ACIAD1355 / TrEMBL Alignments

BLASTP 2.2.28+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: f7ee128d4a2cf2c82e30596fc194d45c.TrEMBL.fasta
           29 sequences; 14,476 total letters



Query= ACIAD1355

Length=446
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  Q6FCI8 Putative potassium uptake protein (TrkH) [Acinetobacter ...   865    0.0  
  N9BU11 Uncharacterized protein [Acinetobacter soli NIPH 2899]        763    0.0  
  A0A1P8EHW5 Potassium transporter TrkH [Acinetobacter soli]           763    0.0  
  A0A0M1I1S7 Potassium transporter TrkH [Acinetobacter sp. C15]        763    0.0  
  A0A009ZZG3 Cation transport family protein [Acinetobacter sp. 4...   718    0.0  
  N9C1D8 Uncharacterized protein [Acinetobacter ursingii ANC 3649]     718    0.0  
  N9QSF6 Uncharacterized protein [Acinetobacter ursingii NIPH 706]     715    0.0  
  A0A2C9X4H9 Potassium transporter TrkH [Acinetobacter baumannii]      654    0.0  
  N9L215 Uncharacterized protein [Acinetobacter baumannii NIPH 80]     654    0.0  
  A0A0M3FLF0 Ktr system potassium uptake protein B [Acinetobacter...   652    0.0  
  A0A062DI80 Ktr system potassium uptake protein B [Acinetobacter...   651    0.0  
  A0A009S614 Ktr system potassium uptake protein B [Acinetobacter...   651    0.0  
  A0A062F6B6 Ktr system potassium uptake protein B [Acinetobacter...   651    0.0  
  A0A1E3M9G3 Potassium transporter TrkH [Acinetobacter baumannii]      651    0.0  
  A0A171F1Z6 Potassium uptake protein, TrkH family [Acinetobacter...   650    0.0  
  A0A090B5E9 K+ uptake system protein [Acinetobacter baumannii]        650    0.0  
  A0A009GUL4 Ktr system potassium uptake protein B [Acinetobacter...   650    0.0  
  A0A009SFV7 Ktr system potassium uptake protein B [Acinetobacter...   650    0.0  
  A0A013T2G0 Ktr system potassium uptake protein B [Acinetobacter...   650    0.0  
  O30362 Putative TrkG [Thermoanaerobacter ethanolicus]                234    6e-75
  A9IZZ6 Na+-transporting ATP synthase [Staphylococcus capitis]        181    2e-55
  Q9ZF91 Uncharacterized protein ykrM [Bacillus megaterium]            127    7e-36
  Q7X3Y7 Trk system potassium uptake protein [Vibrio vulnificus]      90.9    2e-22
  O87729 Trk system potassium uptake protein [Vibrio alginolyticus]   86.3    6e-21
  Q9P851 Potassium transport protein [Schwanniomyces occidentalis]    66.6    2e-14
  Q47476 ORF401 [Escherichia coli]                                    62.8    2e-13
  Q9P8G2 Potassium transport protein [Candida albicans]               63.5    2e-13
  Q3V5P8 High-affinity potassium transporter [Phragmites australis]   60.8    8e-13
  Q9Y7B9 Potassium transport protein [Kluyveromyces lactis]           61.2    8e-13


> Q6FCI8 Putative potassium uptake protein (TrkH) [Acinetobacter 
baylyi (strain ATCC 33305 / BD413 / ADP1)]
Length=445

 Score =  865 bits (2236),  Expect = 0.0
 Identities = 445/445 (100%), Positives = 445/445 (100%), Gaps = 0/445 (0%)

Query  1    MKKQKINQKTFNLSPPSMLALGFLSFIVAGTLLLKLPISNNGHLSWMDAFFTATSAVTIT  60
            MKKQKINQKTFNLSPPSMLALGFLSFIVAGTLLLKLPISNNGHLSWMDAFFTATSAVTIT
Sbjct  1    MKKQKINQKTFNLSPPSMLALGFLSFIVAGTLLLKLPISNNGHLSWMDAFFTATSAVTIT  60

Query  61   GLSVINIGQSLTHVGQIILLFLIQCGGLGFMTFAILAALSLAPQLGLKQQLMAQDSMGQT  120
            GLSVINIGQSLTHVGQIILLFLIQCGGLGFMTFAILAALSLAPQLGLKQQLMAQDSMGQT
Sbjct  61   GLSVINIGQSLTHVGQIILLFLIQCGGLGFMTFAILAALSLAPQLGLKQQLMAQDSMGQT  120

Query  121  SLSKVTFIAQAVFIYTLIFELMGTCILTFAWMNQFGFFHALYYAFFYSISAFNNAGFSLF  180
            SLSKVTFIAQAVFIYTLIFELMGTCILTFAWMNQFGFFHALYYAFFYSISAFNNAGFSLF
Sbjct  121  SLSKVTFIAQAVFIYTLIFELMGTCILTFAWMNQFGFFHALYYAFFYSISAFNNAGFSLF  180

Query  181  PNNLMNFQTHYIACLTISFLYILGGLGFLVIMDIKERKRWKKLSPNSKIVIISIAILNTS  240
            PNNLMNFQTHYIACLTISFLYILGGLGFLVIMDIKERKRWKKLSPNSKIVIISIAILNTS
Sbjct  181  PNNLMNFQTHYIACLTISFLYILGGLGFLVIMDIKERKRWKKLSPNSKIVIISIAILNTS  240

Query  241  AFLIIWLLEVNNPLTLYSMSFSEQALNAWFQATVPRSSGFNTIDIASMNNSSTLLTMFLM  300
            AFLIIWLLEVNNPLTLYSMSFSEQALNAWFQATVPRSSGFNTIDIASMNNSSTLLTMFLM
Sbjct  241  AFLIIWLLEVNNPLTLYSMSFSEQALNAWFQATVPRSSGFNTIDIASMNNSSTLLTMFLM  300

Query  301  FIGGGSLSTAGGIKVGTFVILVFSVIAFLKRHDEVRIFNHSISYENTFKALAVVVITLIL  360
            FIGGGSLSTAGGIKVGTFVILVFSVIAFLKRHDEVRIFNHSISYENTFKALAVVVITLIL
Sbjct  301  FIGGGSLSTAGGIKVGTFVILVFSVIAFLKRHDEVRIFNHSISYENTFKALAVVVITLIL  360

Query  361  IFIGFFSILILEPHKNFLDLFFEIVSAACTVGLSRGITPQLNNSSLFVLSLLMYAGRLGP  420
            IFIGFFSILILEPHKNFLDLFFEIVSAACTVGLSRGITPQLNNSSLFVLSLLMYAGRLGP
Sbjct  361  IFIGFFSILILEPHKNFLDLFFEIVSAACTVGLSRGITPQLNNSSLFVLSLLMYAGRLGP  420

Query  421  LTLAYLIATPKKSRLKHPSADIQIG  445
            LTLAYLIATPKKSRLKHPSADIQIG
Sbjct  421  LTLAYLIATPKKSRLKHPSADIQIG  445


> N9BU11 Uncharacterized protein [Acinetobacter soli NIPH 2899]
Length=445

 Score =  763 bits (1969),  Expect = 0.0
 Identities = 379/445 (85%), Positives = 415/445 (93%), Gaps = 0/445 (0%)

Query  1    MKKQKINQKTFNLSPPSMLALGFLSFIVAGTLLLKLPISNNGHLSWMDAFFTATSAVTIT  60
            MKKQK+ QK+FNLSPPS+LALGFLSFI+ GT LLKLP++NNGHLSWMDA FT+TSAVTIT
Sbjct  1    MKKQKLKQKSFNLSPPSLLALGFLSFIIIGTFLLKLPVANNGHLSWMDALFTSTSAVTIT  60

Query  61   GLSVINIGQSLTHVGQIILLFLIQCGGLGFMTFAILAALSLAPQLGLKQQLMAQDSMGQT  120
            GLSVINIG +LT  GQIILLFLIQ GGLGFMTFAILAALSLAPQLGLKQQ+MAQDS+G T
Sbjct  61   GLSVINIGHALTTTGQIILLFLIQIGGLGFMTFAILAALSLAPQLGLKQQIMAQDSIGHT  120

Query  121  SLSKVTFIAQAVFIYTLIFELMGTCILTFAWMNQFGFFHALYYAFFYSISAFNNAGFSLF  180
            SLSKVTF+AQAVFIYTLIFEL+GT ILT  W +QFGF HALYYA FYS+SAFNNAGFSLF
Sbjct  121  SLSKVTFVAQAVFIYTLIFELIGTVILTVVWTSQFGFLHALYYAMFYSVSAFNNAGFSLF  180

Query  181  PNNLMNFQTHYIACLTISFLYILGGLGFLVIMDIKERKRWKKLSPNSKIVIISIAILNTS  240
            PNNL+NF  HYI CLTISFLYILGG+GFLV+MDIK+ KRW+KLSPNSKI+I+SI +LN  
Sbjct  181  PNNLINFYDHYIVCLTISFLYILGGMGFLVLMDIKQHKRWRKLSPNSKIIIVSIGVLNLV  240

Query  241  AFLIIWLLEVNNPLTLYSMSFSEQALNAWFQATVPRSSGFNTIDIASMNNSSTLLTMFLM  300
             FL+IWLLE NNPLTLY+MSF EQA+NAWFQATVPRSSGFNTIDI SM NSSTLLTMF+M
Sbjct  241  GFLMIWLLEANNPLTLYNMSFGEQAINAWFQATVPRSSGFNTIDIGSMTNSSTLLTMFMM  300

Query  301  FIGGGSLSTAGGIKVGTFVILVFSVIAFLKRHDEVRIFNHSISYENTFKALAVVVITLIL  360
            FIGGGSLSTAGGIKVGT VIL+FSVIAFLKRHDEVRIFNHSISYE+TFKALAV +ITLIL
Sbjct  301  FIGGGSLSTAGGIKVGTAVILLFSVIAFLKRHDEVRIFNHSISYESTFKALAVAIITLIL  360

Query  361  IFIGFFSILILEPHKNFLDLFFEIVSAACTVGLSRGITPQLNNSSLFVLSLLMYAGRLGP  420
            IF+GFF+ILILEPHKNFLDLFFEIVSAACTVGLSRGIT +LNNSSLFVL+LLM+AGRLGP
Sbjct  361  IFVGFFTILILEPHKNFLDLFFEIVSAACTVGLSRGITGELNNSSLFVLTLLMFAGRLGP  420

Query  421  LTLAYLIATPKKSRLKHPSADIQIG  445
            LTLAYLIATP+KSRLKHP+ADIQIG
Sbjct  421  LTLAYLIATPRKSRLKHPNADIQIG  445


> A0A1P8EHW5 Potassium transporter TrkH [Acinetobacter soli]
Length=445

 Score =  763 bits (1969),  Expect = 0.0
 Identities = 379/445 (85%), Positives = 415/445 (93%), Gaps = 0/445 (0%)

Query  1    MKKQKINQKTFNLSPPSMLALGFLSFIVAGTLLLKLPISNNGHLSWMDAFFTATSAVTIT  60
            MKKQK+ QK+FNLSPPS+LALGFLSFI+ GT LLKLP++NNGHLSWMDA FT+TSAVTIT
Sbjct  1    MKKQKLKQKSFNLSPPSLLALGFLSFIIIGTFLLKLPVANNGHLSWMDALFTSTSAVTIT  60

Query  61   GLSVINIGQSLTHVGQIILLFLIQCGGLGFMTFAILAALSLAPQLGLKQQLMAQDSMGQT  120
            GLSVINIG +LT  GQIILLFLIQ GGLGFMTFAILAALSLAPQLGLKQQ+MAQDS+G T
Sbjct  61   GLSVINIGHALTTTGQIILLFLIQIGGLGFMTFAILAALSLAPQLGLKQQIMAQDSIGHT  120

Query  121  SLSKVTFIAQAVFIYTLIFELMGTCILTFAWMNQFGFFHALYYAFFYSISAFNNAGFSLF  180
            SLSKVTF+AQAVFIYTLIFEL+GT ILT  W +QFGF HALYYA FYS+SAFNNAGFSLF
Sbjct  121  SLSKVTFVAQAVFIYTLIFELIGTVILTVVWTSQFGFLHALYYAMFYSVSAFNNAGFSLF  180

Query  181  PNNLMNFQTHYIACLTISFLYILGGLGFLVIMDIKERKRWKKLSPNSKIVIISIAILNTS  240
            PNNL+NF  HYI CLTISFLYILGG+GFLV+MDIK+ KRW+KLSPNSKI+I+SI +LN  
Sbjct  181  PNNLINFYDHYIVCLTISFLYILGGMGFLVLMDIKQHKRWRKLSPNSKIIIVSIGVLNLV  240

Query  241  AFLIIWLLEVNNPLTLYSMSFSEQALNAWFQATVPRSSGFNTIDIASMNNSSTLLTMFLM  300
             FL+IWLLE NNPLTLY+MSF EQA+NAWFQATVPRSSGFNTIDI SM NSSTLLTMF+M
Sbjct  241  GFLMIWLLEANNPLTLYNMSFGEQAINAWFQATVPRSSGFNTIDIGSMTNSSTLLTMFMM  300

Query  301  FIGGGSLSTAGGIKVGTFVILVFSVIAFLKRHDEVRIFNHSISYENTFKALAVVVITLIL  360
            FIGGGSLSTAGGIKVGT VIL+FSVIAFLKRHDEVRIFNHSISYE+TFKALAV +ITLIL
Sbjct  301  FIGGGSLSTAGGIKVGTAVILLFSVIAFLKRHDEVRIFNHSISYESTFKALAVAIITLIL  360

Query  361  IFIGFFSILILEPHKNFLDLFFEIVSAACTVGLSRGITPQLNNSSLFVLSLLMYAGRLGP  420
            IF+GFF+ILILEPHKNFLDLFFEIVSAACTVGLSRGIT +LNNSSLFVL+LLM+AGRLGP
Sbjct  361  IFVGFFTILILEPHKNFLDLFFEIVSAACTVGLSRGITGELNNSSLFVLTLLMFAGRLGP  420

Query  421  LTLAYLIATPKKSRLKHPSADIQIG  445
            LTLAYLIATP+KSRLKHP+ADIQIG
Sbjct  421  LTLAYLIATPRKSRLKHPNADIQIG  445


> A0A0M1I1S7 Potassium transporter TrkH [Acinetobacter sp. C15]
Length=445

 Score =  763 bits (1969),  Expect = 0.0
 Identities = 379/445 (85%), Positives = 415/445 (93%), Gaps = 0/445 (0%)

Query  1    MKKQKINQKTFNLSPPSMLALGFLSFIVAGTLLLKLPISNNGHLSWMDAFFTATSAVTIT  60
            MKKQK+ QK+FNLSPPS+LALGFLSFI+ GT LLKLP++NNGHLSWMDA FT+TSAVTIT
Sbjct  1    MKKQKLKQKSFNLSPPSLLALGFLSFIIIGTFLLKLPVANNGHLSWMDALFTSTSAVTIT  60

Query  61   GLSVINIGQSLTHVGQIILLFLIQCGGLGFMTFAILAALSLAPQLGLKQQLMAQDSMGQT  120
            GLSVINIG +LT  GQIILLFLIQ GGLGFMTFAILAALSLAPQLGLKQQ+MAQDS+G T
Sbjct  61   GLSVINIGHALTTTGQIILLFLIQIGGLGFMTFAILAALSLAPQLGLKQQIMAQDSIGHT  120

Query  121  SLSKVTFIAQAVFIYTLIFELMGTCILTFAWMNQFGFFHALYYAFFYSISAFNNAGFSLF  180
            SLSKVTF+AQAVFIYTLIFEL+GT ILT  W +QFGF HALYYA FYS+SAFNNAGFSLF
Sbjct  121  SLSKVTFVAQAVFIYTLIFELIGTVILTVVWTSQFGFLHALYYAMFYSVSAFNNAGFSLF  180

Query  181  PNNLMNFQTHYIACLTISFLYILGGLGFLVIMDIKERKRWKKLSPNSKIVIISIAILNTS  240
            PNNL+NF  HYI CLTISFLYILGG+GFLV+MDIK+ KRW+KLSPNSKI+I+SI +LN  
Sbjct  181  PNNLINFYDHYIVCLTISFLYILGGMGFLVLMDIKQHKRWRKLSPNSKIIIVSIGVLNLV  240

Query  241  AFLIIWLLEVNNPLTLYSMSFSEQALNAWFQATVPRSSGFNTIDIASMNNSSTLLTMFLM  300
             FL+IWLLE NNPLTLY+MSF EQA+NAWFQATVPRSSGFNTIDI SM NSSTLLTMF+M
Sbjct  241  GFLMIWLLEANNPLTLYNMSFGEQAINAWFQATVPRSSGFNTIDIGSMTNSSTLLTMFMM  300

Query  301  FIGGGSLSTAGGIKVGTFVILVFSVIAFLKRHDEVRIFNHSISYENTFKALAVVVITLIL  360
            FIGGGSLSTAGGIKVGT VIL+FSVIAFLKRHDEVRIFNHSISYE+TFKALAV +ITLIL
Sbjct  301  FIGGGSLSTAGGIKVGTAVILLFSVIAFLKRHDEVRIFNHSISYESTFKALAVAIITLIL  360

Query  361  IFIGFFSILILEPHKNFLDLFFEIVSAACTVGLSRGITPQLNNSSLFVLSLLMYAGRLGP  420
            IF+GFF+ILILEPHKNFLDLFFEIVSAACTVGLSRGIT +LNNSSLFVL+LLM+AGRLGP
Sbjct  361  IFVGFFTILILEPHKNFLDLFFEIVSAACTVGLSRGITGELNNSSLFVLTLLMFAGRLGP  420

Query  421  LTLAYLIATPKKSRLKHPSADIQIG  445
            LTLAYLIATP+KSRLKHP+ADIQIG
Sbjct  421  LTLAYLIATPRKSRLKHPNADIQIG  445


> A0A009ZZG3 Cation transport family protein [Acinetobacter sp. 
479375]
Length=444

 Score =  718 bits (1854),  Expect = 0.0
 Identities = 358/443 (81%), Positives = 401/443 (91%), Gaps = 0/443 (0%)

Query  3    KQKINQKTFNLSPPSMLALGFLSFIVAGTLLLKLPISNNGHLSWMDAFFTATSAVTITGL  62
            K K+  KTFN SPPS+LALGFLSFI+ GTLLLKLP +NNG+LSWMDA FTATSAVTITGL
Sbjct  2    KAKLKNKTFNFSPPSLLALGFLSFIIIGTLLLKLPFANNGNLSWMDALFTATSAVTITGL  61

Query  63   SVINIGQSLTHVGQIILLFLIQCGGLGFMTFAILAALSLAPQLGLKQQLMAQDSMGQTSL  122
            SV+NIGQSLT  GQ+ILLFLIQCGGLGFMTFAILAALSLAPQLGLKQQ+MAQDS+GQTSL
Sbjct  62   SVVNIGQSLTTTGQLILLFLIQCGGLGFMTFAILAALSLAPQLGLKQQMMAQDSLGQTSL  121

Query  123  SKVTFIAQAVFIYTLIFELMGTCILTFAWMNQFGFFHALYYAFFYSISAFNNAGFSLFPN  182
            SKVT IAQ+VF Y+L FE+ G  ILT  W   FGF HALYYAFFYS+SAFNNAGFSLFP+
Sbjct  122  SKVTTIAQSVFFYSLFFEVTGIIILTSIWTPDFGFAHALYYAFFYSVSAFNNAGFSLFPD  181

Query  183  NLMNFQTHYIACLTISFLYILGGLGFLVIMDIKERKRWKKLSPNSKIVIISIAILNTSAF  242
            +L+ FQ+HY+ACL ISFLYILGG+GF+V+MDIK+ KRWKKLS NSK+V+ +IA+LN S F
Sbjct  182  SLVTFQSHYLACLAISFLYILGGIGFMVLMDIKQNKRWKKLSTNSKVVLSTIAVLNISGF  241

Query  243  LIIWLLEVNNPLTLYSMSFSEQALNAWFQATVPRSSGFNTIDIASMNNSSTLLTMFLMFI  302
            L+IWL+E NNPLTL  M+  EQA+NAWFQATVPRSSGFNTID AS+ NSSTLLTMFLMFI
Sbjct  242  LLIWLIEANNPLTLMQMNLGEQAVNAWFQATVPRSSGFNTIDTASLMNSSTLLTMFLMFI  301

Query  303  GGGSLSTAGGIKVGTFVILVFSVIAFLKRHDEVRIFNHSISYENTFKALAVVVITLILIF  362
            GGGSLSTAGGIKVGTF ILV SVI+FL+R+DE+R+FN SISYE+TFKALAVVVITL LIF
Sbjct  302  GGGSLSTAGGIKVGTFFILVLSVISFLRRNDEIRVFNRSISYESTFKALAVVVITLSLIF  361

Query  363  IGFFSILILEPHKNFLDLFFEIVSAACTVGLSRGITPQLNNSSLFVLSLLMYAGRLGPLT  422
            IGF +ILILEPHKNFLDLFFE+VSAACTVGLSRG+T +L+N SLFVLSLLM+AGRLGPLT
Sbjct  362  IGFMTILILEPHKNFLDLFFEVVSAACTVGLSRGVTGELHNGSLFVLSLLMFAGRLGPLT  421

Query  423  LAYLIATPKKSRLKHPSADIQIG  445
            LAYLIATPKKSRLKHPSADIQIG
Sbjct  422  LAYLIATPKKSRLKHPSADIQIG  444


> N9C1D8 Uncharacterized protein [Acinetobacter ursingii ANC 3649]
Length=444

 Score =  718 bits (1854),  Expect = 0.0
 Identities = 358/443 (81%), Positives = 401/443 (91%), Gaps = 0/443 (0%)

Query  3    KQKINQKTFNLSPPSMLALGFLSFIVAGTLLLKLPISNNGHLSWMDAFFTATSAVTITGL  62
            K K+  KTFN SPPS+LALGFLSFI+ GTLLLKLP +NNG+LSWMDA FTATSAVTITGL
Sbjct  2    KAKLKNKTFNFSPPSLLALGFLSFIIIGTLLLKLPFANNGNLSWMDALFTATSAVTITGL  61

Query  63   SVINIGQSLTHVGQIILLFLIQCGGLGFMTFAILAALSLAPQLGLKQQLMAQDSMGQTSL  122
            SV+NIGQSLT  GQ+ILLFLIQCGGLGFMTFAILAALSLAPQLGLKQQ+MAQDS+GQTSL
Sbjct  62   SVVNIGQSLTTTGQLILLFLIQCGGLGFMTFAILAALSLAPQLGLKQQMMAQDSLGQTSL  121

Query  123  SKVTFIAQAVFIYTLIFELMGTCILTFAWMNQFGFFHALYYAFFYSISAFNNAGFSLFPN  182
            SKVT IAQ+VF Y+L FE+ G  ILT  W   FGF HALYYAFFYS+SAFNNAGFSLFP+
Sbjct  122  SKVTTIAQSVFFYSLFFEVTGIIILTSIWTPDFGFAHALYYAFFYSVSAFNNAGFSLFPD  181

Query  183  NLMNFQTHYIACLTISFLYILGGLGFLVIMDIKERKRWKKLSPNSKIVIISIAILNTSAF  242
            +L+ FQ+HY+ACL ISFLYILGG+GF+V+MDIK+ KRWKKLS NSK+V+ +IA+LN S F
Sbjct  182  SLVTFQSHYLACLAISFLYILGGIGFMVLMDIKQNKRWKKLSTNSKVVLSTIAVLNISGF  241

Query  243  LIIWLLEVNNPLTLYSMSFSEQALNAWFQATVPRSSGFNTIDIASMNNSSTLLTMFLMFI  302
            L+IWL+E NNPLTL  M+  EQA+NAWFQATVPRSSGFNTID AS+ NSSTLLTMFLMFI
Sbjct  242  LLIWLIEANNPLTLMQMNLGEQAVNAWFQATVPRSSGFNTIDTASLMNSSTLLTMFLMFI  301

Query  303  GGGSLSTAGGIKVGTFVILVFSVIAFLKRHDEVRIFNHSISYENTFKALAVVVITLILIF  362
            GGGSLSTAGGIKVGTF ILV SVI+FL+R+DE+R+FN SISYE+TFKALAVVVITL LIF
Sbjct  302  GGGSLSTAGGIKVGTFFILVLSVISFLRRNDEIRVFNRSISYESTFKALAVVVITLSLIF  361

Query  363  IGFFSILILEPHKNFLDLFFEIVSAACTVGLSRGITPQLNNSSLFVLSLLMYAGRLGPLT  422
            IGF +ILILEPHKNFLDLFFE+VSAACTVGLSRG+T +L+N SLFVLSLLM+AGRLGPLT
Sbjct  362  IGFMTILILEPHKNFLDLFFEVVSAACTVGLSRGVTGELHNGSLFVLSLLMFAGRLGPLT  421

Query  423  LAYLIATPKKSRLKHPSADIQIG  445
            LAYLIATPKKSRLKHPSADIQIG
Sbjct  422  LAYLIATPKKSRLKHPSADIQIG  444


> N9QSF6 Uncharacterized protein [Acinetobacter ursingii NIPH 706]
Length=444

 Score =  715 bits (1845),  Expect = 0.0
 Identities = 357/443 (81%), Positives = 400/443 (90%), Gaps = 0/443 (0%)

Query  3    KQKINQKTFNLSPPSMLALGFLSFIVAGTLLLKLPISNNGHLSWMDAFFTATSAVTITGL  62
            K K+  KTFN SPPS+LALGFLSFI+ GTLLLKLP +NNG+LSWMDA FTATSAVTITGL
Sbjct  2    KAKLKNKTFNFSPPSLLALGFLSFIIIGTLLLKLPFANNGNLSWMDALFTATSAVTITGL  61

Query  63   SVINIGQSLTHVGQIILLFLIQCGGLGFMTFAILAALSLAPQLGLKQQLMAQDSMGQTSL  122
            SV+NIGQSLT  GQ+ILLFLIQCGGLGFMTFAILAALSLAPQLGLKQQ+MAQDS+GQTSL
Sbjct  62   SVVNIGQSLTTTGQLILLFLIQCGGLGFMTFAILAALSLAPQLGLKQQMMAQDSLGQTSL  121

Query  123  SKVTFIAQAVFIYTLIFELMGTCILTFAWMNQFGFFHALYYAFFYSISAFNNAGFSLFPN  182
            SKVT IAQ+VF Y+L FE+ G  ILT  W   FGF HALYYAFFYS+SAFNNAGFSLFP+
Sbjct  122  SKVTTIAQSVFFYSLFFEVTGIIILTSIWTPDFGFAHALYYAFFYSVSAFNNAGFSLFPD  181

Query  183  NLMNFQTHYIACLTISFLYILGGLGFLVIMDIKERKRWKKLSPNSKIVIISIAILNTSAF  242
            +L+ FQ+ Y+ACL ISFLYILGG+GF+V+MDIK+ KRWKKLS NSK+V+ +IA+LN S F
Sbjct  182  SLVTFQSDYLACLAISFLYILGGIGFMVLMDIKQNKRWKKLSTNSKVVLSTIAVLNISGF  241

Query  243  LIIWLLEVNNPLTLYSMSFSEQALNAWFQATVPRSSGFNTIDIASMNNSSTLLTMFLMFI  302
            L+IWL+E NNPLTL  M+  EQA+NAWFQATVPRSSGFNTID AS+ NSSTLLTMFLMFI
Sbjct  242  LLIWLIEANNPLTLMQMNLGEQAVNAWFQATVPRSSGFNTIDTASLMNSSTLLTMFLMFI  301

Query  303  GGGSLSTAGGIKVGTFVILVFSVIAFLKRHDEVRIFNHSISYENTFKALAVVVITLILIF  362
            GGGSLSTAGGIKVGTF ILV SVI+FL+R+DE+R+FN SISYE+TFKALAVVVITL LIF
Sbjct  302  GGGSLSTAGGIKVGTFFILVLSVISFLRRNDEIRVFNRSISYESTFKALAVVVITLSLIF  361

Query  363  IGFFSILILEPHKNFLDLFFEIVSAACTVGLSRGITPQLNNSSLFVLSLLMYAGRLGPLT  422
            IGF +ILILEPHKNFLDLFFE+VSAACTVGLSRG+T +L+N SLFVLSLLM+AGRLGPLT
Sbjct  362  IGFMTILILEPHKNFLDLFFEVVSAACTVGLSRGVTGELHNGSLFVLSLLMFAGRLGPLT  421

Query  423  LAYLIATPKKSRLKHPSADIQIG  445
            LAYLIATPKKSRLKHPSADIQIG
Sbjct  422  LAYLIATPKKSRLKHPSADIQIG  444


> A0A2C9X4H9 Potassium transporter TrkH [Acinetobacter baumannii]
Length=445

 Score =  654 bits (1686),  Expect = 0.0
 Identities = 325/437 (74%), Positives = 383/437 (88%), Gaps = 0/437 (0%)

Query  9    KTFNLSPPSMLALGFLSFIVAGTLLLKLPISNNGHLSWMDAFFTATSAVTITGLSVINIG  68
            KT NLSPPS+LALGFL FIV GTLLLKLPI+NNGH+SWMDA FTATSAVTITGLSV+NI 
Sbjct  9    KTLNLSPPSLLALGFLGFIVFGTLLLKLPIANNGHVSWMDALFTATSAVTITGLSVLNIH  68

Query  69   QSLTHVGQIILLFLIQCGGLGFMTFAILAALSLAPQLGLKQQLMAQDSMGQTSLSKVTFI  128
            +S T  GQ+I+L LIQ GGLGFMTFAILAALSL+P++GLKQQ+MAQDS+GQTSLSKVTF+
Sbjct  69   ESFTLFGQVIILLLIQSGGLGFMTFAILAALSLSPKVGLKQQMMAQDSLGQTSLSKVTFV  128

Query  129  AQAVFIYTLIFELMGTCILTFAWMNQFGFFHALYYAFFYSISAFNNAGFSLFPNNLMNFQ  188
            A+ V  YTL+FEL+GT ILT A+   +GF   LYYA FYSIS+FNNAGFSLF N+L+NFQ
Sbjct  129  AKGVVTYTLLFELIGTVILTTAFTPIYGFARGLYYAVFYSISSFNNAGFSLFSNSLVNFQ  188

Query  189  THYIACLTISFLYILGGLGFLVIMDIKERKRWKKLSPNSKIVIISIAILNTSAFLIIWLL  248
            ++YI C+TIS LY LGGLGFLV+MDIK+ K+WKKLSPNSK+++ +IAI+N  AF++IW+L
Sbjct  189  SNYIICITISLLYTLGGLGFLVLMDIKQNKKWKKLSPNSKLILTTIAIINLVAFVLIWVL  248

Query  249  EVNNPLTLYSMSFSEQALNAWFQATVPRSSGFNTIDIASMNNSSTLLTMFLMFIGGGSLS  308
            E  NP TL  ++  +QALNAWFQATVPRSSGFNTID  +MNNSS+LL M LMFIGGGSLS
Sbjct  249  EAQNPHTLGLLNVGDQALNAWFQATVPRSSGFNTIDTGAMNNSSSLLMMLLMFIGGGSLS  308

Query  309  TAGGIKVGTFVILVFSVIAFLKRHDEVRIFNHSISYENTFKALAVVVITLILIFIGFFSI  368
            TAGGIKVGTFVILV SV++FL+R DE+R+FNHS+S+E T+KALAV  IT ILIFIGFF +
Sbjct  309  TAGGIKVGTFVILVLSVLSFLRRTDEIRVFNHSVSHETTYKALAVTAITSILIFIGFFIL  368

Query  369  LILEPHKNFLDLFFEIVSAACTVGLSRGITPQLNNSSLFVLSLLMYAGRLGPLTLAYLIA  428
            L+LEP  +F++L FE+VSAACTVGLSRGITP L+N SLF+LSLLM+AGRLGPLTLAYLIA
Sbjct  369  LLLEPKADFMNLLFEVVSAACTVGLSRGITPDLHNGSLFILSLLMFAGRLGPLTLAYLIA  428

Query  429  TPKKSRLKHPSADIQIG  445
            TPKKSRLKHP A+IQIG
Sbjct  429  TPKKSRLKHPQANIQIG  445


 Score = 24.3 bits (51),  Expect = 0.23
 Identities = 44/159 (28%), Positives = 68/159 (43%), Gaps = 21/159 (13%)

Query  5    KINQKTFNLSPPSMLALGFLSFI--VAGTLLLKLPISNNGHLSW-------MDAFFTATS  55
            K N+K   LSP S L L  ++ I  VA  L+  L   N   L         ++A+F AT 
Sbjct  215  KQNKKWKKLSPNSKLILTTIAIINLVAFVLIWVLEAQNPHTLGLLNVGDQALNAWFQAT-  273

Query  56   AVTITGLSVINIG--QSLTHVGQIILLF-----LIQCGGLGFMTFAILAALSLAPQLGLK  108
                +G + I+ G   + + +  ++L+F     L   GG+   TF IL  LS+   L   
Sbjct  274  VPRSSGFNTIDTGAMNNSSSLLMMLLMFIGGGSLSTAGGIKVGTFVIL-VLSVLSFLRRT  332

Query  109  QQLMAQDSMGQTSLSKVTFIAQAVFIYTLIFELMGTCIL  147
             ++        +   + T+ A AV   T I   +G  IL
Sbjct  333  DEIRV---FNHSVSHETTYKALAVTAITSILIFIGFFIL  368


> N9L215 Uncharacterized protein [Acinetobacter baumannii NIPH 
80]
Length=445

 Score =  654 bits (1686),  Expect = 0.0
 Identities = 325/437 (74%), Positives = 383/437 (88%), Gaps = 0/437 (0%)

Query  9    KTFNLSPPSMLALGFLSFIVAGTLLLKLPISNNGHLSWMDAFFTATSAVTITGLSVINIG  68
            KT NLSPPS+LALGFL FIV GTLLLKLPI+NNGH+SWMDA FTATSAVTITGLSV+NI 
Sbjct  9    KTLNLSPPSLLALGFLGFIVFGTLLLKLPIANNGHVSWMDALFTATSAVTITGLSVLNIH  68

Query  69   QSLTHVGQIILLFLIQCGGLGFMTFAILAALSLAPQLGLKQQLMAQDSMGQTSLSKVTFI  128
            +S T  GQ+I+L LIQ GGLGFMTFAILAALSL+P++GLKQQ+MAQDS+GQTSLSKVTF+
Sbjct  69   ESFTLFGQVIILLLIQSGGLGFMTFAILAALSLSPKVGLKQQMMAQDSLGQTSLSKVTFV  128

Query  129  AQAVFIYTLIFELMGTCILTFAWMNQFGFFHALYYAFFYSISAFNNAGFSLFPNNLMNFQ  188
            A+ V  YTL+FEL+GT ILT A+   +GF   LYYA FYSIS+FNNAGFSLF N+L+NFQ
Sbjct  129  AKGVVTYTLLFELIGTVILTTAFTPIYGFARGLYYAVFYSISSFNNAGFSLFSNSLVNFQ  188

Query  189  THYIACLTISFLYILGGLGFLVIMDIKERKRWKKLSPNSKIVIISIAILNTSAFLIIWLL  248
            ++YI C+TIS LY LGGLGFLV+MDIK+ K+WKKLSPNSK+++ +IAI+N  AF++IW+L
Sbjct  189  SNYIICITISLLYTLGGLGFLVLMDIKQNKKWKKLSPNSKLILTTIAIINLVAFVLIWVL  248

Query  249  EVNNPLTLYSMSFSEQALNAWFQATVPRSSGFNTIDIASMNNSSTLLTMFLMFIGGGSLS  308
            E  NP TL  ++  +QALNAWFQATVPRSSGFNTID  +MNNSS+LL M LMFIGGGSLS
Sbjct  249  EAQNPHTLGLLNVGDQALNAWFQATVPRSSGFNTIDTGAMNNSSSLLMMLLMFIGGGSLS  308

Query  309  TAGGIKVGTFVILVFSVIAFLKRHDEVRIFNHSISYENTFKALAVVVITLILIFIGFFSI  368
            TAGGIKVGTFVILV SV++FL+R DE+R+FNHS+S+E T+KALAV  IT ILIFIGFF +
Sbjct  309  TAGGIKVGTFVILVLSVLSFLRRTDEIRVFNHSVSHETTYKALAVTAITSILIFIGFFIL  368

Query  369  LILEPHKNFLDLFFEIVSAACTVGLSRGITPQLNNSSLFVLSLLMYAGRLGPLTLAYLIA  428
            L+LEP  +F++L FE+VSAACTVGLSRGITP L+N SLF+LSLLM+AGRLGPLTLAYLIA
Sbjct  369  LLLEPKADFMNLLFEVVSAACTVGLSRGITPDLHNGSLFILSLLMFAGRLGPLTLAYLIA  428

Query  429  TPKKSRLKHPSADIQIG  445
            TPKKSRLKHP A+IQIG
Sbjct  429  TPKKSRLKHPQANIQIG  445


 Score = 24.3 bits (51),  Expect = 0.23
 Identities = 44/159 (28%), Positives = 68/159 (43%), Gaps = 21/159 (13%)

Query  5    KINQKTFNLSPPSMLALGFLSFI--VAGTLLLKLPISNNGHLSW-------MDAFFTATS  55
            K N+K   LSP S L L  ++ I  VA  L+  L   N   L         ++A+F AT 
Sbjct  215  KQNKKWKKLSPNSKLILTTIAIINLVAFVLIWVLEAQNPHTLGLLNVGDQALNAWFQAT-  273

Query  56   AVTITGLSVINIG--QSLTHVGQIILLF-----LIQCGGLGFMTFAILAALSLAPQLGLK  108
                +G + I+ G   + + +  ++L+F     L   GG+   TF IL  LS+   L   
Sbjct  274  VPRSSGFNTIDTGAMNNSSSLLMMLLMFIGGGSLSTAGGIKVGTFVIL-VLSVLSFLRRT  332

Query  109  QQLMAQDSMGQTSLSKVTFIAQAVFIYTLIFELMGTCIL  147
             ++        +   + T+ A AV   T I   +G  IL
Sbjct  333  DEIRV---FNHSVSHETTYKALAVTAITSILIFIGFFIL  368


> A0A0M3FLF0 Ktr system potassium uptake protein B [Acinetobacter 
baumannii]
Length=445

 Score =  652 bits (1682),  Expect = 0.0
 Identities = 324/437 (74%), Positives = 383/437 (88%), Gaps = 0/437 (0%)

Query  9    KTFNLSPPSMLALGFLSFIVAGTLLLKLPISNNGHLSWMDAFFTATSAVTITGLSVINIG  68
            KT NLSPPS+LALGFL FIV GTLLLKLPI+NNGH+SWMDA FTATSAVTITGLSV+NI 
Sbjct  9    KTLNLSPPSLLALGFLGFIVFGTLLLKLPIANNGHVSWMDALFTATSAVTITGLSVLNIH  68

Query  69   QSLTHVGQIILLFLIQCGGLGFMTFAILAALSLAPQLGLKQQLMAQDSMGQTSLSKVTFI  128
            +S T  GQ+I+L LIQ GGLGFMTFAILAALSL+P++GLKQQ+MAQDS+GQTSLSKVTF+
Sbjct  69   ESFTLFGQVIILLLIQSGGLGFMTFAILAALSLSPKVGLKQQMMAQDSLGQTSLSKVTFV  128

Query  129  AQAVFIYTLIFELMGTCILTFAWMNQFGFFHALYYAFFYSISAFNNAGFSLFPNNLMNFQ  188
            A+ V  YTL+FEL+GT ILT A+   +GF   LYYA FYSIS+FNNAGFSLF N+L+NFQ
Sbjct  129  AKGVVTYTLLFELIGTVILTTAFTPIYGFARGLYYAVFYSISSFNNAGFSLFSNSLVNFQ  188

Query  189  THYIACLTISFLYILGGLGFLVIMDIKERKRWKKLSPNSKIVIISIAILNTSAFLIIWLL  248
            ++Y+ C+TIS LY LGGLGFLV+MDIK+ K+WKKLSPNSK+++ +IAI+N  AF++IW+L
Sbjct  189  SNYLICITISLLYTLGGLGFLVLMDIKQNKKWKKLSPNSKLILTTIAIINLVAFVLIWVL  248

Query  249  EVNNPLTLYSMSFSEQALNAWFQATVPRSSGFNTIDIASMNNSSTLLTMFLMFIGGGSLS  308
            E  NP TL  ++  +QALNAWFQATVPRSSGFNTID  +M NSS+LL M LMFIGGGSLS
Sbjct  249  EAQNPHTLGLLNVGDQALNAWFQATVPRSSGFNTIDTGAMTNSSSLLMMLLMFIGGGSLS  308

Query  309  TAGGIKVGTFVILVFSVIAFLKRHDEVRIFNHSISYENTFKALAVVVITLILIFIGFFSI  368
            TAGGIKVGTFVILV SV++FL+R DE+R+FNHS+S+E T+KALAV  IT ILIFIGFF +
Sbjct  309  TAGGIKVGTFVILVLSVLSFLRRTDEIRVFNHSVSHETTYKALAVTAITSILIFIGFFIL  368

Query  369  LILEPHKNFLDLFFEIVSAACTVGLSRGITPQLNNSSLFVLSLLMYAGRLGPLTLAYLIA  428
            L+LEP  +F++L FE+VSAACTVGLSRGITP L+NSSLF+LSLLM+AGRLGPLTLAYLIA
Sbjct  369  LLLEPKADFMNLLFEVVSAACTVGLSRGITPDLHNSSLFILSLLMFAGRLGPLTLAYLIA  428

Query  429  TPKKSRLKHPSADIQIG  445
            TPKKSRLKHP A+IQIG
Sbjct  429  TPKKSRLKHPQANIQIG  445


 Score = 26.2 bits (56),  Expect = 0.058
 Identities = 43/160 (27%), Positives = 69/160 (43%), Gaps = 23/160 (14%)

Query  5    KINQKTFNLSPPSMLALGFLSFI--VAGTLLLKLPISNNGHLSW-------MDAFFTATS  55
            K N+K   LSP S L L  ++ I  VA  L+  L   N   L         ++A+F AT 
Sbjct  215  KQNKKWKKLSPNSKLILTTIAIINLVAFVLIWVLEAQNPHTLGLLNVGDQALNAWFQAT-  273

Query  56   AVTITGLSVINIGQSLTHVGQIILLFLI--------QCGGLGFMTFAILAALSLAPQLGL  107
                +G + I+ G ++T+   ++++ L+          GG+   TF IL  LS+   L  
Sbjct  274  VPRSSGFNTIDTG-AMTNSSSLLMMLLMFIGGGSLSTAGGIKVGTFVIL-VLSVLSFLRR  331

Query  108  KQQLMAQDSMGQTSLSKVTFIAQAVFIYTLIFELMGTCIL  147
              ++        +   + T+ A AV   T I   +G  IL
Sbjct  332  TDEIRV---FNHSVSHETTYKALAVTAITSILIFIGFFIL  368


> A0A062DI80 Ktr system potassium uptake protein B [Acinetobacter 
baumannii 496487]
Length=445

 Score =  651 bits (1680),  Expect = 0.0
 Identities = 324/437 (74%), Positives = 382/437 (87%), Gaps = 0/437 (0%)

Query  9    KTFNLSPPSMLALGFLSFIVAGTLLLKLPISNNGHLSWMDAFFTATSAVTITGLSVINIG  68
            KT NLSPPS+LALGFL FIV GTLLLKLPI+NNGH+SWMDA FTATSAVTITGLSV+NI 
Sbjct  9    KTLNLSPPSLLALGFLGFIVFGTLLLKLPIANNGHVSWMDALFTATSAVTITGLSVLNIH  68

Query  69   QSLTHVGQIILLFLIQCGGLGFMTFAILAALSLAPQLGLKQQLMAQDSMGQTSLSKVTFI  128
            +S T  GQ+I+L LIQ GGLGFMTFAILAALSL+P++GLKQQ+MAQDS+GQTSLSKVTF+
Sbjct  69   ESFTLFGQVIILLLIQSGGLGFMTFAILAALSLSPKVGLKQQMMAQDSLGQTSLSKVTFV  128

Query  129  AQAVFIYTLIFELMGTCILTFAWMNQFGFFHALYYAFFYSISAFNNAGFSLFPNNLMNFQ  188
            A+ V  YTL+FEL+GT ILT A+   +GF   LYYA FYSIS+FNNAGFSLF N+L+NFQ
Sbjct  129  AKGVVTYTLLFELIGTVILTTAFTPIYGFARGLYYAVFYSISSFNNAGFSLFSNSLVNFQ  188

Query  189  THYIACLTISFLYILGGLGFLVIMDIKERKRWKKLSPNSKIVIISIAILNTSAFLIIWLL  248
            ++YI C+TIS LY LGGLGFLV+MDIK+ K+WKKLSPNSK+++ +IAI+N  AF++IW+L
Sbjct  189  SNYIICITISLLYTLGGLGFLVLMDIKQNKKWKKLSPNSKLILTTIAIINLVAFVLIWVL  248

Query  249  EVNNPLTLYSMSFSEQALNAWFQATVPRSSGFNTIDIASMNNSSTLLTMFLMFIGGGSLS  308
            E  NP TL  ++  +QALNAWFQATVPRSSGFNTID  +M NSS+LL M LMFIGGGSLS
Sbjct  249  EAQNPHTLGLLNVGDQALNAWFQATVPRSSGFNTIDTGAMTNSSSLLMMLLMFIGGGSLS  308

Query  309  TAGGIKVGTFVILVFSVIAFLKRHDEVRIFNHSISYENTFKALAVVVITLILIFIGFFSI  368
            TAGGIKVGTFVILV SV++FL+R DE+R+FNHS+S+E T+KALAV  IT ILIFIGFF +
Sbjct  309  TAGGIKVGTFVILVLSVLSFLRRTDEIRVFNHSVSHETTYKALAVTAITSILIFIGFFIL  368

Query  369  LILEPHKNFLDLFFEIVSAACTVGLSRGITPQLNNSSLFVLSLLMYAGRLGPLTLAYLIA  428
            L+LEP  +F++L FE+VSAACTVGLSRGITP L+N SLF+LSLLM+AGRLGPLTLAYLIA
Sbjct  369  LLLEPKADFMNLLFEVVSAACTVGLSRGITPDLHNGSLFILSLLMFAGRLGPLTLAYLIA  428

Query  429  TPKKSRLKHPSADIQIG  445
            TPKKSRLKHP A+IQIG
Sbjct  429  TPKKSRLKHPQANIQIG  445


 Score = 26.2 bits (56),  Expect = 0.058
 Identities = 43/160 (27%), Positives = 69/160 (43%), Gaps = 23/160 (14%)

Query  5    KINQKTFNLSPPSMLALGFLSFI--VAGTLLLKLPISNNGHLSW-------MDAFFTATS  55
            K N+K   LSP S L L  ++ I  VA  L+  L   N   L         ++A+F AT 
Sbjct  215  KQNKKWKKLSPNSKLILTTIAIINLVAFVLIWVLEAQNPHTLGLLNVGDQALNAWFQAT-  273

Query  56   AVTITGLSVINIGQSLTHVGQIILLFLI--------QCGGLGFMTFAILAALSLAPQLGL  107
                +G + I+ G ++T+   ++++ L+          GG+   TF IL  LS+   L  
Sbjct  274  VPRSSGFNTIDTG-AMTNSSSLLMMLLMFIGGGSLSTAGGIKVGTFVIL-VLSVLSFLRR  331

Query  108  KQQLMAQDSMGQTSLSKVTFIAQAVFIYTLIFELMGTCIL  147
              ++        +   + T+ A AV   T I   +G  IL
Sbjct  332  TDEIRV---FNHSVSHETTYKALAVTAITSILIFIGFFIL  368


> A0A009S614 Ktr system potassium uptake protein B [Acinetobacter 
baumannii 951631]
Length=445

 Score =  651 bits (1680),  Expect = 0.0
 Identities = 324/437 (74%), Positives = 382/437 (87%), Gaps = 0/437 (0%)

Query  9    KTFNLSPPSMLALGFLSFIVAGTLLLKLPISNNGHLSWMDAFFTATSAVTITGLSVINIG  68
            KT NLSPPS+LALGFL FIV GTLLLKLPI+NNGH+SWMDA FTATSAVTITGLSV+NI 
Sbjct  9    KTLNLSPPSLLALGFLGFIVFGTLLLKLPIANNGHVSWMDALFTATSAVTITGLSVLNIH  68

Query  69   QSLTHVGQIILLFLIQCGGLGFMTFAILAALSLAPQLGLKQQLMAQDSMGQTSLSKVTFI  128
            +S T  GQ+I+L LIQ GGLGFMTFAILAALSL+P++GLKQQ+MAQDS+GQTSLSKVTF+
Sbjct  69   ESFTLFGQVIILLLIQSGGLGFMTFAILAALSLSPKVGLKQQMMAQDSLGQTSLSKVTFV  128

Query  129  AQAVFIYTLIFELMGTCILTFAWMNQFGFFHALYYAFFYSISAFNNAGFSLFPNNLMNFQ  188
            A+ V  YTL+FEL+GT ILT A+   +GF   LYYA FYSIS+FNNAGFSLF N+L+NFQ
Sbjct  129  AKGVVTYTLLFELIGTVILTTAFTPIYGFARGLYYAVFYSISSFNNAGFSLFSNSLVNFQ  188

Query  189  THYIACLTISFLYILGGLGFLVIMDIKERKRWKKLSPNSKIVIISIAILNTSAFLIIWLL  248
            ++YI C+TIS LY LGGLGFLV+MDIK+ K+WKKLSPNSK+++ +IAI+N  AF++IW+L
Sbjct  189  SNYIICITISLLYTLGGLGFLVLMDIKQNKKWKKLSPNSKLILTTIAIINLVAFVLIWVL  248

Query  249  EVNNPLTLYSMSFSEQALNAWFQATVPRSSGFNTIDIASMNNSSTLLTMFLMFIGGGSLS  308
            E  NP TL  ++  +QALNAWFQATVPRSSGFNTID  +M NSS+LL M LMFIGGGSLS
Sbjct  249  EAQNPHTLGLLNVGDQALNAWFQATVPRSSGFNTIDTGAMTNSSSLLMMLLMFIGGGSLS  308

Query  309  TAGGIKVGTFVILVFSVIAFLKRHDEVRIFNHSISYENTFKALAVVVITLILIFIGFFSI  368
            TAGGIKVGTFVILV SV++FL+R DE+R+FNHS+S+E T+KALAV  IT ILIFIGFF +
Sbjct  309  TAGGIKVGTFVILVLSVLSFLRRTDEIRVFNHSVSHETTYKALAVTAITSILIFIGFFIL  368

Query  369  LILEPHKNFLDLFFEIVSAACTVGLSRGITPQLNNSSLFVLSLLMYAGRLGPLTLAYLIA  428
            L+LEP  +F++L FE+VSAACTVGLSRGITP L+N SLF+LSLLM+AGRLGPLTLAYLIA
Sbjct  369  LLLEPKADFMNLLFEVVSAACTVGLSRGITPDLHNGSLFILSLLMFAGRLGPLTLAYLIA  428

Query  429  TPKKSRLKHPSADIQIG  445
            TPKKSRLKHP A+IQIG
Sbjct  429  TPKKSRLKHPQANIQIG  445


 Score = 26.2 bits (56),  Expect = 0.058
 Identities = 43/160 (27%), Positives = 69/160 (43%), Gaps = 23/160 (14%)

Query  5    KINQKTFNLSPPSMLALGFLSFI--VAGTLLLKLPISNNGHLSW-------MDAFFTATS  55
            K N+K   LSP S L L  ++ I  VA  L+  L   N   L         ++A+F AT 
Sbjct  215  KQNKKWKKLSPNSKLILTTIAIINLVAFVLIWVLEAQNPHTLGLLNVGDQALNAWFQAT-  273

Query  56   AVTITGLSVINIGQSLTHVGQIILLFLI--------QCGGLGFMTFAILAALSLAPQLGL  107
                +G + I+ G ++T+   ++++ L+          GG+   TF IL  LS+   L  
Sbjct  274  VPRSSGFNTIDTG-AMTNSSSLLMMLLMFIGGGSLSTAGGIKVGTFVIL-VLSVLSFLRR  331

Query  108  KQQLMAQDSMGQTSLSKVTFIAQAVFIYTLIFELMGTCIL  147
              ++        +   + T+ A AV   T I   +G  IL
Sbjct  332  TDEIRV---FNHSVSHETTYKALAVTAITSILIFIGFFIL  368


> A0A062F6B6 Ktr system potassium uptake protein B [Acinetobacter 
baumannii 754286]
Length=445

 Score =  651 bits (1680),  Expect = 0.0
 Identities = 324/437 (74%), Positives = 382/437 (87%), Gaps = 0/437 (0%)

Query  9    KTFNLSPPSMLALGFLSFIVAGTLLLKLPISNNGHLSWMDAFFTATSAVTITGLSVINIG  68
            KT NLSPPS+LALGFL FIV GTLLLKLPI+NNGH+SWMDA FTATSAVTITGLSV+NI 
Sbjct  9    KTLNLSPPSLLALGFLGFIVFGTLLLKLPIANNGHVSWMDALFTATSAVTITGLSVLNIH  68

Query  69   QSLTHVGQIILLFLIQCGGLGFMTFAILAALSLAPQLGLKQQLMAQDSMGQTSLSKVTFI  128
            +S T  GQ+I+L LIQ GGLGFMTFAILAALSL+P++GLKQQ+MAQDS+GQTSLSKVTF+
Sbjct  69   ESFTLFGQVIILLLIQSGGLGFMTFAILAALSLSPKVGLKQQMMAQDSLGQTSLSKVTFV  128

Query  129  AQAVFIYTLIFELMGTCILTFAWMNQFGFFHALYYAFFYSISAFNNAGFSLFPNNLMNFQ  188
            A+ V  YTL+FEL+GT ILT A+   +GF   LYYA FYSIS+FNNAGFSLF N+L+NFQ
Sbjct  129  AKGVVTYTLLFELIGTVILTTAFTPIYGFARGLYYAVFYSISSFNNAGFSLFSNSLVNFQ  188

Query  189  THYIACLTISFLYILGGLGFLVIMDIKERKRWKKLSPNSKIVIISIAILNTSAFLIIWLL  248
            ++YI C+TIS LY LGGLGFLV+MDIK+ K+WKKLSPNSK+++ +IAI+N  AF++IW+L
Sbjct  189  SNYIICITISLLYTLGGLGFLVLMDIKQNKKWKKLSPNSKLILTTIAIINLVAFVLIWVL  248

Query  249  EVNNPLTLYSMSFSEQALNAWFQATVPRSSGFNTIDIASMNNSSTLLTMFLMFIGGGSLS  308
            E  NP TL  ++  +QALNAWFQATVPRSSGFNTID  +M NSS+LL M LMFIGGGSLS
Sbjct  249  EAQNPHTLGLLNVGDQALNAWFQATVPRSSGFNTIDTGAMTNSSSLLMMLLMFIGGGSLS  308

Query  309  TAGGIKVGTFVILVFSVIAFLKRHDEVRIFNHSISYENTFKALAVVVITLILIFIGFFSI  368
            TAGGIKVGTFVILV SV++FL+R DE+R+FNHS+S+E T+KALAV  IT ILIFIGFF +
Sbjct  309  TAGGIKVGTFVILVLSVLSFLRRTDEIRVFNHSVSHETTYKALAVTAITSILIFIGFFIL  368

Query  369  LILEPHKNFLDLFFEIVSAACTVGLSRGITPQLNNSSLFVLSLLMYAGRLGPLTLAYLIA  428
            L+LEP  +F++L FE+VSAACTVGLSRGITP L+N SLF+LSLLM+AGRLGPLTLAYLIA
Sbjct  369  LLLEPKADFMNLLFEVVSAACTVGLSRGITPDLHNGSLFILSLLMFAGRLGPLTLAYLIA  428

Query  429  TPKKSRLKHPSADIQIG  445
            TPKKSRLKHP A+IQIG
Sbjct  429  TPKKSRLKHPQANIQIG  445


 Score = 26.2 bits (56),  Expect = 0.058
 Identities = 43/160 (27%), Positives = 69/160 (43%), Gaps = 23/160 (14%)

Query  5    KINQKTFNLSPPSMLALGFLSFI--VAGTLLLKLPISNNGHLSW-------MDAFFTATS  55
            K N+K   LSP S L L  ++ I  VA  L+  L   N   L         ++A+F AT 
Sbjct  215  KQNKKWKKLSPNSKLILTTIAIINLVAFVLIWVLEAQNPHTLGLLNVGDQALNAWFQAT-  273

Query  56   AVTITGLSVINIGQSLTHVGQIILLFLI--------QCGGLGFMTFAILAALSLAPQLGL  107
                +G + I+ G ++T+   ++++ L+          GG+   TF IL  LS+   L  
Sbjct  274  VPRSSGFNTIDTG-AMTNSSSLLMMLLMFIGGGSLSTAGGIKVGTFVIL-VLSVLSFLRR  331

Query  108  KQQLMAQDSMGQTSLSKVTFIAQAVFIYTLIFELMGTCIL  147
              ++        +   + T+ A AV   T I   +G  IL
Sbjct  332  TDEIRV---FNHSVSHETTYKALAVTAITSILIFIGFFIL  368


> A0A1E3M9G3 Potassium transporter TrkH [Acinetobacter baumannii]
Length=445

 Score =  651 bits (1679),  Expect = 0.0
 Identities = 323/437 (74%), Positives = 382/437 (87%), Gaps = 0/437 (0%)

Query  9    KTFNLSPPSMLALGFLSFIVAGTLLLKLPISNNGHLSWMDAFFTATSAVTITGLSVINIG  68
            KT NLSPPS+LALGFL FIV GTLLLKLPI+NNGH+SWMDA FTATSAVTITGLSV+NI 
Sbjct  9    KTLNLSPPSLLALGFLGFIVFGTLLLKLPIANNGHVSWMDALFTATSAVTITGLSVLNIH  68

Query  69   QSLTHVGQIILLFLIQCGGLGFMTFAILAALSLAPQLGLKQQLMAQDSMGQTSLSKVTFI  128
            +S T  GQ+I+L LIQ GGLGFMTFAILAALSL+P++GLKQQ+MAQDS+GQTSLSKVTF+
Sbjct  69   ESFTLFGQVIILLLIQSGGLGFMTFAILAALSLSPKVGLKQQMMAQDSLGQTSLSKVTFV  128

Query  129  AQAVFIYTLIFELMGTCILTFAWMNQFGFFHALYYAFFYSISAFNNAGFSLFPNNLMNFQ  188
            A+ V  YTL+FEL+GT ILT A+   +GF   LYYA FYSIS+FNNAGFSLF N+L+NFQ
Sbjct  129  AKGVVTYTLLFELIGTVILTTAFTPIYGFARGLYYAIFYSISSFNNAGFSLFSNSLVNFQ  188

Query  189  THYIACLTISFLYILGGLGFLVIMDIKERKRWKKLSPNSKIVIISIAILNTSAFLIIWLL  248
            ++Y+ C+TIS LY LGGLGFLV+MDIK+ K+WKKLSPNSK+++ +IAI+N  AF++IW+L
Sbjct  189  SNYLICITISLLYTLGGLGFLVLMDIKQNKKWKKLSPNSKLILTTIAIINLVAFVLIWVL  248

Query  249  EVNNPLTLYSMSFSEQALNAWFQATVPRSSGFNTIDIASMNNSSTLLTMFLMFIGGGSLS  308
            E  NP TL  ++  +QALNAWFQATVPRSSGFNTID  +M NSS+LL M LMFIGGGSLS
Sbjct  249  EAQNPHTLGLLNVGDQALNAWFQATVPRSSGFNTIDTGAMTNSSSLLMMLLMFIGGGSLS  308

Query  309  TAGGIKVGTFVILVFSVIAFLKRHDEVRIFNHSISYENTFKALAVVVITLILIFIGFFSI  368
            TAGGIKVGTFVILV SV++FL+R DE+R+FNHS+S+E T+KALAV  IT ILIFIGFF +
Sbjct  309  TAGGIKVGTFVILVLSVLSFLRRTDEIRVFNHSVSHETTYKALAVTAITSILIFIGFFIL  368

Query  369  LILEPHKNFLDLFFEIVSAACTVGLSRGITPQLNNSSLFVLSLLMYAGRLGPLTLAYLIA  428
            L+LEP  +F++L FE+VSAACTVGLSRGITP L+N SLF+LSLLM+AGRLGPLTLAYLIA
Sbjct  369  LLLEPKADFMNLLFEVVSAACTVGLSRGITPDLHNGSLFILSLLMFAGRLGPLTLAYLIA  428

Query  429  TPKKSRLKHPSADIQIG  445
            TPKKSRLKHP A+IQIG
Sbjct  429  TPKKSRLKHPQANIQIG  445


 Score = 26.2 bits (56),  Expect = 0.058
 Identities = 43/160 (27%), Positives = 69/160 (43%), Gaps = 23/160 (14%)

Query  5    KINQKTFNLSPPSMLALGFLSFI--VAGTLLLKLPISNNGHLSW-------MDAFFTATS  55
            K N+K   LSP S L L  ++ I  VA  L+  L   N   L         ++A+F AT 
Sbjct  215  KQNKKWKKLSPNSKLILTTIAIINLVAFVLIWVLEAQNPHTLGLLNVGDQALNAWFQAT-  273

Query  56   AVTITGLSVINIGQSLTHVGQIILLFLI--------QCGGLGFMTFAILAALSLAPQLGL  107
                +G + I+ G ++T+   ++++ L+          GG+   TF IL  LS+   L  
Sbjct  274  VPRSSGFNTIDTG-AMTNSSSLLMMLLMFIGGGSLSTAGGIKVGTFVIL-VLSVLSFLRR  331

Query  108  KQQLMAQDSMGQTSLSKVTFIAQAVFIYTLIFELMGTCIL  147
              ++        +   + T+ A AV   T I   +G  IL
Sbjct  332  TDEIRV---FNHSVSHETTYKALAVTAITSILIFIGFFIL  368


> A0A171F1Z6 Potassium uptake protein, TrkH family [Acinetobacter 
baumannii Naval-82]
Length=445

 Score =  650 bits (1678),  Expect = 0.0
 Identities = 323/437 (74%), Positives = 382/437 (87%), Gaps = 0/437 (0%)

Query  9    KTFNLSPPSMLALGFLSFIVAGTLLLKLPISNNGHLSWMDAFFTATSAVTITGLSVINIG  68
            KT NLSPPS+LALGFL FIV GTLLLKLPI+NNGH+SWMDA FTATSAVTITGLSV+NI 
Sbjct  9    KTLNLSPPSLLALGFLGFIVFGTLLLKLPIANNGHVSWMDALFTATSAVTITGLSVLNIH  68

Query  69   QSLTHVGQIILLFLIQCGGLGFMTFAILAALSLAPQLGLKQQLMAQDSMGQTSLSKVTFI  128
            +S T  GQ+I+L LIQ GGLGFMTFAILAALSL+P++GLKQQ+MAQDS+GQTSLSKVTF+
Sbjct  69   ESFTLFGQVIILLLIQSGGLGFMTFAILAALSLSPKVGLKQQMMAQDSLGQTSLSKVTFV  128

Query  129  AQAVFIYTLIFELMGTCILTFAWMNQFGFFHALYYAFFYSISAFNNAGFSLFPNNLMNFQ  188
            A+ V  YTL+FEL+GT ILT A+   +GF   LYYA FYSIS+FNNAGFSLF N+L+NFQ
Sbjct  129  AKGVVTYTLLFELIGTVILTTAFTPIYGFARGLYYAVFYSISSFNNAGFSLFSNSLVNFQ  188

Query  189  THYIACLTISFLYILGGLGFLVIMDIKERKRWKKLSPNSKIVIISIAILNTSAFLIIWLL  248
            ++Y+ C+TIS LY LGGLGFLV+MDIK+ K+WKKLSPNSK+++ +IAI+N  AF++IW+L
Sbjct  189  SNYLICITISLLYTLGGLGFLVLMDIKQNKKWKKLSPNSKLILTTIAIINLVAFVLIWVL  248

Query  249  EVNNPLTLYSMSFSEQALNAWFQATVPRSSGFNTIDIASMNNSSTLLTMFLMFIGGGSLS  308
            E  NP TL  ++  +QALNAWFQATVPRSSGFNTID  +M NSS+LL M LMFIGGGSLS
Sbjct  249  EAQNPHTLGLLNVGDQALNAWFQATVPRSSGFNTIDTGAMTNSSSLLMMLLMFIGGGSLS  308

Query  309  TAGGIKVGTFVILVFSVIAFLKRHDEVRIFNHSISYENTFKALAVVVITLILIFIGFFSI  368
            TAGGIKVGTFVILV SV++FL+R DE+R+FNHS+S+E T+KALAV  IT ILIFIGFF +
Sbjct  309  TAGGIKVGTFVILVLSVLSFLRRTDEIRVFNHSVSHETTYKALAVTAITSILIFIGFFIL  368

Query  369  LILEPHKNFLDLFFEIVSAACTVGLSRGITPQLNNSSLFVLSLLMYAGRLGPLTLAYLIA  428
            L+LEP  +F++L FE+VSAACTVGLSRGITP L+N SLF+LSLLM+AGRLGPLTLAYLIA
Sbjct  369  LLLEPKADFMNLLFEVVSAACTVGLSRGITPDLHNGSLFILSLLMFAGRLGPLTLAYLIA  428

Query  429  TPKKSRLKHPSADIQIG  445
            TPKKSRLKHP A+IQIG
Sbjct  429  TPKKSRLKHPQANIQIG  445


 Score = 26.2 bits (56),  Expect = 0.058
 Identities = 43/160 (27%), Positives = 69/160 (43%), Gaps = 23/160 (14%)

Query  5    KINQKTFNLSPPSMLALGFLSFI--VAGTLLLKLPISNNGHLSW-------MDAFFTATS  55
            K N+K   LSP S L L  ++ I  VA  L+  L   N   L         ++A+F AT 
Sbjct  215  KQNKKWKKLSPNSKLILTTIAIINLVAFVLIWVLEAQNPHTLGLLNVGDQALNAWFQAT-  273

Query  56   AVTITGLSVINIGQSLTHVGQIILLFLI--------QCGGLGFMTFAILAALSLAPQLGL  107
                +G + I+ G ++T+   ++++ L+          GG+   TF IL  LS+   L  
Sbjct  274  VPRSSGFNTIDTG-AMTNSSSLLMMLLMFIGGGSLSTAGGIKVGTFVIL-VLSVLSFLRR  331

Query  108  KQQLMAQDSMGQTSLSKVTFIAQAVFIYTLIFELMGTCIL  147
              ++        +   + T+ A AV   T I   +G  IL
Sbjct  332  TDEIRV---FNHSVSHETTYKALAVTAITSILIFIGFFIL  368


> A0A090B5E9 K+ uptake system protein [Acinetobacter baumannii]
Length=445

 Score =  650 bits (1678),  Expect = 0.0
 Identities = 323/437 (74%), Positives = 382/437 (87%), Gaps = 0/437 (0%)

Query  9    KTFNLSPPSMLALGFLSFIVAGTLLLKLPISNNGHLSWMDAFFTATSAVTITGLSVINIG  68
            KT NLSPPS+LALGFL FIV GTLLLKLPI+NNGH+SWMDA FTATSAVTITGLSV+NI 
Sbjct  9    KTLNLSPPSLLALGFLGFIVFGTLLLKLPIANNGHVSWMDALFTATSAVTITGLSVLNIH  68

Query  69   QSLTHVGQIILLFLIQCGGLGFMTFAILAALSLAPQLGLKQQLMAQDSMGQTSLSKVTFI  128
            +S T  GQ+I+L LIQ GGLGFMTFAILAALSL+P++GLKQQ+MAQDS+GQTSLSKVTF+
Sbjct  69   ESFTLFGQVIILLLIQSGGLGFMTFAILAALSLSPKVGLKQQMMAQDSLGQTSLSKVTFV  128

Query  129  AQAVFIYTLIFELMGTCILTFAWMNQFGFFHALYYAFFYSISAFNNAGFSLFPNNLMNFQ  188
            A+ V  YTL+FEL+GT ILT A+   +GF   LYYA FYSIS+FNNAGFSLF N+L+NFQ
Sbjct  129  AKGVVTYTLLFELIGTVILTTAFTPIYGFARGLYYAVFYSISSFNNAGFSLFSNSLVNFQ  188

Query  189  THYIACLTISFLYILGGLGFLVIMDIKERKRWKKLSPNSKIVIISIAILNTSAFLIIWLL  248
            ++Y+ C+TIS LY LGGLGFLV+MDIK+ K+WKKLSPNSK+++ +IAI+N  AF++IW+L
Sbjct  189  SNYLICITISLLYTLGGLGFLVLMDIKQNKKWKKLSPNSKLILTTIAIINLVAFVLIWVL  248

Query  249  EVNNPLTLYSMSFSEQALNAWFQATVPRSSGFNTIDIASMNNSSTLLTMFLMFIGGGSLS  308
            E  NP TL  ++  +QALNAWFQATVPRSSGFNTID  +M NSS+LL M LMFIGGGSLS
Sbjct  249  EAQNPHTLGLLNVGDQALNAWFQATVPRSSGFNTIDTGAMTNSSSLLMMLLMFIGGGSLS  308

Query  309  TAGGIKVGTFVILVFSVIAFLKRHDEVRIFNHSISYENTFKALAVVVITLILIFIGFFSI  368
            TAGGIKVGTFVILV SV++FL+R DE+R+FNHS+S+E T+KALAV  IT ILIFIGFF +
Sbjct  309  TAGGIKVGTFVILVLSVLSFLRRTDEIRVFNHSVSHETTYKALAVTAITSILIFIGFFIL  368

Query  369  LILEPHKNFLDLFFEIVSAACTVGLSRGITPQLNNSSLFVLSLLMYAGRLGPLTLAYLIA  428
            L+LEP  +F++L FE+VSAACTVGLSRGITP L+N SLF+LSLLM+AGRLGPLTLAYLIA
Sbjct  369  LLLEPKADFMNLLFEVVSAACTVGLSRGITPDLHNGSLFILSLLMFAGRLGPLTLAYLIA  428

Query  429  TPKKSRLKHPSADIQIG  445
            TPKKSRLKHP A+IQIG
Sbjct  429  TPKKSRLKHPQANIQIG  445


 Score = 26.2 bits (56),  Expect = 0.058
 Identities = 43/160 (27%), Positives = 69/160 (43%), Gaps = 23/160 (14%)

Query  5    KINQKTFNLSPPSMLALGFLSFI--VAGTLLLKLPISNNGHLSW-------MDAFFTATS  55
            K N+K   LSP S L L  ++ I  VA  L+  L   N   L         ++A+F AT 
Sbjct  215  KQNKKWKKLSPNSKLILTTIAIINLVAFVLIWVLEAQNPHTLGLLNVGDQALNAWFQAT-  273

Query  56   AVTITGLSVINIGQSLTHVGQIILLFLI--------QCGGLGFMTFAILAALSLAPQLGL  107
                +G + I+ G ++T+   ++++ L+          GG+   TF IL  LS+   L  
Sbjct  274  VPRSSGFNTIDTG-AMTNSSSLLMMLLMFIGGGSLSTAGGIKVGTFVIL-VLSVLSFLRR  331

Query  108  KQQLMAQDSMGQTSLSKVTFIAQAVFIYTLIFELMGTCIL  147
              ++        +   + T+ A AV   T I   +G  IL
Sbjct  332  TDEIRV---FNHSVSHETTYKALAVTAITSILIFIGFFIL  368


> A0A009GUL4 Ktr system potassium uptake protein B [Acinetobacter 
baumannii 118362]
Length=445

 Score =  650 bits (1678),  Expect = 0.0
 Identities = 323/437 (74%), Positives = 382/437 (87%), Gaps = 0/437 (0%)

Query  9    KTFNLSPPSMLALGFLSFIVAGTLLLKLPISNNGHLSWMDAFFTATSAVTITGLSVINIG  68
            KT NLSPPS+LALGFL FIV GTLLLKLPI+NNGH+SWMDA FTATSAVTITGLSV+NI 
Sbjct  9    KTLNLSPPSLLALGFLGFIVFGTLLLKLPIANNGHVSWMDALFTATSAVTITGLSVLNIH  68

Query  69   QSLTHVGQIILLFLIQCGGLGFMTFAILAALSLAPQLGLKQQLMAQDSMGQTSLSKVTFI  128
            +S T  GQ+I+L LIQ GGLGFMTFAILAALSL+P++GLKQQ+MAQDS+GQTSLSKVTF+
Sbjct  69   ESFTLFGQVIILLLIQSGGLGFMTFAILAALSLSPKVGLKQQMMAQDSLGQTSLSKVTFV  128

Query  129  AQAVFIYTLIFELMGTCILTFAWMNQFGFFHALYYAFFYSISAFNNAGFSLFPNNLMNFQ  188
            A+ V  YTL+FEL+GT ILT A+   +GF   LYYA FYSIS+FNNAGFSLF N+L+NFQ
Sbjct  129  AKGVVTYTLLFELIGTVILTTAFTPIYGFARGLYYAVFYSISSFNNAGFSLFSNSLVNFQ  188

Query  189  THYIACLTISFLYILGGLGFLVIMDIKERKRWKKLSPNSKIVIISIAILNTSAFLIIWLL  248
            ++Y+ C+TIS LY LGGLGFLV+MDIK+ K+WKKLSPNSK+++ +IAI+N  AF++IW+L
Sbjct  189  SNYLICITISLLYTLGGLGFLVLMDIKQNKKWKKLSPNSKLILTTIAIINLVAFVLIWVL  248

Query  249  EVNNPLTLYSMSFSEQALNAWFQATVPRSSGFNTIDIASMNNSSTLLTMFLMFIGGGSLS  308
            E  NP TL  ++  +QALNAWFQATVPRSSGFNTID  +M NSS+LL M LMFIGGGSLS
Sbjct  249  EAQNPHTLGLLNVGDQALNAWFQATVPRSSGFNTIDTGAMTNSSSLLMMLLMFIGGGSLS  308

Query  309  TAGGIKVGTFVILVFSVIAFLKRHDEVRIFNHSISYENTFKALAVVVITLILIFIGFFSI  368
            TAGGIKVGTFVILV SV++FL+R DE+R+FNHS+S+E T+KALAV  IT ILIFIGFF +
Sbjct  309  TAGGIKVGTFVILVLSVLSFLRRTDEIRVFNHSVSHETTYKALAVTAITSILIFIGFFIL  368

Query  369  LILEPHKNFLDLFFEIVSAACTVGLSRGITPQLNNSSLFVLSLLMYAGRLGPLTLAYLIA  428
            L+LEP  +F++L FE+VSAACTVGLSRGITP L+N SLF+LSLLM+AGRLGPLTLAYLIA
Sbjct  369  LLLEPKADFMNLLFEVVSAACTVGLSRGITPDLHNGSLFILSLLMFAGRLGPLTLAYLIA  428

Query  429  TPKKSRLKHPSADIQIG  445
            TPKKSRLKHP A+IQIG
Sbjct  429  TPKKSRLKHPQANIQIG  445


 Score = 26.2 bits (56),  Expect = 0.058
 Identities = 43/160 (27%), Positives = 69/160 (43%), Gaps = 23/160 (14%)

Query  5    KINQKTFNLSPPSMLALGFLSFI--VAGTLLLKLPISNNGHLSW-------MDAFFTATS  55
            K N+K   LSP S L L  ++ I  VA  L+  L   N   L         ++A+F AT 
Sbjct  215  KQNKKWKKLSPNSKLILTTIAIINLVAFVLIWVLEAQNPHTLGLLNVGDQALNAWFQAT-  273

Query  56   AVTITGLSVINIGQSLTHVGQIILLFLI--------QCGGLGFMTFAILAALSLAPQLGL  107
                +G + I+ G ++T+   ++++ L+          GG+   TF IL  LS+   L  
Sbjct  274  VPRSSGFNTIDTG-AMTNSSSLLMMLLMFIGGGSLSTAGGIKVGTFVIL-VLSVLSFLRR  331

Query  108  KQQLMAQDSMGQTSLSKVTFIAQAVFIYTLIFELMGTCIL  147
              ++        +   + T+ A AV   T I   +G  IL
Sbjct  332  TDEIRV---FNHSVSHETTYKALAVTAITSILIFIGFFIL  368


> A0A009SFV7 Ktr system potassium uptake protein B [Acinetobacter 
baumannii 99063]
Length=445

 Score =  650 bits (1678),  Expect = 0.0
 Identities = 323/437 (74%), Positives = 382/437 (87%), Gaps = 0/437 (0%)

Query  9    KTFNLSPPSMLALGFLSFIVAGTLLLKLPISNNGHLSWMDAFFTATSAVTITGLSVINIG  68
            KT NLSPPS+LALGFL FIV GTLLLKLPI+NNGH+SWMDA FTATSAVTITGLSV+NI 
Sbjct  9    KTLNLSPPSLLALGFLGFIVFGTLLLKLPIANNGHVSWMDALFTATSAVTITGLSVLNIH  68

Query  69   QSLTHVGQIILLFLIQCGGLGFMTFAILAALSLAPQLGLKQQLMAQDSMGQTSLSKVTFI  128
            +S T  GQ+I+L LIQ GGLGFMTFAILAALSL+P++GLKQQ+MAQDS+GQTSLSKVTF+
Sbjct  69   ESFTLFGQVIILLLIQSGGLGFMTFAILAALSLSPKVGLKQQMMAQDSLGQTSLSKVTFV  128

Query  129  AQAVFIYTLIFELMGTCILTFAWMNQFGFFHALYYAFFYSISAFNNAGFSLFPNNLMNFQ  188
            A+ V  YTL+FEL+GT ILT A+   +GF   LYYA FYSIS+FNNAGFSLF N+L+NFQ
Sbjct  129  AKGVVTYTLLFELIGTVILTTAFTPIYGFARGLYYAVFYSISSFNNAGFSLFSNSLVNFQ  188

Query  189  THYIACLTISFLYILGGLGFLVIMDIKERKRWKKLSPNSKIVIISIAILNTSAFLIIWLL  248
            ++Y+ C+TIS LY LGGLGFLV+MDIK+ K+WKKLSPNSK+++ +IAI+N  AF++IW+L
Sbjct  189  SNYLICITISLLYTLGGLGFLVLMDIKQNKKWKKLSPNSKLILTTIAIINLVAFVLIWVL  248

Query  249  EVNNPLTLYSMSFSEQALNAWFQATVPRSSGFNTIDIASMNNSSTLLTMFLMFIGGGSLS  308
            E  NP TL  ++  +QALNAWFQATVPRSSGFNTID  +M NSS+LL M LMFIGGGSLS
Sbjct  249  EAQNPHTLGLLNVGDQALNAWFQATVPRSSGFNTIDTGAMTNSSSLLMMLLMFIGGGSLS  308

Query  309  TAGGIKVGTFVILVFSVIAFLKRHDEVRIFNHSISYENTFKALAVVVITLILIFIGFFSI  368
            TAGGIKVGTFVILV SV++FL+R DE+R+FNHS+S+E T+KALAV  IT ILIFIGFF +
Sbjct  309  TAGGIKVGTFVILVLSVLSFLRRTDEIRVFNHSVSHETTYKALAVTAITSILIFIGFFIL  368

Query  369  LILEPHKNFLDLFFEIVSAACTVGLSRGITPQLNNSSLFVLSLLMYAGRLGPLTLAYLIA  428
            L+LEP  +F++L FE+VSAACTVGLSRGITP L+N SLF+LSLLM+AGRLGPLTLAYLIA
Sbjct  369  LLLEPKADFMNLLFEVVSAACTVGLSRGITPDLHNGSLFILSLLMFAGRLGPLTLAYLIA  428

Query  429  TPKKSRLKHPSADIQIG  445
            TPKKSRLKHP A+IQIG
Sbjct  429  TPKKSRLKHPQANIQIG  445


 Score = 26.2 bits (56),  Expect = 0.058
 Identities = 43/160 (27%), Positives = 69/160 (43%), Gaps = 23/160 (14%)

Query  5    KINQKTFNLSPPSMLALGFLSFI--VAGTLLLKLPISNNGHLSW-------MDAFFTATS  55
            K N+K   LSP S L L  ++ I  VA  L+  L   N   L         ++A+F AT 
Sbjct  215  KQNKKWKKLSPNSKLILTTIAIINLVAFVLIWVLEAQNPHTLGLLNVGDQALNAWFQAT-  273

Query  56   AVTITGLSVINIGQSLTHVGQIILLFLI--------QCGGLGFMTFAILAALSLAPQLGL  107
                +G + I+ G ++T+   ++++ L+          GG+   TF IL  LS+   L  
Sbjct  274  VPRSSGFNTIDTG-AMTNSSSLLMMLLMFIGGGSLSTAGGIKVGTFVIL-VLSVLSFLRR  331

Query  108  KQQLMAQDSMGQTSLSKVTFIAQAVFIYTLIFELMGTCIL  147
              ++        +   + T+ A AV   T I   +G  IL
Sbjct  332  TDEIRV---FNHSVSHETTYKALAVTAITSILIFIGFFIL  368


> A0A013T2G0 Ktr system potassium uptake protein B [Acinetobacter 
baumannii 573719]
Length=445

 Score =  650 bits (1676),  Expect = 0.0
 Identities = 325/437 (74%), Positives = 379/437 (87%), Gaps = 0/437 (0%)

Query  9    KTFNLSPPSMLALGFLSFIVAGTLLLKLPISNNGHLSWMDAFFTATSAVTITGLSVINIG  68
            KT NLSPPS+LALGFL FI  GTLLLKLP +N G++SWMDA FTATSAVTITGLSV+NI 
Sbjct  9    KTLNLSPPSLLALGFLGFIAFGTLLLKLPFANTGNVSWMDALFTATSAVTITGLSVLNIH  68

Query  69   QSLTHVGQIILLFLIQCGGLGFMTFAILAALSLAPQLGLKQQLMAQDSMGQTSLSKVTFI  128
            +S T  GQ I+L LIQ GGLGFMTFAILAALSL+P++GLKQQ+MAQDS+GQTSLSKVTF+
Sbjct  69   ESFTLFGQTIILLLIQSGGLGFMTFAILAALSLSPKVGLKQQMMAQDSLGQTSLSKVTFV  128

Query  129  AQAVFIYTLIFELMGTCILTFAWMNQFGFFHALYYAFFYSISAFNNAGFSLFPNNLMNFQ  188
            A+ V  YTLIFEL+GT ILT A++  +GF H LYYA FYSIS+FNNAGFSLF N+LMNFQ
Sbjct  129  AKGVVTYTLIFELIGTVILTTAFIPTYGFAHGLYYAAFYSISSFNNAGFSLFSNSLMNFQ  188

Query  189  THYIACLTISFLYILGGLGFLVIMDIKERKRWKKLSPNSKIVIISIAILNTSAFLIIWLL  248
            ++YI C+TIS LY LGGLGFLV+MDIK+ KRWKKL+PNSK+++ +IAI+N  AF++IW L
Sbjct  189  SNYIICITISILYTLGGLGFLVLMDIKQNKRWKKLTPNSKLILTTIAIINLVAFILIWAL  248

Query  249  EVNNPLTLYSMSFSEQALNAWFQATVPRSSGFNTIDIASMNNSSTLLTMFLMFIGGGSLS  308
            E  NP TL  ++  EQALNAWFQATVPRSSGFNTID  +M NSS+LL M LMFIGGGSLS
Sbjct  249  EAQNPATLGMLNSGEQALNAWFQATVPRSSGFNTIDTGAMTNSSSLLMMLLMFIGGGSLS  308

Query  309  TAGGIKVGTFVILVFSVIAFLKRHDEVRIFNHSISYENTFKALAVVVITLILIFIGFFSI  368
            TAGGIKVGTFVILV SVI+FL+R DE+RIFNHS+S+E T+KALAV  IT ILIF+GFF +
Sbjct  309  TAGGIKVGTFVILVLSVISFLRRTDEIRIFNHSVSHETTYKALAVTAITSILIFMGFFIL  368

Query  369  LILEPHKNFLDLFFEIVSAACTVGLSRGITPQLNNSSLFVLSLLMYAGRLGPLTLAYLIA  428
            L+LEP  +F++L FE+VSAACTVGLSRGITP L+N SLF+LSLLM+AGRLGPLTLAYLIA
Sbjct  369  LLLEPKADFMNLLFEVVSAACTVGLSRGITPDLHNGSLFILSLLMFAGRLGPLTLAYLIA  428

Query  429  TPKKSRLKHPSADIQIG  445
            TPKKSRLKHP A+IQIG
Sbjct  429  TPKKSRLKHPQANIQIG  445


> O30362 Putative TrkG [Thermoanaerobacter ethanolicus]
Length=350

 Score =  234 bits (596),  Expect = 6e-75
 Identities = 128/350 (37%), Positives = 205/350 (59%), Gaps = 6/350 (2%)

Query  101  LAPQLGLKQQLMAQDSMGQTSLSKVTFIAQAVFIYTLIFELMGTCILTFAWMNQFGFFHA  160
            L  ++  K++L+ Q++    SL  +   A+ + + + +FE +G  +LT  ++ Q G   A
Sbjct  2    LGRKITFKERLVMQEAFNTNSLGGIVKFAKYILMVSFLFESIGAIMLTLRFLPQMGLKKA  61

Query  161  LYYAFFYSISAFNNAGFSLFPN--NLMNFQTHYIACLTISFLYILGGLGFLVIMDIKERK  218
            +YY  F+SISAFNNAGF L  N  +L  + + ++  L +  L I GGLGF V++DI E +
Sbjct  62   VYYGLFHSISAFNNAGFDLMGNFKSLTGYVSDWVVNLVVMGLIIFGGLGFYVLLDIYEHR  121

Query  219  RWKKLSPNSKIVIISIAILNTSAFLIIWLLEVNNPLTLYSMSFSEQALNAWFQATVPRSS  278
             + K + +SKIVI    +L     L+I+L E NNP TL  + F  + L A FQA  PR++
Sbjct  122  HFNKFTLHSKIVITITLLLIAIGTLLIFLFEYNNPKTLGPLDFPTKILAALFQAVTPRTA  181

Query  279  GFNTIDIASMNNSSTLLTMFLMFIGGGSLSTAGGIKVGTFVILVFSVIAFLKRHDEVRIF  338
            GFNT+ ++ M  +S  LT+ LMFIG     T GGIK  TF +++++V++ ++  +E  ++
Sbjct  182  GFNTLSLSDMTIASKFLTIILMFIGASPAGTGGGIKTTTFAVILYTVLSVIQGEEETVLY  241

Query  339  NHSISYENTFKALAVVVITLILIFIGFFSILILEPHKNFLDLFFEIVSAACTVGLSRGIT  398
              +IS    +KA+A+  I++ +IF     +L +    NFL + +E  SA  TVGLS G+T
Sbjct  242  KRTISRNIVYKAVAISFISVFIIF-SVTMVLSITETSNFLTVLYETTSAFGTVGLSLGLT  300

Query  399  PQLNNSSLFVLSLLMYAGRLGPLTLAYLIATPK---KSRLKHPSADIQIG  445
            P+L+     ++   MY GR+GPLTLA  +A  +   K  +K+    I +G
Sbjct  301  PELSTVGKIIIIFTMYTGRVGPLTLALALAKRQRRPKPIIKYAEEKIMVG  350


 Score = 21.9 bits (45),  Expect = 1.2
 Identities = 57/285 (20%), Positives = 105/285 (37%), Gaps = 65/285 (23%)

Query  51   FTATSAVTITGLSVINIGQSLTH-----VGQIILLFLIQCGGLGFMTFAILAALSLAPQL  105
            F + SA    G  ++   +SLT      V  ++++ LI  GGLGF               
Sbjct  67   FHSISAFNNAGFDLMGNFKSLTGYVSDWVVNLVVMGLIIFGGLGFYVLL-----------  115

Query  106  GLKQQLMAQDSMGQTSLSKVTFIAQAVFIYTLIFELMGT-CILTFAWMN-----QFGFFH  159
                     D       +K T  ++ V   TL+   +GT  I  F + N        F  
Sbjct  116  ---------DIYEHRHFNKFTLHSKIVITITLLLIAIGTLLIFLFEYNNPKTLGPLDFPT  166

Query  160  ALYYAFFYSISAFNNAGFSLFPNNLMNFQTHYIACL----------------TISFLYIL  203
             +  A F +++    AGF+    + M   + ++  +                T +F  IL
Sbjct  167  KILAALFQAVTP-RTAGFNTLSLSDMTIASKFLTIILMFIGASPAGTGGGIKTTTFAVIL  225

Query  204  GGLGFLVIMDIKERKRWKKLSPNSKIVIISIAILNTSAFLIIWLLEVNNPLTLYSMSFSE  263
                 L ++  +E     K + +  IV  ++AI   S F+I  +  V       S++ + 
Sbjct  226  --YTVLSVIQGEEETVLYKRTISRNIVYKAVAISFISVFIIFSVTMV------LSITETS  277

Query  264  QALNAWFQATVPRSSGFNTIDIA-----SMNNSSTLLTMFLMFIG  303
              L   ++ T    S F T+ ++      ++    ++ +F M+ G
Sbjct  278  NFLTVLYETT----SAFGTVGLSLGLTPELSTVGKIIIIFTMYTG  318


> A9IZZ6 Na+-transporting ATP synthase [Staphylococcus capitis]
Length=315

 Score =  181 bits (459),  Expect = 2e-55
 Identities = 106/298 (36%), Positives = 171/298 (57%), Gaps = 3/298 (1%)

Query  23   FLSFIVAGTLLLKLPISNNGHLSWMDAFFTATSAVTITGLSVINIGQSLTHVGQIILLFL  82
            FL   + G  LL LP +    ++++DA F A+SA T+TGLS +++G      G+II+L L
Sbjct  15   FLLTTLIGAFLLYLPYTGKKPINFIDALFVASSAFTVTGLSPVDVGTQFNIFGEIIILLL  74

Query  83   IQCGGLGFMTFAILAALSLAPQLGLKQQLMAQDSMGQTSLSKVTFIAQAVFIYTLIFELM  142
            IQ GGLG +T A+L  + L  ++ +  +++   +        V  + + + IY++  EL 
Sbjct  75   IQIGGLGIVTVAMLTLIFLNKKISINNRILFMTTWNIDEPGGVIKLIKHLAIYSIATELF  134

Query  143  GTCILTFAWMNQFGFFHALYYAFFYSISAFNNAGFSLFPNNLMNFQTHYIACLTISFLYI  202
            GT  L  +++ +FG    L+ + F S+SAFNNAGF+LF NNL++F    +  +TI  L I
Sbjct  135  GTLCLCLSFIPKFGIGKGLFLSLFTSVSAFNNAGFALFKNNLIDFSNDPVIIITIPILII  194

Query  203  LGGLGFLVIMDIKERKRWKKLSPNSKIVIISIAILNTSAFLIIWLLEVNNPLTLYSMSFS  262
            LGGLG LV++D+   K ++KLS +SK+V+ +  +L     +  +LLE  N  ++  M   
Sbjct  195  LGGLGHLVVVDLWNAKSFRKLSLHSKLVLTTTGLLILIGTVFFFLLENQN--SMLHMGLI  252

Query  263  EQALNAWFQATVPRSSGFNTIDIASMNNSSTLLTMFLMFIGGGSLSTAGGIKVGTFVI  320
            E+  NA+FQ+   R++GFNTID+ ++ +   L T         ++      KV TFVI
Sbjct  253  EKIGNAFFQSVTTRTAGFNTIDVGNIKHRQ-LYTYGSHVYWRCTIECCRWYKVTTFVI  309


 Score = 30.0 bits (66),  Expect = 0.003
 Identities = 24/77 (31%), Positives = 37/77 (48%), Gaps = 4/77 (5%)

Query  354  VVITLILIFIGFFSILILEPHK---NFLDLFFEIVSAACTVGLSR-GITPQLNNSSLFVL  409
            +++ L+   IG F + +    K   NF+D  F   SA    GLS   +  Q N     ++
Sbjct  12   LMLFLLTTLIGAFLLYLPYTGKKPINFIDALFVASSAFTVTGLSPVDVGTQFNIFGEIII  71

Query  410  SLLMYAGRLGPLTLAYL  426
             LL+  G LG +T+A L
Sbjct  72   LLLIQIGGLGIVTVAML  88


 Score = 23.9 bits (50),  Expect = 0.28
 Identities = 24/83 (29%), Positives = 36/83 (43%), Gaps = 3/83 (4%)

Query  312  GIKVGTFVILVFSVIAFLKRHDEVRIF-NHSISYENTFKALAVVVITLILIFIGFFSILI  370
            GI  G F+ L  SV AF   +    +F N+ I + N    +  + I +IL  +G   ++ 
Sbjct  148  GIGKGLFLSLFTSVSAF--NNAGFALFKNNLIDFSNDPVIIITIPILIILGGLGHLVVVD  205

Query  371  LEPHKNFLDLFFEIVSAACTVGL  393
            L   K+F  L         T GL
Sbjct  206  LWNAKSFRKLSLHSKLVLTTTGL  228


> Q9ZF91 Uncharacterized protein ykrM [Bacillus megaterium]
Length=319

 Score =  127 bits (320),  Expect = 7e-36
 Identities = 85/319 (27%), Positives = 157/319 (49%), Gaps = 11/319 (3%)

Query  4    QKINQKTFNLSPPSMLALGFLSFIVAGTLLLKLP--ISNNGHLSWMDAFFTATSAVTITG  61
            Q   ++   +S   ++   ++  +  G LLL +P  +     L+++D  F A SAV++TG
Sbjct  3    QPWKRRVRQMSSAQIIVTFYIVAVTLGFLLLSIPEALRPGAKLAFIDRLFIAVSAVSVTG  62

Query  62   LSVINIGQSLTHVGQIILLFLIQCGGLGFMTFAILAALSLAPQLGLKQQLMAQDSMGQTS  121
            L+ ++   + +  G  +L+F+ Q GG+G MT +    + L  ++GLK++ +      Q+ 
Sbjct  63   LTPVSTPDTFSTTGYFLLVFIFQIGGIGVMTLSTFIWMILGKKIGLKERQLIMTDHNQSR  122

Query  122  LSKVTFIAQAVFIYTLIFELMGTCILTFAWMNQF-GFFHALYYAFFYSISAFNNAGFSLF  180
            LS +  + + +       EL+G  IL   ++  +  +  A  + FF S+SA  NAGF + 
Sbjct  123  LSGLVDLMRNILFIIFAIELVGAIILGLHFLRYYSSWTDAFLHGFFASVSATTNAGFDIT  182

Query  181  PNNLMNFQTHYIACLTISFLYILGGLGFLVIMDIK------ERKRWKKLSPNSKIVIISI  234
             ++ + +   Y   +    L  LG +GF V+++IK      + KR  + S  +K+  I  
Sbjct  183  GSSFIPYAHDYFVQVVTVILITLGAIGFPVLIEIKHYFLTFKDKRKFQFSLFTKLTTIMF  242

Query  235  AILNTSAFLIIWLLEVNNPLTLYSMSFSEQALNAWFQATVPRSSGFNTIDIASMNNSSTL  294
             +L     ++I +LE +    L   S+ E    A+FQ+   RS G  T++I   +  + +
Sbjct  243  FLLLGGGTILILVLEHSG--FLADKSWDESFFYAFFQSAATRSGGVATMNINEFSLPTLI  300

Query  295  LTMFLMFIGGGSLSTAGGI  313
            +   +MFIG    S  GGI
Sbjct  301  MMSAMMFIGASPSSVGGGI  319


 Score = 32.3 bits (72),  Expect = 6e-04
 Identities = 23/84 (27%), Positives = 39/84 (46%), Gaps = 6/84 (7%)

Query  350  ALAVVVITLILIFIGFFSILILEPHKN-----FLDLFFEIVSAACTVGLSRGITPQ-LNN  403
            A  +V   ++ + +GF  + I E  +      F+D  F  VSA    GL+   TP   + 
Sbjct  15   AQIIVTFYIVAVTLGFLLLSIPEALRPGAKLAFIDRLFIAVSAVSVTGLTPVSTPDTFST  74

Query  404  SSLFVLSLLMYAGRLGPLTLAYLI  427
            +  F+L  +   G +G +TL+  I
Sbjct  75   TGYFLLVFIFQIGGIGVMTLSTFI  98


 Score = 19.2 bits (38),  Expect = 8.0
 Identities = 10/29 (34%), Positives = 16/29 (55%), Gaps = 0/29 (0%)

Query  353  VVVITLILIFIGFFSILILEPHKNFLDLF  381
            V V+T+ILI +G     +L   K++   F
Sbjct  195  VQVVTVILITLGAIGFPVLIEIKHYFLTF  223


> Q7X3Y7 Trk system potassium uptake protein [Vibrio vulnificus]
Length=481

 Score = 90.9 bits (224),  Expect = 2e-22
 Identities = 109/436 (25%), Positives = 193/436 (44%), Gaps = 45/436 (10%)

Query  11   FNLSPPSMLALGFLSFIVAGTLLLKLPISNNGHLSWMDAFFTATSAVTITGLSVINIGQS  70
            F LS   M  +  L + +A      LP     H+S+ DA+F   S +T TG +V++    
Sbjct  63   FKLSVRDMFLITSLVWTIASAFAA-LPFMFINHISFTDAYFETMSGITTTGSTVLS---G  118

Query  71   LTHVGQIILLF---LIQCGGLGFMTFAILAALSLAPQLGLKQQLMAQDSMGQTSLSKVTF  127
            L ++   ILL+   L   GG+GF+  A+ A L +    G+K            S  +   
Sbjct  119  LDNMAPSILLWRSILQWLGGIGFIVMAV-AVLPMLNVGGMKLFQTESSDWSDKSSPRAKT  177

Query  128  IAQAVFIYTLIFELMGTCILTFAWMNQFGFFHALYYAFFYSISAFNNAGFSLFPNNLMNF  187
            +A+ + +  L+  L G C++ +  +     F A+ ++F    +  +  G+S    ++ +F
Sbjct  178  VAKNIVVVYLV--LTGLCLIGYL-LTGMNLFDAINHSF----TTLSTGGYSTSDGSMNHF  230

Query  188  QT--HYIACLTISFLYILGGLGFLVIMDIKERKRWKKLSPNSKIVIISIAILNTSAFLII  245
                H++A L   F++ LGGL FL+ +    ++R   L  ++++   +   L TS  +  
Sbjct  231  SNGAHWVATL---FMF-LGGLPFLLFVSAMRKRRLDALIKDAQVRGFTYLFLGTSLVISA  286

Query  246  WLLEVNNPLTLYSMSFSEQALNAWFQ-ATVPRSSGFNTIDIASMNNSSTLLTMFLMFIGG  304
            WL+ + +  T+     ++    A F   +V  ++GF   D  +     T L  FLM  G 
Sbjct  287  WLV-IRDGYTI-----ADALRVAMFNIVSVVTTTGFGLEDFTAWGALPTTLFAFLMMAGA  340

Query  305  GSLSTAGGIKVGTFVI-----------LVFSVIAFLKRHDEVRIFNHSISYENTFKALAV  353
             S ST+GGIK+  F I           L+     F++R+++ R  N  I    +  A  +
Sbjct  341  CSGSTSGGIKIFRFQIAMTLLNKQIMKLIHPSGIFVQRYNQ-RPVNDDI--VRSVVAFGL  397

Query  354  VVITLILIFIGFFSILILEPHKNFLDLFFEIVSAACTVGLSRGIT---PQLNNSSLFVLS  410
            +    I+   G  S + L+P  +       + +    +G   G T     L +++ ++LS
Sbjct  398  MFFITIIAIAGGLSAMGLDPVTSISGSITAVANVGPGMGSIIGPTGNFAPLPDAAKWLLS  457

Query  411  LLMYAGRLGPLTLAYL  426
              M  GRL  LTL  L
Sbjct  458  FGMLMGRLEILTLLVL  473


> O87729 Trk system potassium uptake protein [Vibrio alginolyticus]
Length=481

 Score = 86.3 bits (212),  Expect = 6e-21
 Identities = 110/436 (25%), Positives = 193/436 (44%), Gaps = 45/436 (10%)

Query  11   FNLSPPSMLALGFLSFIVAGTLLLKLPISNNGHLSWMDAFFTATSAVTITGLSVINIGQS  70
            F LS   M  +  L + +A      LP     H+S+ DA+F   S +T TG +V++    
Sbjct  63   FKLSVRDMFLITSLVWTIASAFAA-LPFVFINHISFTDAYFETMSGITTTGSTVLS---G  118

Query  71   LTHVGQIILLF---LIQCGGLGFMTFAILAALSLAPQLGLKQ-QLMAQDSMGQTSLSKVT  126
            L ++   ILL+   L   GG+GF+  A+ A L +    G+K  Q  + D   ++S    T
Sbjct  119  LDNMAPSILLWRSILQWLGGIGFIVMAV-AVLPMLNVGGMKLFQTESSDWSDKSSPRAKT  177

Query  127  FIAQAVFIYTLIFELMGTCILTFAWMNQFGFFHALYYAFFYSISAFNNAGFSLFPNNLMN  186
                 V +Y +   L G CI+ +  +     F A+ +AF    +  +  G+S    ++ +
Sbjct  178  VAKNIVAVYLM---LTGLCIVGYL-VTGMNLFEAINHAF----TTLSTGGYSTSDGSMNH  229

Query  187  FQT--HYIACLTISFLYILGGLGFLVIMDIKERKRWKKLSPNSKIVIISIAILNTSAFLI  244
            F    H++A    +F++ LGGL FL+ +    ++R   L  ++++   +   + +S  + 
Sbjct  230  FSNGAHWVAT---TFMF-LGGLPFLLFIAALRKRRIDVLVNDAQVRGFAYLFVFSSLVIS  285

Query  245  IWLLEVNNPLTLYSMSFSEQALNAWFQATVPRSSGFNTIDIASMNNSSTLLTMFLMFIGG  304
             WL+  +    L ++  S   +      +V  ++GF   D  +     T L  FLM  G 
Sbjct  286  AWLVIRDGYTILDALRVSMFNI-----VSVVTTTGFGLEDFTAWGALPTTLFAFLMMAGA  340

Query  305  GSLSTAGGIKVGTFVI-----------LVFSVIAFLKRHDEVRIFNHSISYENTFKALAV  353
             S ST+GGIK+  F I           L+     F++R+++ R  N  I    +  A  +
Sbjct  341  CSGSTSGGIKIFRFQIAMTLLNKQMMKLIHPSGVFVQRYNQ-RPVNDDI--VRSVVAFGL  397

Query  354  VVITLILIFIGFFSILILEPHKNFLDLFFEIVSAACTVGLSRGIT---PQLNNSSLFVLS  410
            +    I+   G  S L L+P  +       + +    +G   G T     L +++ ++LS
Sbjct  398  MFFITIIFIAGCLSALGLDPITSISGAITAVANVGPGMGSVIGPTGNFAPLPDTAKWLLS  457

Query  411  LLMYAGRLGPLTLAYL  426
              M  GRL  LT+  L
Sbjct  458  FGMLMGRLEILTILVL  473


> Q9P851 Potassium transport protein [Schwanniomyces occidentalis]
Length=1018

 Score = 66.6 bits (161),  Expect = 2e-14
 Identities = 85/366 (23%), Positives = 149/366 (41%), Gaps = 63/366 (17%)

Query  100  SLAPQLGLKQQLMAQDSMGQTSLSKVTFIAQAVFIYTLIFELMGTCILTFA----WMNQF  155
            S  P +G     +  +   +  L  V + A  + I  LIF  +G  IL F     W+ + 
Sbjct  549  SWVPTVGRNSTFVHLNEEQKEELGGVEYRAIKLLIKILIFYYVGFHILAFIFLLPWILKM  608

Query  156  GFFHAL---------YYAFFYSISAFNNAGFSLFPNNLMNFQTHYIACLTISFLYILGGL  206
              +  +         ++AFF + S+FN+ G +L  +++ +F       + +SF  ++G  
Sbjct  609  PNYSNIVREQGVSPTWWAFFTAQSSFNDLGLTLTADSMQSFNRSIYVMVVMSFFIVIGNT  668

Query  207  GFLVIMDIKERKRWKKLSPNSKI--------------------------VIISIAILNTS  240
            GF V +       +K   P+S                            +   + ++N  
Sbjct  669  GFPVFLRFIIWILFKFARPSSLFKESLGFLLDHPRRCFTLLFPSIPTWWLFSILVVMNVV  728

Query  241  AFLIIWLLEVNNPLTLYSMSFSEQALNAWFQATVPRSSGFNTIDIASMNNSSTLLTMFLM  300
              ++  +L++NN   L  +    + ++  FQA   R++GF  +D++ ++ +  +  M +M
Sbjct  729  DLVLFIILDLNNTY-LEEIPVGYRIMDGLFQAFSTRTAGFTVVDLSQLHPAIQVSYMLMM  787

Query  301  FIGGGSLSTAGGIKVGTFVILVFSVIAFLKRHDEVRIFNHSISYENTFKALA------VV  354
            +I    L  A  I+  T V    S+  +LK  +     N     E T K          +
Sbjct  788  YI--SVLPLAISIR-RTNVYEEQSLGVYLKEDN-----NEHEDVEKTPKTFVGAHLRNQL  839

Query  355  VITLILIFIGFFSILILEPHK--------NFLDLFFEIVSAACTVGLSRGITPQLNNSSL  406
               L  IF+G F I I E  K        +   + FEI+SA  TVGLS G  P +N S  
Sbjct  840  SFDLWFIFLGLFIICIAEGSKLNKNHFRFSVFSILFEIISAYGTVGLSLGF-PNVNASFS  898

Query  407  FVLSLL  412
            + L+ L
Sbjct  899  YELTTL  904


 Score = 29.6 bits (65),  Expect = 0.005
 Identities = 45/205 (22%), Positives = 84/205 (41%), Gaps = 20/205 (10%)

Query  23   FLSFIVAGTLLLKLPISNNGHLSWMDAFFTATSAVTITGLSVINIGQSLTHVGQIILLFL  82
            F+   +  T L ++P+          AF T T+  T+  LS ++    ++++  +++   
Sbjct  733  FIILDLNNTYLEEIPVGYRIMDGLFQAFSTRTAGFTVVDLSQLHPAIQVSYM--LMMYIS  790

Query  83   IQCGGLGFMTFAILAALSLAPQLGLKQQLMAQDSMGQTSLSKVTFIAQAVFIYTLIFELM  142
            +    +      +    SL   + LK+     + + +T  + V    +    + L F  +
Sbjct  791  VLPLAISIRRTNVYEEQSLG--VYLKEDNNEHEDVEKTPKTFVGAHLRNQLSFDLWFIFL  848

Query  143  GT---CILTFAWMNQFGFFHALYYAFFYSISAFNNAGFSL-FPNNLMNFQTHYIACLTIS  198
            G    CI   + +N+  F  +++   F  ISA+   G SL FPN            +  S
Sbjct  849  GLFIICIAEGSKLNKNHFRFSVFSILFEIISAYGTVGLSLGFPN------------VNAS  896

Query  199  FLYILGGLGFLVIMDIKERKRWKKL  223
            F Y L  L  LVI+ +  R R + L
Sbjct  897  FSYELTTLSKLVIIAMMIRGRHRGL  921


 Score = 25.4 bits (54),  Expect = 0.11
 Identities = 24/80 (30%), Positives = 38/80 (48%), Gaps = 12/80 (15%)

Query  24   LSFIVAGTLLLKLPISNN-----GHLSWMDAFFTATSA-----VTITGLSVINIGQSLTH  73
            L+FI     +LK+P  +N     G      AFFTA S+     +T+T  S+ +  +S+  
Sbjct  596  LAFIFLLPWILKMPNYSNIVREQGVSPTWWAFFTAQSSFNDLGLTLTADSMQSFNRSI--  653

Query  74   VGQIILLFLIQCGGLGFMTF  93
               +++ F I  G  GF  F
Sbjct  654  YVMVVMSFFIVIGNTGFPVF  673


 Score = 23.9 bits (50),  Expect = 0.33
 Identities = 18/61 (30%), Positives = 36/61 (59%), Gaps = 8/61 (13%)

Query  23   FLSFIVAGTLLLKLPISNNGHLSWMDAFFTATSAVTITGLSVINIGQSLTHVGQIILLFL  82
            F+SF+  G++L+  P+ N   + ++DA F    A T  GL+  +I  +  ++ Q I++++
Sbjct  65   FMSFL--GSILV-YPVKN---MRYVDALFLTGGASTQAGLNTTDI--NTLYLYQQIIVYI  116

Query  83   I  83
            I
Sbjct  117  I  117


 Score = 21.9 bits (45),  Expect = 1.3
 Identities = 14/50 (28%), Positives = 25/50 (50%), Gaps = 5/50 (10%)

Query  360  LIFIGFFSILILEPHKN--FLDLFFEIVSAACTVGLSRGITPQLNNSSLF  407
            +IF+ F   +++ P KN  ++D  F    A+   GL+   T  +N   L+
Sbjct  63   IIFMSFLGSILVYPVKNMRYVDALFLTGGASTQAGLN---TTDINTLYLY  109


> Q47476 ORF401 [Escherichia coli]
Length=401

 Score = 62.8 bits (151),  Expect = 2e-13
 Identities = 81/311 (26%), Positives = 136/311 (44%), Gaps = 27/311 (9%)

Query  22   GFLSFIVAGTLL-----LKLPISNNGHLSWMDAFFTATSAVTITGLSVINIGQSLTHVGQ  76
            GFL  ++  T+L     L    S + +L+  DAFF + S +T TG + +    SL H   
Sbjct  49   GFLIVVLFWTVLGSVGALPFIFSESPNLTITDAFFESFSGLTTTGATTLVGLDSLPHAIL  108

Query  77   IILLFLIQCGGLGFMTFAILAALSLAPQLGL-KQQLMAQDSMGQTSLSKV-TFIAQAVFI  134
                 L   GG+G +   I+ A+++ P LG+   QL   +  G    +K+   IA+    
Sbjct  109  FYRQMLQWFGGMGII---IVLAVAILPILGVGGMQLYRAEMPGPLKDNKMRPRIAETAKT  165

Query  135  YTLIFELMGTCILTFAWMNQFGFFHALYYAFFYSISAFNNAGFSLFPNNLMNFQTHYIAC  194
              LI+ L+        W      F A+ ++F    +     GFS    ++  F +  I  
Sbjct  166  LWLIYVLLTVASALALWFAGMDAFDAIGHSF----ATIAIGGFSTHDASIGYFDSPTINT  221

Query  195  LTISFLYILG---GLGFLVIMDIKERKRWKKLSPNSKIVIISIAILNTSAFLIIWLLEVN  251
            +   FL I G   GL F ++     +  W+   P  ++ I     L     L++W    +
Sbjct  222  IIAIFLLISGCNYGLHFSLLSGRSLKVYWR--DPEFRMFIGVQFTLVVICTLVLWF---H  276

Query  252  NPLTLYSMSFSEQALNAWFQ-ATVPRSSGFNTIDIASMNNSSTLLTMFLMFIGGGSLSTA  310
            N  +   M+ ++    A+FQ  ++  ++GF T  IA       +L +   FIGG + ST 
Sbjct  277  NVYSSALMTINQ----AFFQVVSMATTAGFTTDSIARWPLFLPVLLLCSAFIGGCAGSTG  332

Query  311  GGIKVGTFVIL  321
            GG+KV   ++L
Sbjct  333  GGLKVIRILLL  343


 Score = 32.7 bits (73),  Expect = 5e-04
 Identities = 54/234 (23%), Positives = 101/234 (43%), Gaps = 37/234 (16%)

Query  192  IACLTISFLYILGGLGFLVIM-----DIKERKRWKKLSPNSKIVIISIAILNTSAFLIIW  246
            I  L ++ L ILG  G  +        +K+ K   +++  +K + +   +L  ++ L +W
Sbjct  123  IIVLAVAILPILGVGGMQLYRAEMPGPLKDNKMRPRIAETAKTLWLIYVLLTVASALALW  182

Query  247  LLEVNNPLTLYSMSFSEQALNAWFQATVPRSSGFNTIDIASMNNSSTLLTMFLMFIGGGS  306
               ++        SF+  A+  +  +T   S G+   D  ++N   T++ +FL+      
Sbjct  183  FAGMD-AFDAIGHSFATIAIGGF--STHDASIGY--FDSPTIN---TIIAIFLLI-----  229

Query  307  LSTAGGIKVGT-FVILVFSVIAFLKRHDEVRIFNHSISYENTFKALAVVVITLILIFIGF  365
                 G   G  F +L    +    R  E R+F   I  + T     VV+ TL+L F   
Sbjct  230  ----SGCNYGLHFSLLSGRSLKVYWRDPEFRMF---IGVQFTL----VVICTLVLWFHNV  278

Query  366  FSILILEPHKNFLDLFFEIVSAACTVGLSRGITPQLNNSSLFVLSLLMYAGRLG  419
            +S  ++  ++     FF++VS A T G +   T  +    LF+  LL+ +  +G
Sbjct  279  YSSALMTINQ----AFFQVVSMATTAGFT---TDSIARWPLFLPVLLLCSAFIG  325


 Score = 26.9 bits (58),  Expect = 0.032
 Identities = 21/82 (26%), Positives = 36/82 (44%), Gaps = 2/82 (2%)

Query  351  LAVVVITLILIFIGFFSILILE-PHKNFLDLFFEIVSAACTVGLSRGI-TPQLNNSSLFV  408
            L VV+   +L  +G    +  E P+    D FFE  S   T G +  +    L ++ LF 
Sbjct  51   LIVVLFWTVLGSVGALPFIFSESPNLTITDAFFESFSGLTTTGATTLVGLDSLPHAILFY  110

Query  409  LSLLMYAGRLGPLTLAYLIATP  430
              +L + G +G + +  +   P
Sbjct  111  RQMLQWFGGMGIIIVLAVAILP  132


> Q9P8G2 Potassium transport protein [Candida albicans]
Length=1059

 Score = 63.5 bits (153),  Expect = 2e-13
 Identities = 83/380 (22%), Positives = 158/380 (42%), Gaps = 66/380 (17%)

Query  114  QDSMGQTSLSKVTFIAQAVFIYTLIFELMGTCILTFAWMNQFGFFHAL---------YYA  164
            ++ +G      V  + + + +Y + F ++   +L+  W+     +  L         ++A
Sbjct  613  KEELGGIEYRAVKLLIKIIVVYYVGFNIIPGVMLSI-WIYCMPHYKNLMISSSISPAWWA  671

Query  165  FFYSISAFNNAGFSLFPNNLMNFQTHYIACLTISFLYILGGLGFLVIMDIKERKRWKKLS  224
            FF S S+FN+ G +L  N++M+F  +    +  SFL ++G  GF +++       +K   
Sbjct  672  FFTSQSSFNDLGLTLTSNSMMSFNQNAFVQILCSFLIVIGNTGFPILLRFIIWVMFKTAR  731

Query  225  PNSKI--------------------------VIISIAILNTSAFLIIWLLEVNNPLTLYS  258
            P S                            +   + +LN    +I  +L++++  T   
Sbjct  732  PLSLYKESLGFLLDHPRRCFTLLFPSVPTWWLFFILVVLNGFDLVIFCILDLHDD-TFKG  790

Query  259  MSFSEQALNAWFQATVPRSSGFNTIDIASMNNSSTLLTMFLMFIGGGSLSTAGGIKVGTF  318
            +    + LN  FQA   R+ GF+ +D++ ++ ++ +  + +M+I    L  A  ++  T 
Sbjct  791  VDMGYRVLNGLFQAFCTRTVGFSVMDLSQLHAATQVSYLIMMYI--SVLPIAISVR-RTN  847

Query  319  VILVFSVIAFLKRH----DEVRIFNHSISYENTFKALAVVVITLILIFIGFFSILILEPH  374
            V    S+  + K +    DE    N+  S+         +   L  I +G F I I E  
Sbjct  848  VYEEQSLGVYAKENAEGVDESAPSNYVGSHLRN-----QLSYDLWYICLGLFIICIAEGK  902

Query  375  K--------NFLDLFFEIVSAACTVGLSRG-------ITPQLNNSSLFVLSLLMYAGRLG  419
            +        +   + FEIVSA  TVG+S G       ++ + N  S  V+  +M  GR  
Sbjct  903  RLKEQDLRFSIFAVLFEIVSAYGTVGMSMGYPGVDCSLSGEFNVISKLVIIAMMIRGRHR  962

Query  420  --PLTLAYLIATPKKSRLKH  437
              P T+   I  P  +  +H
Sbjct  963  GLPYTIDRAIMLPNAAMKRH  982


 Score = 28.5 bits (62),  Expect = 0.013
 Identities = 32/108 (30%), Positives = 51/108 (47%), Gaps = 15/108 (14%)

Query  11   FNLSPPSMLALGFLSFIVAGTLLLKLPISNNGHLSWMDAFFTATSA-----VTITGLSVI  65
            FN+ P  ML++    +I        L IS++   +W  AFFT+ S+     +T+T  S++
Sbjct  638  FNIIPGVMLSI----WIYCMPHYKNLMISSSISPAWW-AFFTSQSSFNDLGLTLTSNSMM  692

Query  66   NIGQSLTHVGQIILLFLIQCGGLGF---MTFAILAALSLAPQLGLKQQ  110
            +  Q+     QI+  FLI  G  GF   + F I      A  L L ++
Sbjct  693  SFNQNA--FVQILCSFLIVIGNTGFPILLRFIIWVMFKTARPLSLYKE  738


 Score = 25.0 bits (53),  Expect = 0.15
 Identities = 16/59 (27%), Positives = 31/59 (53%), Gaps = 5/59 (8%)

Query  24   LSFIVAGTLLLKLPISNNGHLSWMDAFFTATSAVTITGLSVINIGQSLTHVGQIILLFL  82
            L+ ++ G++L+  P+      +++D  F    A T  GL+ +N+   L+   QI+L  L
Sbjct  56   LTLVILGSILV-YPVKT---CAYIDVLFFTAGASTQAGLNTVNV-NDLSLYQQIVLYLL  109


> Q3V5P8 High-affinity potassium transporter [Phragmites australis]
Length=530

 Score = 60.8 bits (146),  Expect = 8e-13
 Identities = 92/443 (21%), Positives = 179/443 (40%), Gaps = 86/443 (19%)

Query  23   FLSFIVAGTLLLKLPISNNGHLS--WMDAFFTATSAVTITGLSVINIGQSLTHVGQIILL  80
            FL   + G++LL     NN   S  ++D  F +TSA+T++GLS + + + L+    ++L 
Sbjct  48   FLVIDLLGSVLLISLKPNNPDFSPRYVDMLFLSTSALTVSGLSTVKM-EDLSSTQIVVLT  106

Query  81   FLIQCGGLGFMTFAIL-------------------------------AALSLAPQLGLKQ  109
             L+  GG  F++F  L                               A+  +  +L L++
Sbjct  107  LLMFVGGEVFVSFLGLMLRPNHQAKPTDPAGNNKVSSIAVELETIDTASAIICEELQLEE  166

Query  110  QLMAQDSMGQTSLSK---VTFIAQAVFIYTLIFELMGTCILTFAWMNQFGFFHALY----  162
            ++ A  S+    L K   V ++   VF Y  +  ++G  +L F ++       A+     
Sbjct  167  EMHATPSLSSNDLKKSKSVRYLGFVVFGYLAVIHVLGF-LLVFLYITHVPTARAVLTKKG  225

Query  163  -----YAFFYSISAFNNAGFSLFPNNLMNFQTHYIACLTISFLYILGGLGF---------  208
                 ++   ++S+F N G      N+  F  +    L ++   + G   F         
Sbjct  226  INVALFSVSVTVSSFANGGLVPTNENMAIFSKNAGLLLLLTGQVLAGNTLFPLFLRLLIW  285

Query  209  ------------LVIMDIKERKRWKKLSPNSKIVIISIAILNTSAFLIIWLLEVN-NPLT  255
                        L+I + KE  R++ L P      +S  ++  +A  ++    ++ N L 
Sbjct  286  FLGRVTKLEGLELMIRNPKEL-RFRHLLPKLLTAFLSSTVVGLAALAVVLFSVIDWNSLV  344

Query  256  LYSMSFSEQALNAWFQATVPRSSGFNTIDIASMNNSSTLLTMFLMFIGGGSLSTAGGIKV  315
               +S  ++ +NA F A   R +G N+ID + ++ +  +L + +M++   +         
Sbjct  345  FDGLSSYQKIINALFMAVNTRHAGENSIDCSLISPAVLVLLIVMMYLPSSTTFAPPNRDD  404

Query  316  GTFVILVFSVIAFLKRHDEVRIFNHSISYENTFKALAVVVITLILIFIGFFSILILEPHK  375
                          ++ D+V     S+     F  L   +I ++++ I     L  +P  
Sbjct  405  K-------------RKDDKVVPKRRSLVQNLAFSQLGCNIIFVMVVCITERRRLRNDP-L  450

Query  376  NF--LDLFFEIVSAACTVGLSRG  396
            NF  L++ FE++SA    GLS G
Sbjct  451  NFSTLNMIFEVISAYGNAGLSTG  473


 Score = 31.2 bits (69),  Expect = 0.002
 Identities = 18/64 (28%), Positives = 34/64 (53%), Gaps = 5/64 (8%)

Query  358  LILIFIGFFSILILEPHK-----NFLDLFFEIVSAACTVGLSRGITPQLNNSSLFVLSLL  412
            L++  +G   ++ L+P+       ++D+ F   SA    GLS      L+++ + VL+LL
Sbjct  49   LVIDLLGSVLLISLKPNNPDFSPRYVDMLFLSTSALTVSGLSTVKMEDLSSTQIVVLTLL  108

Query  413  MYAG  416
            M+ G
Sbjct  109  MFVG  112


 Score = 27.3 bits (59),  Expect = 0.026
 Identities = 21/77 (27%), Positives = 39/77 (51%), Gaps = 15/77 (19%)

Query  237  LNTSAFLIIWLL--------EVNNPLTLYSMSFSEQALNAWFQATVPRS-SGFNTIDIAS  287
            +  S FL+I LL        + NNP       FS + ++  F +T   + SG +T+ +  
Sbjct  43   IQLSYFLVIDLLGSVLLISLKPNNP------DFSPRYVDMLFLSTSALTVSGLSTVKMED  96

Query  288  MNNSSTLLTMFLMFIGG  304
            ++++  ++   LMF+GG
Sbjct  97   LSSTQIVVLTLLMFVGG  113


> Q9Y7B9 Potassium transport protein [Kluyveromyces lactis]
Length=1070

 Score = 61.2 bits (147),  Expect = 8e-13
 Identities = 84/393 (21%), Positives = 155/393 (39%), Gaps = 67/393 (17%)

Query  99   LSLAPQLGLKQQLMAQDSMGQTSLSKVTFIAQAVFIYTLIFELMGTCILTF----AWMNQ  154
            LS  P++G     +      +  L  V + +  V    L    +G  IL      AW+  
Sbjct  459  LSYEPKIGRNSTFVGLSESQKVELGGVEYRSTKVLCLLLSIYYLGFSILAMIIFAAWIQP  518

Query  155  FGFFHAL---------YYAFFYSISAFNNAGFSLFPNNLMNFQTHYIACLTISFLYILGG  205
               +  +         ++ F+  +SAF N G +L PN++++F       + + +  ++G 
Sbjct  519  MNNYKEIVRSQGVSPTWWGFWTGMSAFGNLGLTLTPNSMISFHKSIYTLIWMMWFIVIGN  578

Query  206  LGFLVIM------------DIKERKR------------WKKLSPNSKIVIISIAILNTSA  241
             GF + +            D+  RK             +  L P +    + + ++  +A
Sbjct  579  TGFPIFLRFVIWILFKLSPDLSLRKDSLGFLLDHPRRCFTMLFPKAATWWLFLILIGMNA  638

Query  242  F-LIIWLLEVNNPLTLYSMSFSEQALNAWFQATVPRSSGFNTIDIASMNNSSTLLTMFLM  300
              LI++++   N   +  ++   + LN  FQA   R++GF  +D++ ++ S  +  M +M
Sbjct  639  IDLILFIILDLNTDVVKDLTAGFKVLNGLFQAVSTRTAGFAVLDLSQLHPSVQVSYMLMM  698

Query  301  FIGGGSLSTAGGIKVGTFVILVFSVIAFLKRHDEVRIFNHSISYENTFKALAV-----VV  355
            ++    L+ +   +   +      V    +++ E        S +NT   +       + 
Sbjct  699  YVSVMPLAISIR-RTNVYEEQSLGVYGEWEKNQE-----DDGSEKNTKSFIGAHLRRQLS  752

Query  356  ITLILIFIGFFSILILE------PHKNFLDLF---FEIVSAACTVGLSRG-------ITP  399
              L  +F+G F I I E      P K    +F   FE+VSA  TVGLS G        + 
Sbjct  753  FDLWYMFLGLFIICICEGGKIQDPSKPSFTVFQCLFEVVSAYGTVGLSLGYPGSNQSFSG  812

Query  400  QLNNSSLFVLSLLMYAGRLG--PLTLAYLIATP  430
            Q    S  V+  ++  GR    P TL   I  P
Sbjct  813  QFTTISKLVIIAMLIRGRHRGLPYTLDRAIILP  845


 Score = 29.6 bits (65),  Expect = 0.006
 Identities = 19/64 (30%), Positives = 36/64 (56%), Gaps = 2/64 (3%)

Query  16   PSMLALGFLSFIVAGTLLLKLPISNNGHLSWMDAFFTATSAVTITGLSVINIGQSLTHVG  75
            P+ +A  +  +I+A  LL  + I    + +++D  F AT A T  GL+ +++ + L+   
Sbjct  46   PNFIAFHYF-YIIAFALLCSILIYPVKNFAYIDILFLATGAATQGGLNTVDLNE-LSLYQ  103

Query  76   QIIL  79
            QI+L
Sbjct  104  QIVL  107



Lambda      K        H        a         alpha
   0.330    0.142    0.418    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4988147


  Database: f7ee128d4a2cf2c82e30596fc194d45c.TrEMBL.fasta
    Posted date:  Sep 21, 2020  4:53 AM
  Number of letters in database: 14,476
  Number of sequences in database:  29



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40