ACIAD1368 / SwissProt Alignments

BLASTP 2.2.28+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: f7e8667bfc76dc44b7478e390ec393d2.SwissProt.fasta
           13 sequences; 6,058 total letters



Query= ACIAD1368

Length=492
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  P0AFB9 DNA-binding transcriptional regulator NtrC [Escherichia ...   608    0.0   
  P0AFB8 DNA-binding transcriptional regulator NtrC [Escherichia ...   608    0.0   
  P03029 DNA-binding transcriptional regulator NtrC [Klebsiella p...   608    0.0   
  P41789 DNA-binding transcriptional regulator NtrC [Salmonella t...   607    0.0   
  P28787 DNA-binding transcriptional regulator NtrC [Proteus haus...   594    0.0   
  P10577 DNA-binding transcriptional regulator NtrC [Rhizobium me...   398    2e-136
  P45671 DNA-binding transcriptional regulator NtrC [Azospirillum...   389    7e-133
  Q04848 DNA-binding transcriptional regulator NtrC [Azorhizobium...   385    2e-131
  P10576 DNA-binding transcriptional regulator NtrC [Bradyrhizobi...   374    3e-127
  Q06065 Regulatory protein AtoC [Escherichia coli (strain K12)]       348    3e-117
  P14375 Transcriptional regulatory protein ZraR [Escherichia col...   342    2e-115
  Q8X613 Transcriptional regulatory protein ZraR [Escherichia col...   338    8e-114
  P25852 Transcriptional regulatory protein ZraR [Salmonella typh...   330    8e-111


> P0AFB9 DNA-binding transcriptional regulator NtrC [Escherichia 
coli O157:H7]
Length=469

 Score =  608 bits (1569),  Expect = 0.0
 Identities = 307/479 (64%), Positives = 366/479 (76%), Gaps = 11/479 (2%)

Query  1    MSRNKIWVIDDDRAMRWVLEKTFKEEGFDVTSFEEAQSALDQLLDDAPDVILTDIRMPGI  60
            M R  +WV+DDD ++RWVLE+     G   T+FE     L+ L    PDV+L+DIRMPG+
Sbjct  1    MQRGIVWVVDDDSSIRWVLERALAGAGLTCTTFENGAEVLEALASKTPDVLLSDIRMPGM  60

Query  61   DGLTFLGKVKNNYPDLPVIIMTAHSDLESAVSSYQTGAFEYLPKPFDIDEALALVNRAIL  120
            DGL  L ++K  +P LPVIIMTAHSDL++AVS+YQ GAF+YLPKPFDIDEA+ALV RAI 
Sbjct  61   DGLALLKQIKQRHPMLPVIIMTAHSDLDAAVSAYQQGAFDYLPKPFDIDEAVALVERAIS  120

Query  121  HINKLQQQEATKAASAAQSTEIIGESPAMQEVFRAIGRLSQSHITVLINGESGTGKELVA  180
            H    +QQ+         +T+IIGE+PAMQ+VFR IGRLS+S I+VLINGESGTGKELVA
Sbjct  121  HYQ--EQQQPRNVQLNGPTTDIIGEAPAMQDVFRIIGRLSRSSISVLINGESGTGKELVA  178

Query  181  HALHKHSPRSSKPFIALNMAAIPKDLIETELFGHEKGAFTGANTQRQGRFEQANGGTLFL  240
            HALH+HSPR+  PFIALNMAAIPKDLIE+ELFGHEKGAFTGANT RQGRFEQA+GGTLFL
Sbjct  179  HALHRHSPRAKAPFIALNMAAIPKDLIESELFGHEKGAFTGANTIRQGRFEQADGGTLFL  238

Query  241  DEIGDMPFETQTRLLRVLADGEFYRVGGHIPVKVDVRIVAATHQDLEKLVNEGRFREDLY  300
            DEIGDMP + QTRLLRVLADG+FYRVGG+ PVKVDVRI+AATHQ+LE+ V EG+FREDL+
Sbjct  239  DEIGDMPLDVQTRLLRVLADGQFYRVGGYAPVKVDVRIIAATHQNLEQRVQEGKFREDLF  298

Query  301  HRLNVIRIHIPKLAHRSEDIPMLAQHFLARAGKELGVSPKILRTETTDYMQQLPWPGNVR  360
            HRLNVIR+H+P L  R EDIP LA+HFL  A +ELGV  K+L  ET   + +L WPGNVR
Sbjct  299  HRLNVIRVHLPPLRERREDIPRLARHFLQVAARELGVEAKLLHPETEAALTRLAWPGNVR  358

Query  361  QLENTCRWLTVMITGREVYPEDLPSELKQIPIQKSVDQTGTPPSFDRISLHHWDELLGQW  420
            QLENTCRWLTVM  G+EV  +DLP EL +  + +S  Q   P S        W  LL QW
Sbjct  359  QLENTCRWLTVMAAGQEVLIQDLPGELFESTVAESTSQM-QPDS--------WATLLAQW  409

Query  421  AIQKLKNGEMKILDIATPMFERTLINAALQQTRGRKRHAAELLGWGRNTLTRKLKELGI  479
            A + L++G   +L  A P  ERTL+  AL+ T+G K+ AA LLGWGRNTLTRKLKELG+
Sbjct  410  ADRALRSGHQNLLSEAQPELERTLLTTALRHTQGHKQEAARLLGWGRNTLTRKLKELGM  468


> P0AFB8 DNA-binding transcriptional regulator NtrC [Escherichia 
coli (strain K12)]
Length=469

 Score =  608 bits (1569),  Expect = 0.0
 Identities = 307/479 (64%), Positives = 366/479 (76%), Gaps = 11/479 (2%)

Query  1    MSRNKIWVIDDDRAMRWVLEKTFKEEGFDVTSFEEAQSALDQLLDDAPDVILTDIRMPGI  60
            M R  +WV+DDD ++RWVLE+     G   T+FE     L+ L    PDV+L+DIRMPG+
Sbjct  1    MQRGIVWVVDDDSSIRWVLERALAGAGLTCTTFENGAEVLEALASKTPDVLLSDIRMPGM  60

Query  61   DGLTFLGKVKNNYPDLPVIIMTAHSDLESAVSSYQTGAFEYLPKPFDIDEALALVNRAIL  120
            DGL  L ++K  +P LPVIIMTAHSDL++AVS+YQ GAF+YLPKPFDIDEA+ALV RAI 
Sbjct  61   DGLALLKQIKQRHPMLPVIIMTAHSDLDAAVSAYQQGAFDYLPKPFDIDEAVALVERAIS  120

Query  121  HINKLQQQEATKAASAAQSTEIIGESPAMQEVFRAIGRLSQSHITVLINGESGTGKELVA  180
            H    +QQ+         +T+IIGE+PAMQ+VFR IGRLS+S I+VLINGESGTGKELVA
Sbjct  121  HYQ--EQQQPRNVQLNGPTTDIIGEAPAMQDVFRIIGRLSRSSISVLINGESGTGKELVA  178

Query  181  HALHKHSPRSSKPFIALNMAAIPKDLIETELFGHEKGAFTGANTQRQGRFEQANGGTLFL  240
            HALH+HSPR+  PFIALNMAAIPKDLIE+ELFGHEKGAFTGANT RQGRFEQA+GGTLFL
Sbjct  179  HALHRHSPRAKAPFIALNMAAIPKDLIESELFGHEKGAFTGANTIRQGRFEQADGGTLFL  238

Query  241  DEIGDMPFETQTRLLRVLADGEFYRVGGHIPVKVDVRIVAATHQDLEKLVNEGRFREDLY  300
            DEIGDMP + QTRLLRVLADG+FYRVGG+ PVKVDVRI+AATHQ+LE+ V EG+FREDL+
Sbjct  239  DEIGDMPLDVQTRLLRVLADGQFYRVGGYAPVKVDVRIIAATHQNLEQRVQEGKFREDLF  298

Query  301  HRLNVIRIHIPKLAHRSEDIPMLAQHFLARAGKELGVSPKILRTETTDYMQQLPWPGNVR  360
            HRLNVIR+H+P L  R EDIP LA+HFL  A +ELGV  K+L  ET   + +L WPGNVR
Sbjct  299  HRLNVIRVHLPPLRERREDIPRLARHFLQVAARELGVEAKLLHPETEAALTRLAWPGNVR  358

Query  361  QLENTCRWLTVMITGREVYPEDLPSELKQIPIQKSVDQTGTPPSFDRISLHHWDELLGQW  420
            QLENTCRWLTVM  G+EV  +DLP EL +  + +S  Q   P S        W  LL QW
Sbjct  359  QLENTCRWLTVMAAGQEVLIQDLPGELFESTVAESTSQM-QPDS--------WATLLAQW  409

Query  421  AIQKLKNGEMKILDIATPMFERTLINAALQQTRGRKRHAAELLGWGRNTLTRKLKELGI  479
            A + L++G   +L  A P  ERTL+  AL+ T+G K+ AA LLGWGRNTLTRKLKELG+
Sbjct  410  ADRALRSGHQNLLSEAQPELERTLLTTALRHTQGHKQEAARLLGWGRNTLTRKLKELGM  468


> P03029 DNA-binding transcriptional regulator NtrC [Klebsiella 
pneumoniae]
Length=469

 Score =  608 bits (1569),  Expect = 0.0
 Identities = 307/479 (64%), Positives = 366/479 (76%), Gaps = 11/479 (2%)

Query  1    MSRNKIWVIDDDRAMRWVLEKTFKEEGFDVTSFEEAQSALDQLLDDAPDVILTDIRMPGI  60
            M R   W++DDD ++RWVLE+     G   T+FE     LD L    PDV+L+DIRMPG+
Sbjct  1    MQRGIAWIVDDDSSIRWVLERALTGAGLSCTTFESGNEVLDALTTKTPDVLLSDIRMPGM  60

Query  61   DGLTFLGKVKNNYPDLPVIIMTAHSDLESAVSSYQTGAFEYLPKPFDIDEALALVNRAIL  120
            DGL  L ++K  +P LPVIIMTAHSDL++AVS+YQ GAF+YLPKPFDIDEA+ALV+RAI 
Sbjct  61   DGLALLKQIKQRHPMLPVIIMTAHSDLDAAVSAYQQGAFDYLPKPFDIDEAVALVDRAIS  120

Query  121  HINKLQQQEATKAASAAQSTEIIGESPAMQEVFRAIGRLSQSHITVLINGESGTGKELVA  180
            H    +QQ+   A   + + +IIGE+PAMQ+VFR IGRLS+S I+VLINGESGTGKELVA
Sbjct  121  HYQ--EQQQPRNAPINSPTADIIGEAPAMQDVFRIIGRLSRSSISVLINGESGTGKELVA  178

Query  181  HALHKHSPRSSKPFIALNMAAIPKDLIETELFGHEKGAFTGANTQRQGRFEQANGGTLFL  240
            HALH+HSPR+  PFIALNMAAIPKDLIE+ELFGHEKGAFTGANT RQGRFEQA+GGTLFL
Sbjct  179  HALHRHSPRAKAPFIALNMAAIPKDLIESELFGHEKGAFTGANTVRQGRFEQADGGTLFL  238

Query  241  DEIGDMPFETQTRLLRVLADGEFYRVGGHIPVKVDVRIVAATHQDLEKLVNEGRFREDLY  300
            DEIGDMP + QTRLLRVLADG+FYRVGG+ PVKVDVRI+AATHQ+LE  V EG+FREDL+
Sbjct  239  DEIGDMPLDVQTRLLRVLADGQFYRVGGYAPVKVDVRIIAATHQNLELRVQEGKFREDLF  298

Query  301  HRLNVIRIHIPKLAHRSEDIPMLAQHFLARAGKELGVSPKILRTETTDYMQQLPWPGNVR  360
            HRLNVIR+H+P L  R EDIP LA+HFL  A +ELGV  K L  ET   + +L WPGNVR
Sbjct  299  HRLNVIRVHLPPLRERREDIPRLARHFLQIAARELGVEAKQLHPETEMALTRLAWPGNVR  358

Query  361  QLENTCRWLTVMITGREVYPEDLPSELKQIPIQKSVDQTGTPPSFDRISLHHWDELLGQW  420
            QLENTCRWLTVM  G+EV  +DLPSEL          +T  P +  ++    W  LLGQW
Sbjct  359  QLENTCRWLTVMAAGQEVLTQDLPSEL---------FETAIPDNPTQMLPDSWATLLGQW  409

Query  421  AIQKLKNGEMKILDIATPMFERTLINAALQQTRGRKRHAAELLGWGRNTLTRKLKELGI  479
            A + L++G   +L  A P  ERTL+  AL+ T+G K+ AA LLGWGRNTLTRKLKELG+
Sbjct  410  ADRALRSGHQNLLSEAQPEMERTLLTTALRHTQGHKQEAARLLGWGRNTLTRKLKELGM  468


> P41789 DNA-binding transcriptional regulator NtrC [Salmonella 
typhimurium (strain LT2 / SGSC1412 / ATCC 700720)]
Length=469

 Score =  607 bits (1566),  Expect = 0.0
 Identities = 306/479 (64%), Positives = 363/479 (76%), Gaps = 11/479 (2%)

Query  1    MSRNKIWVIDDDRAMRWVLEKTFKEEGFDVTSFEEAQSALDQLLDDAPDVILTDIRMPGI  60
            M R  +WV+DDD ++RWVLE+     G   T+FE     L  L    PDV+L+DIRMPG+
Sbjct  1    MQRGIVWVVDDDSSIRWVLERALAGAGLTCTTFENGNEVLAALASKTPDVLLSDIRMPGM  60

Query  61   DGLTFLGKVKNNYPDLPVIIMTAHSDLESAVSSYQTGAFEYLPKPFDIDEALALVNRAIL  120
            DGL  L ++K  +P LPVIIMTAHSDL++AVS+YQ GAF+YLPKPFDIDEA+ALV RAI 
Sbjct  61   DGLALLKQIKQRHPMLPVIIMTAHSDLDAAVSAYQQGAFDYLPKPFDIDEAVALVERAIS  120

Query  121  HINKLQQQEATKAASAAQSTEIIGESPAMQEVFRAIGRLSQSHITVLINGESGTGKELVA  180
            H    +QQ+         +T++IGE+PAMQ+VFR IGRLS+S I+VLINGESGTGKELVA
Sbjct  121  HYQ--EQQQPRNIEVNGPTTDMIGEAPAMQDVFRIIGRLSRSSISVLINGESGTGKELVA  178

Query  181  HALHKHSPRSSKPFIALNMAAIPKDLIETELFGHEKGAFTGANTQRQGRFEQANGGTLFL  240
            HALH+HSPR+  PFIALNMAAIPKDLIE+ELFGHEKGAFTGANT RQGRFEQA+GGTLFL
Sbjct  179  HALHRHSPRAKAPFIALNMAAIPKDLIESELFGHEKGAFTGANTIRQGRFEQADGGTLFL  238

Query  241  DEIGDMPFETQTRLLRVLADGEFYRVGGHIPVKVDVRIVAATHQDLEKLVNEGRFREDLY  300
            DEIGDMP + QTRLLRVLADG+FYRVGG+ PVKVDVRI+AATHQ+LE+ V EG+FREDL+
Sbjct  239  DEIGDMPLDVQTRLLRVLADGQFYRVGGYAPVKVDVRIIAATHQNLERRVQEGKFREDLF  298

Query  301  HRLNVIRIHIPKLAHRSEDIPMLAQHFLARAGKELGVSPKILRTETTDYMQQLPWPGNVR  360
            HRLNVIRIH+P L  R EDIP LA+HFL  A +ELGV  K+L  ET   + +L WPGNVR
Sbjct  299  HRLNVIRIHLPPLRERREDIPRLARHFLQVAARELGVEAKLLHPETETALTRLAWPGNVR  358

Query  361  QLENTCRWLTVMITGREVYPEDLPSELKQIPIQKSVDQTGTPPSFDRISLHHWDELLGQW  420
            QLENTCRWLTVM  G+EV  +DLP EL          +  TP S   +    W  LL QW
Sbjct  359  QLENTCRWLTVMAAGQEVLIQDLPGEL---------FEASTPDSPSHLPPDSWATLLAQW  409

Query  421  AIQKLKNGEMKILDIATPMFERTLINAALQQTRGRKRHAAELLGWGRNTLTRKLKELGI  479
            A + L++G   +L  A P  ERTL+  AL+ T+G K+ AA LLGWGRNTLTRKLKELG+
Sbjct  410  ADRALRSGHQNLLSEAQPELERTLLTTALRHTQGHKQEAARLLGWGRNTLTRKLKELGM  468


> P28787 DNA-binding transcriptional regulator NtrC [Proteus hauseri]
Length=473

 Score =  594 bits (1531),  Expect = 0.0
 Identities = 300/480 (63%), Positives = 368/480 (77%), Gaps = 11/480 (2%)

Query  1    MSRNKIWVIDDDRAMRWVLEKTFKEEGFDVTSFEEAQSALDQLLDDAPDVILTDIRMPGI  60
            M +  +WV+DDD ++RWVLE+    EG    +FE A   L  L  + PDV+L+DIRMP +
Sbjct  1    MQKGNVWVVDDDSSIRWVLERAITREGMLCRAFEHANDVLKALNSEQPDVLLSDIRMPDM  60

Query  61   DGLTFLGKVKNNYPDLPVIIMTAHSDLESAVSSYQTGAFEYLPKPFDIDEALALVNRAIL  120
            DGL+ L  +K  YP LPVIIMTAHSDL++AV++YQ GAF+YLPKPFDIDE LAL+ RAI 
Sbjct  61   DGLSLLKIIKEQYPTLPVIIMTAHSDLDAAVNAYQQGAFDYLPKPFDIDETLALIERAIT  120

Query  121  HINKLQQQEATKAASAAQS-TEIIGESPAMQEVFRAIGRLSQSHITVLINGESGTGKELV  179
            H    +Q++   A +  QS +++IGE+PAMQEV+R IGRLS+S I+VLINGESGTGKELV
Sbjct  121  HYR--EQKQPNNAENILQSVSDMIGEAPAMQEVYRIIGRLSRSSISVLINGESGTGKELV  178

Query  180  AHALHKHSPRSSKPFIALNMAAIPKDLIETELFGHEKGAFTGANTQRQGRFEQANGGTLF  239
            AHALH+HSPR+  PFIALNMAAIPKDLIE+ELFGHEKGAFTGA+  RQGRFEQANGG+LF
Sbjct  179  AHALHRHSPRALAPFIALNMAAIPKDLIESELFGHEKGAFTGASQVRQGRFEQANGGSLF  238

Query  240  LDEIGDMPFETQTRLLRVLADGEFYRVGGHIPVKVDVRIVAATHQDLEKLVNEGRFREDL  299
            LDEIGDMP + QTRLLRVLA+G+FYRVGG+ PVKVDVRI+AATHQDLEK VNEG FREDL
Sbjct  239  LDEIGDMPLDIQTRLLRVLAEGQFYRVGGYAPVKVDVRIIAATHQDLEKRVNEGDFREDL  298

Query  300  YHRLNVIRIHIPKLAHRSEDIPMLAQHFLARAGKELGVSPKILRTETTDYMQQLPWPGNV  359
            YHRLNVIRI +P L  R+EDIP LA++FL +  KELGV  K L  ++   M +  W GNV
Sbjct  299  YHRLNVIRIQLPPLRDRTEDIPSLARYFLQKTAKELGVETKSLHEQSLKTMMEYVWSGNV  358

Query  360  RQLENTCRWLTVMITGREVYPEDLPSELKQIPIQKSVDQTGTPPSFDRISLHHWDELLGQ  419
            RQLEN CRWLTVM   +E+ P+DLPSE++ +  +K+        + +R++  HW + L  
Sbjct  359  RQLENVCRWLTVMTASQEIMPQDLPSEIR-LADEKA-------KNINRLTSQHWSQHLSL  410

Query  420  WAIQKLKNGEMKILDIATPMFERTLINAALQQTRGRKRHAAELLGWGRNTLTRKLKELGI  479
            WA + L  G+  IL+ A P FERTL+ +AL  T+G K+ AA LLGWGRNTLTRKLKELGI
Sbjct  411  WADEALGEGKENILNDALPQFERTLLLSALAYTQGHKQDAARLLGWGRNTLTRKLKELGI  470


> P10577 DNA-binding transcriptional regulator NtrC [Rhizobium 
meliloti (strain 1021)]
Length=484

 Score =  398 bits (1022),  Expect = 2e-136
 Identities = 217/485 (45%), Positives = 309/485 (64%), Gaps = 14/485 (3%)

Query  1    MSRNKIWVIDDDRAMRWVLEKTFKEEGFDVTSFEEAQSALDQLLDDAPDVILTDIRMPGI  60
            M+   I V DDD A+R VL +     G+DV     A +    +     D+++TD+ MP  
Sbjct  1    MTGATILVADDDAAIRTVLNQALSRAGYDVRITSNAATLWRWIAAGDGDLVVTDVVMPDE  60

Query  61   DGLTFLGKVKNNYPDLPVIIMTAHSDLESAVSSYQTGAFEYLPKPFDIDEALALVNRAIL  120
            +    L ++K   PDLPV++M+A +   +A+ + + GA++YLPKPFD+ E + ++ RA+ 
Sbjct  61   NAFDLLPRIKKARPDLPVLVMSAQNTFMTAIKASEKGAYDYLPKPFDLTELIGIIGRALA  120

Query  121  HINKLQQQEATKAASAAQS-TEIIGESPAMQEVFRAIGRLSQSHITVLINGESGTGKELV  179
                  ++  +K    +Q    ++G S AMQE++R + RL Q+ +T++I GESGTGKELV
Sbjct  121  E----PKRRPSKLEDDSQDGMPLVGRSAAMQEIYRVLARLMQTDLTLMITGESGTGKELV  176

Query  180  AHALHKHSPRSSKPFIALNMAAIPKDLIETELFGHEKGAFTGANTQRQGRFEQANGGTLF  239
            A ALH +  R + PF+A+NMAAIP+DLIE+ELFGHEKGAFTGA T+  GRFEQA GGTLF
Sbjct  177  ARALHDYGKRRNGPFVAINMAAIPRDLIESELFGHEKGAFTGAQTRSTGRFEQAEGGTLF  236

Query  240  LDEIGDMPFETQTRLLRVLADGEFYRVGGHIPVKVDVRIVAATHQDLEKLVNEGRFREDL  299
            LDEIGDMP + QTRLLRVL  GE+  VGG  P++ DVRIVAAT++DL++ +N+G FREDL
Sbjct  237  LDEIGDMPMDAQTRLLRVLQQGEYTTVGGRTPIRSDVRIVAATNKDLKQSINQGLFREDL  296

Query  300  YHRLNVIRIHIPKLAHRSEDIPMLAQHFLARAGKELGVSPKILRTETTDYMQQLPWPGNV  359
            Y+RLNV+ + +P L  R+EDIP L +HF+ +A KE G+  K    E  + M+  PWPGNV
Sbjct  297  YYRLNVVPLRLPPLRDRAEDIPDLVRHFVQQAEKE-GLDVKRFDQEALELMKAHPWPGNV  355

Query  360  RQLENTCRWLTVM----ITGREVYPEDLPSELKQIPIQKSVDQTGTPPSFDRISLHHWDE  415
            R+LEN  R LT +    +  RE+   +L SE+   PI+K+  ++G+  S  +    +  +
Sbjct  356  RELENLVRRLTALYPQDVITREIIENELRSEIPDSPIEKAAARSGS-LSISQAVEENMRQ  414

Query  416  LLGQWAIQKLKNGEMKILDIATPMFERTLINAALQQTRGRKRHAAELLGWGRNTLTRKLK  475
                +      +G   + D      E  LI AAL  TRG +  AA+LLG  RNTL +K++
Sbjct  415  YFASFGDALPPSG---LYDRVLAEMEYPLILAALTATRGNQIKAADLLGLNRNTLRKKIR  471

Query  476  ELGIS  480
            ELG+S
Sbjct  472  ELGVS  476


> P45671 DNA-binding transcriptional regulator NtrC [Azospirillum 
brasilense]
Length=481

 Score =  389 bits (998),  Expect = 7e-133
 Identities = 218/480 (45%), Positives = 301/480 (63%), Gaps = 7/480 (1%)

Query  1    MSRNKIWVIDDDRAMRWVLEKTFKEEGFDVTSFEEAQSALDQLLDDAPDVILTDIRMPGI  60
            MS   I V DDDRA+R VL +     G +V +   A +    + D   D+I+TD+ MP  
Sbjct  1    MSAATILVADDDRAIRTVLTQALARLGHEVRTTGNASTLWRWVADGQGDLIITDVVMPDE  60

Query  61   DGLTFLGKVKNNYPDLPVIIMTAHSDLESAVSSYQTGAFEYLPKPFDIDEALALVNRAIL  120
            +GL  + ++K   PDL +I+M+A + L +AV + + GAFEYLPKPFD+ E +++V RA L
Sbjct  61   NGLDLIPRIKKIRPDLRIIVMSAQNTLITAVKAAERGAFEYLPKPFDLKELVSVVERA-L  119

Query  121  HINKLQQQEATKAASAAQSTEIIGESPAMQEVFRAIGRLSQSHITVLINGESGTGKELVA  180
            + N         A  A +   +IG SPAMQE++R + RL  + +TV I GESGTGKELVA
Sbjct  120  NSNTPPAALPADAGEADEQLPLIGRSPAMQEIYRVLARLMGTDLTVTITGESGTGKELVA  179

Query  181  HALHKHSPRSSKPFIALNMAAIPKDLIETELFGHEKGAFTGANTQRQGRFEQANGGTLFL  240
             ALH +  R + PF+A+NMAAIP++LIE+ELFGHEKGAFTGA  +  GRFEQA GGTLFL
Sbjct  180  RALHDYGKRRNGPFVAINMAAIPRELIESELFGHEKGAFTGATNRSTGRFEQAQGGTLFL  239

Query  241  DEIGDMPFETQTRLLRVLADGEFYRVGGHIPVKVDVRIVAATHQDLEKLVNEGRFREDLY  300
            DEIGDMP E QTRLLRVL +GE+  VGG  P+K DVRIVAATH+DL  L+ +G FREDL+
Sbjct  240  DEIGDMPLEAQTRLLRVLQEGEYTTVGGRTPIKTDVRIVAATHRDLRTLIRQGLFREDLF  299

Query  301  HRLNVIRIHIPKLAHRSEDIPMLAQHFLARAGKELGVSPKILRTETTDYMQQLPWPGNVR  360
            +RL V+ I +P L  R+ED+P+L +HFL +   + G+  K +     D +++  WPGNVR
Sbjct  300  YRLCVVPIRLPPLRERTEDVPLLVRHFLNQCSAQ-GLPVKSIDQPAMDRLKRYRWPGNVR  358

Query  361  QLENTCRWLTVMITGREVYPEDLPSELKQ-IPIQKSVDQTGTPPSFDRISLHHWDELLGQ  419
            +LEN  R L  + +   +  + + +EL    P  + V++    P  + +S      L   
Sbjct  359  ELENLVRRLAALYSQEVIGLDVVEAELADTTPAAQPVEE----PQGEGLSAAVERHLKDY  414

Query  420  WAIQKLKNGEMKILDIATPMFERTLINAALQQTRGRKRHAAELLGWGRNTLTRKLKELGI  479
            +A  K       + D      ER LI+ +L  TRG +  AA+LLG  RNTL +K+++L I
Sbjct  415  FAAHKDGMPSNGLYDRVLREVERPLISLSLSATRGNQIKAAQLLGLNRNTLRKKIRDLDI  474


> Q04848 DNA-binding transcriptional regulator NtrC [Azorhizobium 
caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 
14845 / NCIMB 13405 / ORS 571)]
Length=480

 Score =  385 bits (988),  Expect = 2e-131
 Identities = 213/489 (44%), Positives = 302/489 (62%), Gaps = 26/489 (5%)

Query  1    MSRNKIWVIDDDRAMRWVLEKTFKEEGFDVTSFEEAQSALDQLLDDAPDVILTDIRMPGI  60
            M    I V DDD A+R VL +     G++V S   A +    +     D+++TD+ MP  
Sbjct  1    MPTGSILVADDDAAIRTVLNQALSRAGYEVRSCGNAATLWRWVSQGDGDLVITDVVMPDE  60

Query  61   DGLTFLGKVKNNYPDLPVIIMTAHSDLESAVSSYQTGAFEYLPKPFDIDEALALVNRAIL  120
            +    L ++K   PDLPVI+M+A +   +A+ + + GA+EYLPKPFD+ E +++V RA+ 
Sbjct  61   NAFDLLPRIKKARPDLPVIVMSAQNTFMTAIRASERGAYEYLPKPFDLKELISIVGRALA  120

Query  121  HINKLQQQEATKAASAAQSTEIIGESPAMQEVFRAIGRLSQSHITVLINGESGTGKELVA  180
               K ++      +   ++  ++G S AMQE++R + RL Q+ +TV+I GESGTGKELVA
Sbjct  121  EPKKAEK--LALGSDEQENIPLVGRSAAMQEIYRLLARLMQTDLTVMIAGESGTGKELVA  178

Query  181  HALHKHSPRSSKPFIALNMAAIPKDLIETELFGHEKGAFTGANTQRQGRFEQANGGTLFL  240
             ALH +  R + PF+A+NMAAIP+DLIE+ELFGHEKG+FTGA T+  GRFEQA GGTLFL
Sbjct  179  RALHDYGKRRNGPFVAINMAAIPRDLIESELFGHEKGSFTGATTRNAGRFEQAEGGTLFL  238

Query  241  DEIGDMPFETQTRLLRVLADGEFYRVGGHIPVKVDVRIVAATHQDLEKLVNEGRFREDLY  300
            DEIGDMP E QTRLLRVL  GE+  VGG  P+K DVRI+AAT++DL  L+ +G FREDL+
Sbjct  239  DEIGDMPMEAQTRLLRVLQQGEYTTVGGRTPIKTDVRIIAATNKDLRTLIQQGLFREDLF  298

Query  301  HRLNVIRIHIPKLAHRSEDIPMLAQHFLARAGKELGVSPKILRTETTDYMQQLPWPGNVR  360
             RLNV+ + +P L  RSED+P L +HF  +A +E G+  K + +   D +++  WPGNVR
Sbjct  299  FRLNVVPLRLPPLRERSEDVPDLVRHFFLQAERE-GLPAKQVDSAALDRLKRYRWPGNVR  357

Query  361  QLENTCRWLTVMITGREVYPEDLPSELKQIPIQKSVDQTGTPPSFDRISLHHWDELLGQW  420
            +LEN  R L  +     + P  + +EL + P   ++ + G             D  LG  
Sbjct  358  ELENLVRRLAALYPQEIITPSIIEAELSE-PAPSALSEDGPV-----------DATLGA-  404

Query  421  AIQKLKNGEMKIL--DIATPMF--------ERTLINAALQQTRGRKRHAAELLGWGRNTL  470
            ++++  NG       D+  P          E  L++AAL  TRG +  AAELLG  RNTL
Sbjct  405  SVERHLNGYFSGFGEDLPPPGLYHRILRDVEYPLLSAALAATRGNQIKAAELLGLNRNTL  464

Query  471  TRKLKELGI  479
             +K+++L I
Sbjct  465  RKKIRDLDI  473


> P10576 DNA-binding transcriptional regulator NtrC [Bradyrhizobium 
sp. (strain RP501 Parasponia)]
Length=480

 Score =  374 bits (960),  Expect = 3e-127
 Identities = 214/491 (44%), Positives = 293/491 (60%), Gaps = 30/491 (6%)

Query  1    MSRNKIWVIDDDRAMRWVLEKTFKEEGFDVTSFEEAQSALDQLLDDAPDVILTDIRMPGI  60
            M    I V DDD A+R VL +     G++V     A +    +     D+++TD+ MP  
Sbjct  1    MPAGSILVADDDTAIRTVLNQALSRAGYEVRLTGNAATLWRWVSQGEGDLVITDVVMPDE  60

Query  61   DGLTFLGKVKNNYPDLPVIIMTAHSDLESAVSSYQTGAFEYLPKPFDIDEALALVNRAIL  120
            +    L ++K   P+LPVI+M+A +   +A+   + GA+EYLPKPFD+ E + +V RA+ 
Sbjct  61   NAFDLLPRIKKMRPNLPVIVMSAQNTFMTAIRPSERGAYEYLPKPFDLKELITIVGRALA  120

Query  121  HINKLQQQEATKAASAAQSTEIIGESPAMQEVFRAIGRLSQSHITVLINGESGTGKELVA  180
               +     A        S  ++G SPAMQE++R + RL Q+ +TV+I+GESGTGKELVA
Sbjct  121  EPKERVSSPADDGEF--DSIPLVGRSPAMQEIYRVLARLMQTDLTVMISGESGTGKELVA  178

Query  181  HALHKHSPRSSKPFIALNMAAIPKDLIETELFGHEKGAFTGANTQRQGRFEQANGGTLFL  240
             ALH +  R + PF+A+NMAAIP+DLIE+ELFGHE+GAFTGANT+  GRFEQA GGTLFL
Sbjct  179  RALHDYGRRRNGPFVAVNMAAIPRDLIESELFGHERGAFTGANTRASGRFEQAEGGTLFL  238

Query  241  DEIGDMPFETQTRLLRVLADGEFYRVGGHIPVKVDVRIVAATHQDLEKLVNEGRFREDLY  300
            DEIGDMP E QTRLLRVL  GE+  VGG  P+K DVRIVAA+++DL  L+ +G FREDL+
Sbjct  239  DEIGDMPMEAQTRLLRVLQQGEYTTVGGRTPIKTDVRIVAASNKDLRILIQQGLFREDLF  298

Query  301  HRLNVIRIHIPKLAHRSEDIPMLAQHFLARAGKELGVSPKILRTETTDYMQQLPWPGNVR  360
             RLNV+ + +P L  R ED+P L +HF + A K+ G+ PK L  +  + ++Q  WPGNVR
Sbjct  299  FRLNVVPLRVPPLRERIEDLPDLIRHFFSLAEKD-GLPPKKLDAQALERLKQHRWPGNVR  357

Query  361  QLENTCRWLTVMITGREVYPEDLPSELKQIPIQKSVDQTGTPPSFDRISLH--HWDELLG  418
            +LEN  R L  +      YP+D       +     +D    PP+    S      D L G
Sbjct  358  ELENLARRLAAL------YPQD-------VITASVIDGELAPPAVTSGSTATVGVDNLGG  404

Query  419  QWAIQKLKNGEMKILDIATP----------MFERTLINAALQQTRGRKRHAAELLGWGRN  468
              A++   +          P            E  L+ AAL  TRG +  AA+LLG  RN
Sbjct  405  --AVEAYLSSHFSGFPNGVPPPGLYHRILKEIEIPLLTAALAATRGNQIRAADLLGLNRN  462

Query  469  TLTRKLKELGI  479
            TL +K+++L I
Sbjct  463  TLRKKIRDLDI  473


> Q06065 Regulatory protein AtoC [Escherichia coli (strain K12)]
Length=461

 Score =  348 bits (892),  Expect = 3e-117
 Identities = 199/487 (41%), Positives = 294/487 (60%), Gaps = 38/487 (8%)

Query  4    NKIWVIDDDRAMRWVLEKTFKEEGFDVTSFEEAQSALDQLLDDAPDVILTDIRMPGIDGL  63
            N+I ++DD+  +R +L   F  +GF+       ++AL    D  PDV+L DIRMP +DG+
Sbjct  5    NRILIVDDEDNVRRMLSTAFALQGFETHCANNGRTALHLFADIHPDVVLMDIRMPEMDGI  64

Query  64   TFLGKVKNNYPDLPVIIMTAHSDLESAVSSYQTGAFEYLPKPFDIDEALALVNRAI-LHI  122
              L +++++    PVI+MTA++++E+AV + + GAF+Y+ KPFD+DE   +V RA+ L  
Sbjct  65   KALKEMRSHETRTPVILMTAYAEVETAVEALRCGAFDYVIKPFDLDELNLIVQRALQLQS  124

Query  123  NKLQQQEATKAASAA-QSTEIIGESPAMQEVFRAIGRLSQSHITVLINGESGTGKELVAH  181
             K + +   +A S + Q   I+  SPAM ++ +   +++ S  +VLI+GESGTGKEL+A 
Sbjct  125  MKKEIRHLHQALSTSWQWGHILTNSPAMMDICKDTAKIALSQASVLISGESGTGKELIAR  184

Query  182  ALHKHSPRSSKPFIALNMAAIPKDLIETELFGHEKGAFTGANTQRQGRFEQANGGTLFLD  241
            A+H +S R+  PFI +N AA+P+ L+E+ELFGHEKGAFTGA T RQG FE+AN GTL LD
Sbjct  185  AIHYNSRRAKGPFIKVNCAALPESLLESELFGHEKGAFTGAQTLRQGLFERANEGTLLLD  244

Query  242  EIGDMPFETQTRLLRVLADGEFYRVGGHIPVKVDVRIVAATHQDLEKLVNEGRFREDLYH  301
            EIG+MP   Q +LLR+L + EF R+GGH  +KVD+RI+AAT++DL+ +V EG FREDL++
Sbjct  245  EIGEMPLVLQAKLLRILQEREFERIGGHQTIKVDIRIIAATNRDLQAMVKEGTFREDLFY  304

Query  302  RLNVIRIHIPKLAHRSEDIPMLAQHFLARAGKE-----LGVSPKILRTETTDYMQQLPWP  356
            RLNVI + +P L  R EDI +LA HFL +   E     + + P  +   T        WP
Sbjct  305  RLNVIHLILPPLRDRREDISLLANHFLQKFSSENQRDIIDIDPMAMSLLTA-----WSWP  359

Query  357  GNVRQLENTCRWLTVMITGREVYPEDLPSELKQIPIQKSVDQTGTPPSFDRISLHHWDEL  416
            GN+R+L N      VM +G  ++ EDLP +++Q P+  +  +  T P  +R         
Sbjct  360  GNIRELSNVIERAVVMNSGPIIFSEDLPPQIRQ-PV-CNAGEVKTAPVGER---------  408

Query  417  LGQWAIQKLKNGEMKILDIATPMFERTLINAALQQTRGRKRHAAELLGWGRNTLTRKLKE  476
                    LK    ++        E+ +I   L+Q  G +   A +LG  R  L  KL+E
Sbjct  409  -------NLKEEIKRV--------EKRIIMEVLEQQEGNRTRTALMLGISRRALMYKLQE  453

Query  477  LGISAED  483
             GI   D
Sbjct  454  YGIDPAD  460


> P14375 Transcriptional regulatory protein ZraR [Escherichia coli 
(strain K12)]
Length=441

 Score =  342 bits (878),  Expect = 2e-115
 Identities = 193/469 (41%), Positives = 278/469 (59%), Gaps = 37/469 (8%)

Query  6    IWVIDDDRAMRWVLEKTFKEEGFDVTSFEEAQSALDQLLDDAPDVILTDIRMPGIDGLTF  65
            I V+DDD +   +L+   +  G++V      + AL+Q+ +   D++L D+RM  +DG+  
Sbjct  8    ILVVDDDISHCTILQALLRGWGYNVALANSGRQALEQVREQVFDLVLCDVRMAEMDGIAT  67

Query  66   LGKVKNNYPDLPVIIMTAHSDLESAVSSYQTGAFEYLPKPFDIDEALALVNRAILHINKL  125
            L ++K   P +PV+IMTA+S +E+AV + +TGA +YL KP D D   A + +A+ H + +
Sbjct  68   LKEIKALNPAIPVLIMTAYSSVETAVEALKTGALDYLIKPLDFDNLQATLEKALAHTHSI  127

Query  126  QQQEATKAASAAQSTEIIGESPAMQEVFRAIGRLSQSHITVLINGESGTGKELVAHALHK  185
              +  T A +A+Q   ++G+SPAMQ +   I  ++ S  TVLI+G+SGTGKELVA A+H 
Sbjct  128  DAE--TPAVTASQFG-MVGKSPAMQHLLSEIALVAPSEATVLIHGDSGTGKELVARAIHA  184

Query  186  HSPRSSKPFIALNMAAIPKDLIETELFGHEKGAFTGANTQRQGRFEQANGGTLFLDEIGD  245
             S RS KP + LN AA+ + L+E+ELFGHEKGAFTGA+ +R+GRF +A+GGTLFLDEIGD
Sbjct  185  SSARSEKPLVTLNCAALNESLLESELFGHEKGAFTGADKRREGRFVEADGGTLFLDEIGD  244

Query  246  MPFETQTRLLRVLADGEFYRVGGHIPVKVDVRIVAATHQDLEKLVNEGRFREDLYHRLNV  305
            +    Q RLLR + + E  RVG +  + VDVR++AATH+DL   VN GRFR+DLY+RLNV
Sbjct  245  ISPMMQVRLLRAIQEREVQRVGSNQIISVDVRLIAATHRDLAAEVNAGRFRQDLYYRLNV  304

Query  306  IRIHIPKLAHRSEDIPMLAQHFLARAGKELGVSPKILRTETTDYMQQLPWPGNVRQLENT  365
            + I +P L  R EDIP+LA HFL R  +    + K    +  D +    WPGN+R+LEN 
Sbjct  305  VAIEVPSLRQRREDIPLLAGHFLQRFAERNRKAVKGFTPQAMDLLIHYDWPGNIRELENA  364

Query  366  CRWLTVMITGREVYPEDLPSELKQIPIQKSVDQTGTPPSFDRISLHHWDELLGQWAIQKL  425
                 V++TG  +   +LP  +   PI     Q   P                       
Sbjct  365  VERAVVLLTGEYISERELPLAIASTPIPLGQSQDIQP-----------------------  401

Query  426  KNGEMKILDIATPMFERTLINAALQQTRGRKRHAAELLGWGRNTLTRKL  474
                  ++++     E+ +I AAL++T G K  AA  LG  R TL  KL
Sbjct  402  ------LVEV-----EKEVILAALEKTGGNKTEAARQLGITRKTLLAKL  439


> Q8X613 Transcriptional regulatory protein ZraR [Escherichia coli 
O157:H7]
Length=441

 Score =  338 bits (867),  Expect = 8e-114
 Identities = 195/471 (41%), Positives = 279/471 (59%), Gaps = 41/471 (9%)

Query  6    IWVIDDDRAMRWVLEKTFKEEGFDVTSFEEAQSALDQLLDDAPDVILTDIRMPGIDGLTF  65
            I V+DDD +   +L+   +  G++V      + AL+Q+ +   D++L D+RM  +DG+  
Sbjct  8    ILVVDDDISHCTILQALLRGWGYNVALANSGRQALEQVRERVFDLVLCDVRMAEMDGIAT  67

Query  66   LGKVKNNYPDLPVIIMTAHSDLESAVSSYQTGAFEYLPKPFDIDEALALVNRAILHINKL  125
            L ++K   P +PV+IMTA+S +E+AV + +TGA +YL KP D D   A + +A+ H + +
Sbjct  68   LKEIKALNPAIPVLIMTAYSSVETAVEALKTGALDYLIKPLDFDNLQATLEKALAHTHII  127

Query  126  QQQEATKAASAAQSTEIIGESPAMQEVFRAIGRLSQSHITVLINGESGTGKELVAHALHK  185
              +  T A +A+Q   ++G+SPAMQ +   I  ++ S  TVLI+G+SGTGKELVA A+H 
Sbjct  128  DAE--TPAVTASQFG-MVGKSPAMQHLLSEIALVAPSEATVLIHGDSGTGKELVARAIHA  184

Query  186  HSPRSSKPFIALNMAAIPKDLIETELFGHEKGAFTGANTQRQGRFEQANGGTLFLDEIGD  245
             S RS KP + LN AA+ + L+E+ELFGHEKGAFTGA+ +R+GRF +A+GGTLFLDEIGD
Sbjct  185  SSARSEKPLVTLNCAALNESLLESELFGHEKGAFTGADKRREGRFVEADGGTLFLDEIGD  244

Query  246  MPFETQTRLLRVLADGEFYRVGGHIPVKVDVRIVAATHQDLEKLVNEGRFREDLYHRLNV  305
            +      RLLR + + E  RVG +  + VDVR++AATH+DL   VN GRFR+DLY+RLNV
Sbjct  245  ISPMMLVRLLRAIQEREVQRVGSNQTISVDVRLIAATHRDLAAEVNAGRFRQDLYYRLNV  304

Query  306  IRIHIPKLAHRSEDIPMLAQHFLARAGKELGVSPKILRTETTDYMQQLPWPGNVRQLENT  365
            + I +P L  R EDIP+LA HFL R  +    + K    +  D +    WPGN+R+LEN 
Sbjct  305  VAIEVPSLRQRREDIPLLAGHFLQRFAERNRKAVKGFTPQAMDLLIHYDWPGNIRELENA  364

Query  366  CRWLTVMITGREVYPEDLPSELKQ--IPIQKSVDQTGTPPSFDRISLHHWDELLGQWAIQ  423
                 V++TG  +   +LP  +    IP+ +S+D                        IQ
Sbjct  365  VERAVVLLTGEYISERELPLAIASTPIPLAQSLD------------------------IQ  400

Query  424  KLKNGEMKILDIATPMFERTLINAALQQTRGRKRHAAELLGWGRNTLTRKL  474
             L               E+ +I AAL++T G K  AA  LG  R TL  KL
Sbjct  401  PLVE------------VEKEVILAALEKTGGNKTEAARQLGITRKTLLAKL  439


> P25852 Transcriptional regulatory protein ZraR [Salmonella typhimurium 
(strain LT2 / SGSC1412 / ATCC 700720)]
Length=441

 Score =  330 bits (847),  Expect = 8e-111
 Identities = 192/470 (41%), Positives = 275/470 (59%), Gaps = 39/470 (8%)

Query  6    IWVIDDDRAMRWVLEKTFKEEGFDVTSFEEAQSALDQLLDDAPDVILTDIRMPGIDGLTF  65
            I V+DDD +   +L+   +  G++V        AL Q+ +   D++L D+RM  +DG+  
Sbjct  8    ILVVDDDVSHCTILQALLRGWGYNVALAYSGHDALAQVREKVFDLVLCDVRMAEMDGIAT  67

Query  66   LGKVKNNYPDLPVIIMTAHSDLESAVSSYQTGAFEYLPKPFDIDEALALVNRAILHINKL  125
            L ++K   P +P++IMTA S +E+AV + + GA +YL KP D D     + +A+ H  + 
Sbjct  68   LKEIKALNPAIPILIMTAFSSVETAVEALKAGALDYLIKPLDFDRLQETLEKALAHTRET  127

Query  126  QQQEATKAASAAQSTEIIGESPAMQEVFRAIGRLSQSHITVLINGESGTGKELVAHALHK  185
              +    +ASAAQ   +IG SPAMQ +   I  ++ S  TVLI+G+SGTGKELVA ALH 
Sbjct  128  GAE--LPSASAAQFG-MIGSSPAMQHLLNEIAMVAPSDATVLIHGDSGTGKELVARALHA  184

Query  186  HSPRSSKPFIALNMAAIPKDLIETELFGHEKGAFTGANTQRQGRFEQANGGTLFLDEIGD  245
             S RS +P + LN AA+ + L+E+ELFGHEKGAFTGA+ +R+GRF +A+GGTLFLDEIGD
Sbjct  185  CSARSDRPLVTLNCAALNESLLESELFGHEKGAFTGADKRREGRFVEADGGTLFLDEIGD  244

Query  246  MPFETQTRLLRVLADGEFYRVGGHIPVKVDVRIVAATHQDLEKLVNEGRFREDLYHRLNV  305
            +    Q RLLR + + E  RVG +  + VDVR++AATH+DL + V+ GRFR+DLY+RLNV
Sbjct  245  ISPLMQVRLLRAIQEREVQRVGSNQTISVDVRLIAATHRDLAEEVSAGRFRQDLYYRLNV  304

Query  306  IRIHIPKLAHRSEDIPMLAQHFLARAGKELGVSPKILRTETTDYMQQLPWPGNVRQLENT  365
            + I +P L  R EDIP+LA HFL R  +      K    +  D +    WPGN+R+LEN 
Sbjct  305  VAIEMPSLRQRREDIPLLADHFLRRFAERNRKVVKGFTPQAMDLLIHYDWPGNIRELENA  364

Query  366  CRWLTVMITGREVYPEDLPSELKQIPIQKSVDQTGTPPSFDRISLHHWDELLGQWAIQKL  425
                 V++TG  +   +LP  +   PI+                                
Sbjct  365  IERAVVLLTGEYISERELPLAIAATPIKTEY-----------------------------  395

Query  426  KNGEMK-ILDIATPMFERTLINAALQQTRGRKRHAAELLGWGRNTLTRKL  474
             +GE++ ++D+     E+ +I AAL++T G K  AA  LG  R TL  KL
Sbjct  396  -SGEIQPLVDV-----EKEVILAALEKTGGNKTEAARQLGITRKTLLAKL  439



Lambda      K        H        a         alpha
   0.319    0.136    0.396    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2379195


  Database: f7e8667bfc76dc44b7478e390ec393d2.SwissProt.fasta
    Posted date:  Oct 1, 2020  7:41 AM
  Number of letters in database: 6,058
  Number of sequences in database:  13



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40