNTLLTAVKATERGAFEYLPKPFDLTEVVNVVRRA-LSLPRG  122

Query  126  QQQEATKAASAAQSTEIIGESPAMQEVFRAIGRLSQSHITVLINGESGTGKELVAHALHK  185
               E   A+   +   +IG SPAMQE++R + RL  + +TV+INGESGTGKELVA ALH 
Sbjct  123  NPTEGDHASEEDERLPLIGRSPAMQEIYRTLARLMNTDLTVMINGESGTGKELVARALHD  182

Query  186  HSPRSSKPFIALNMAAIPKDLIETELFGHEKGAFTGANTQRQGRFEQANGGTLFLDEIGD  245
            +  R +  F+A+NM AIP++LIE+ELFGHEKGAFTGA+ +  GRFEQA+GGTLFLDEIGD
Sbjct  183  YGKRRNGSFVAVNMGAIPRELIESELFGHEKGAFTGAHARSAGRFEQADGGTLFLDEIGD  242

Query  246  MPFETQTRLLRVLADGEFYRVGGHIPVKVDVRIVAATHQDLEKLVNEGRFREDLYHRLNV  305
            MP E QTRLLRVL + E+  VGG   ++ +VRI+AATH+DL +L+++G FREDL++RLNV
Sbjct  243  MPLEAQTRLLRVLQESEYTTVGGRQTLRANVRIIAATHRDLRQLIHQGLFREDLFYRLNV  302

Query  306  IRIHIPKLAHRSEDIPMLAQHFLARAGKELGVSPKILRTETTDYMQQLPWPGNVRQLENT  365
            + + +P L  R EDIP L +HFL    +  G+ PK+L     + +++  W GNVR+LEN 
Sbjct  303  VPLRLPPLRERVEDIPELTRHFLHAVAEHDGLPPKVLEAPAMERLKKHRWSGNVRELENL  362

Query  366  CRWLTVM----ITGREVYPEDLPSELKQIPIQKSVDQTGTPPSFDRISLHHWDELLGQWA  421
             R L  +    + G EV   +L S    I  +      G     +R  L H+ E  G+ A
Sbjct  363  VRRLAALYSQEVIGVEVIEAELSSSAPPILDEGDESAEGLSTKVER-HLRHYFEAHGE-A  420

Query  422  IQKLKNGEMKILDIATPMFERTLINAALQQTRGRKRHAAELLGWGRNTLTRKLKELGI  479
            +      E    ++     ER LI+  L+ TRG +  AA+LLG  RNTL +K+++L I
Sbjct  421  LPPAGLHERISREV-----ERPLISLCLEATRGNQIKAAQLLGLNRNTLRKKIRDLDI  473


> O31412 DNA-binding transcriptional regulator NtrC [Brucella suis]
Length=466

 Score =  345 bits (885),  Expect = 7e-116
 Identities = 193/474 (41%), Positives = 279/474 (59%), Gaps = 22/474 (5%)

Query  6    IWVIDDDRAMRWVLEKTFKEEGFDVTSFEEAQSALDQLLDDAPDVILTDIRMPGIDGLTF  65
            + V DDD  +R VL +     G+DV     A S    +     D+++ D+ MP  +    
Sbjct  5    VLVADDDXPIRXVLNQALSRAGYDVRVTSNAASLWLWVAAGDGDLVINDVMMPDENAFDL  64

Query  66   LGKVKNNYPDLPVIIMTAHSDLESAVSSYQTGAFEYLPKPFDIDEALALVNRAILHINKL  125
            L ++K   PDLPV++M+A +   + + + + GA+EYLPK  D+ E + +V RA    ++ 
Sbjct  65   LPRIKKKPPDLPVVVMSAQNTFMTPIRASEEGAYEYLPKSHDLTELINIVGRAF---SEP  121

Query  126  QQQEATKAASAAQSTEIIGESPAMQEVFRAIGRLSQSHITVLINGESGTGKELVAHALHK  185
            +Q+ A       ++  ++G   AMQE++R + R+ Q+ +TV++ GESGTGKELVA ALH+
Sbjct  122  RQKPAALPDEQGENMPLVGRFAAMQEIYRLLARMMQTDLTVMVTGESGTGKELVARALHE  181

Query  186  HSPRSSKPFIALNMAAIPKDLIETELFGHEKGAFTGANTQRQGRFEQANGGTLFLDEIGD  245
            +  R   PF+A+NMAAIP+DLIE+ELFG+EKG FTGA  +  G    +  GTLFLDEIGD
Sbjct  182  YGRRRKGPFVAINMAAIPRDLIESELFGYEKGVFTGAQNRSSGSLWASQRGTLFLDEIGD  241

Query  246  MPFETQTRLLRVLADGEFYRVGGHIPVKVDVRIVAATHQDLEKLVNEGRFREDLYHRLNV  305
            MP E QTRLLRVL  GE+  VGG  P+K DVRIVAAT++DL +++ +G FREDLY+RLNV
Sbjct  242  MPMEAQTRLLRVLQQGEYMTVGGRTPIKTDVRIVAATNRDLRQIIAQGLFREDLYYRLNV  301

Query  306  IRIHIPKLAHRSEDIPMLAQHFLARAGKELGVSPKILRTETTDYMQQLPWPGNVRQLENT  365
            + + +P L  RSED+P L +HF+    +E G+  K +     + M++ PWPGNVR+LEN 
Sbjct  302  VPLRLPPLRERSEDVPDLVRHFIQTRCEE-GLPEKRITNAGLEMMRRYPWPGNVRKLENL  360

Query  366  CRWLTVMITGREVYPEDLPSELKQIPIQKSVDQTGTPPSFDRISLHHWDELLGQWAIQKL  425
             R L  +    ++ PE + +EL Q  + K        P F   +    + ++ Q   Q +
Sbjct  361  VRRLAALYPQEKIAPEIIKTEL-QAXLAK--------PDFVAAAGGEMENIISQAVEQNM  411

Query  426  KNGEMKI-LDIATP--------MFERTLINAALQQTRGRKRHAAELLGWGRNTL  470
            +        D+  P          E  LI A L  TRG +  AA+LLG  RNTL
Sbjct  412  QRYFASFGSDLPPPGLYXRFLAXLEYPLILACLTATRGNQIKAADLLGLNRNTL  465



Lambda      K        H        a         alpha
   0.319    0.136    0.396    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4713160


  Database: ed09eb68441ed5288bf3ed2bfc655f5f.TrEMBL.fasta
    Posted date:  Sep 28, 2020  3:11 PM
  Number of letters in database: 12,210
  Number of sequences in database:  25



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40