ACIAD1355 / SwissProt Alignments

BLASTP 2.2.28+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: cd19c89ab0e728ffa2393df0b2287f4b.SwissProt.fasta
           16 sequences; 8,599 total letters



Query= ACIAD1355

Length=446
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  O32081 Ktr system potassium uptake protein B [Bacillus subtilis...   362    2e-123
  O87953 Ktr system potassium uptake protein B [Vibrio alginolyti...   302    4e-100
  P43440 Potassium/sodium uptake protein NtpJ [Enterococcus hirae...   248    2e-79 
  O31658 Ktr system potassium uptake protein D [Bacillus subtilis...   214    1e-66 
  P47564 Uncharacterized cation transporter MG322 [Mycoplasma gen...   140    1e-39 
  P75323 Uncharacterized cation transporter MG322 homolog [Mycopl...   139    6e-39 
  Q58880 Uncharacterized cation transporter MJ1485 [Methanocaldoc...  77.4    2e-18 
  Q87TN7 Trk system potassium uptake protein TrkH [Vibrio parahae...  73.2    5e-17 
  Q9L6L2 Trk system potassium uptake protein TrkH [Salmonella typ...  67.4    4e-15 
  P0AFZ8 Trk system potassium uptake protein TrkH [Escherichia co...  66.2    8e-15 
  P0AFZ9 Trk system potassium uptake protein TrkH [Shigella flexn...  66.2    8e-15 
  P0AFZ7 Trk system potassium uptake protein TrkH [Escherichia co...  66.2    8e-15 
  P23849 Trk system potassium uptake protein TrkG [Escherichia co...  65.9    1e-14 
  Q10065 Potassium transport protein 2 [Schizosaccharomyces pombe...  65.1    3e-14 
  Q6H501 Probable cation transporter HKT6 [Oryza sativa subsp. ja...  60.8    5e-13 
  P28584 Low-affinity potassium transport protein [Saccharomyces ...  60.1    1e-12 


> O32081 Ktr system potassium uptake protein B [Bacillus subtilis 
(strain 168)]
Length=445

 Score =  362 bits (928),  Expect = 2e-123
 Identities = 180/445 (40%), Positives = 291/445 (65%), Gaps = 2/445 (0%)

Query  1    MKKQKINQKTFNLSPPSMLALGFLSFIVAGTLLLKLPISNNGHLSWMDAFFTATSAVTIT  60
            ++K K+  K    +PP +LA+GF   I+ G +LL LPIS    LSW+DA FTA SA T+T
Sbjct  3    LQKDKVI-KWVRFTPPQVLAIGFFLTIIIGAVLLMLPISTTKPLSWIDALFTAASATTVT  61

Query  61   GLSVINIGQSLTHVGQIILLFLIQCGGLGFMTFAILAALSLAPQLGLKQQLMAQDSMGQT  120
            GL+V++ G   T  GQ +++ LIQ GGLGFMTFA+L  + L  ++GLK++++ Q+++ Q 
Sbjct  62   GLAVVDTGTQFTVFGQTVIMGLIQIGGLGFMTFAVLIVMILGKKIGLKERMLVQEALNQP  121

Query  121  SLSKVTFIAQAVFIYTLIFELMGTCILTFAWMNQFGFFHALYYAFFYSISAFNNAGFSLF  180
            ++  V  + + +F++++  EL+   IL+   + Q+G+   L+ + F++ISAFNNAGFSL+
Sbjct  122  TIGGVIGLVKVLFLFSISIELIAALILSIRLVPQYGWSSGLFASLFHAISAFNNAGFSLW  181

Query  181  PNNLMNFQTHYIACLTISFLYILGGLGFLVIMDIKERKRWKKLSPNSKIVIISIAILNTS  240
            P+NLM++       L I+FL+I GG+GF V+ D+ + +R+K  S ++K+++    +LN  
Sbjct  182  PDNLMSYVGDPTVNLVITFLFITGGIGFTVLFDVMKNRRFKTFSLHTKLMLTGTLMLNAI  241

Query  241  AFLIIWLLEVNNPLTLYSMSFSEQALNAWFQATVPRSSGFNTIDIASMNNSSTLLTMFLM  300
            A L +++LE +NP TL  +   ++   ++FQA  PR++GFN++D  SM   + + T+ LM
Sbjct  242  AMLTVFILEYSNPGTLGHLHIVDKLWASYFQAVTPRTAGFNSLDFGSMREGTIVFTLLLM  301

Query  301  FIGGGSLSTAGGIKVGTFVILVFSVIAFLKRHDEVRIFNHSISYENTFKALAVVVITLIL  360
            FIG GS STA GIK+ TF++++ SVIA+L+   E  IF  SI Y    KALAV V +L +
Sbjct  302  FIGAGSASTASGIKLTTFIVILTSVIAYLRGKKETVIFRRSIKYPIIIKALAVSVTSLFI  361

Query  361  IFIGFFSILILEPHKNFLDLFFEIVSAACTVGLSRGITPQLNNSSLFVLSLLMYAGRLGP  420
            +F+G F++ I E    FL + FE  SA  TVGL+ G+TP+L  +   ++ ++M+ GR+GP
Sbjct  362  VFLGIFALTITE-QAPFLQIVFETFSAFGTVGLTMGLTPELTTAGKCIIIVIMFIGRIGP  420

Query  421  LTLAYLIATPKKSRLKHPSADIQIG  445
            LT  +  A  ++S +++P  ++  G
Sbjct  421  LTFVFSFAKTEQSNIRYPDGEVFTG  445


> O87953 Ktr system potassium uptake protein B [Vibrio alginolyticus]
Length=455

 Score =  302 bits (773),  Expect = 4e-100
 Identities = 156/432 (36%), Positives = 267/432 (62%), Gaps = 3/432 (1%)

Query  16   PSMLALGFLSFIVAGTLLLKLPISNNGHLSWMDAFFTATSAVTITGLSVINIGQSLTHVG  75
            P ++ L FL  ++   +LL LP+ +   LS  DA FTATSA+++TGL V++ GQ  T  G
Sbjct  25   PRIILLSFLGVLLPSAVLLTLPVFSVSGLSITDALFTATSAISVTGLGVVDTGQHFTLAG  84

Query  76   QIILLFLIQCGGLGFMTFAILAALSLAPQLGLKQQLMAQDSMGQTSLSKVTFIAQAVFIY  135
            +I+L+ L+Q GGLG MT + +       +L L+QQ +A++++GQ     +  + + +  +
Sbjct  85   KILLMCLMQIGGLGQMTLSAVLLYMFGVRLSLRQQALAKEALGQERQVNLRRLVKKIVTF  144

Query  136  TLIFELMGTCILTFAWMNQFGFFHALYYAFFYSISAFNNAGFSLFPNNLMNFQTHYIACL  195
             L+ E +G   L++ W+ + G+   ++YA F+SISAFNNAGF+LF +++M+F    +   
Sbjct  145  ALVAEAIGFVFLSYRWVPEMGWQTGMFYALFHSISAFNNAGFALFSDSMMSFVNDPLVSF  204

Query  196  TISFLYILGGLGFLVIMDIKE--RKRWKKLSPNSKIVIISIAILNTSAFLIIWLLEVNNP  253
            T++ L+I GGLGF VI D+    RK +  L  ++KI++I+  +L     ++ WLLE +NP
Sbjct  205  TLAGLFIFGGLGFTVIGDVWRHWRKGFHFLHIHTKIMLIATPLLLLVGTVLFWLLERHNP  264

Query  254  LTLYSMSFSEQALNAWFQATVPRSSGFNTIDIASMNNSSTLLTMFLMFIGGGSLSTAGGI  313
             T+ S++   Q L A+FQ+   R++GFN++D+      + L+ + LM IG GS ST GGI
Sbjct  265  NTMGSLTTGGQWLAAFFQSASARTAGFNSVDLTQFTQPALLIMIVLMLIGAGSTSTGGGI  324

Query  314  KVGTFVILVFSVIAFLKRHDEVRIFNHSISYENTFKALAVVVITLILIFIGFFSILILEP  373
            KV TF +   +   FL++   V +F  ++++    K+LA++V++  ++    F +L+L  
Sbjct  325  KVSTFAVAFMATWTFLRQKKHVVMFKRTVNWPTVTKSLAIIVVSGAILTTAMF-LLMLTE  383

Query  374  HKNFLDLFFEIVSAACTVGLSRGITPQLNNSSLFVLSLLMYAGRLGPLTLAYLIATPKKS  433
              +F  + FE +SA  TVGL+ G+T +L+    +++ ++M  GR+GPLTLAY++A P+ +
Sbjct  384  KASFDKVMFETISAFATVGLTAGLTAELSEPGKYIMIVVMIIGRIGPLTLAYMLARPEPT  443

Query  434  RLKHPSADIQIG  445
             +K+P   +  G
Sbjct  444  LIKYPEDTVLTG  455


> P43440 Potassium/sodium uptake protein NtpJ [Enterococcus hirae 
(strain ATCC 9790 / DSM 20160 / JCM 8729 / LMG 6399 / NBRC 
3181 / NCIMB 6459 / NCDO 1258)]
Length=451

 Score =  248 bits (633),  Expect = 2e-79
 Identities = 146/441 (33%), Positives = 249/441 (56%), Gaps = 9/441 (2%)

Query  13   LSPPSMLALGFLSFIVAGTLLLKLPI-SNNGHLS-WMDAFFTATSAVTITGLSVINIGQS  70
            LSP  ++A GF   I+ G  LL LP  S +G  + ++DA FTATSAV +TGL+ +N  + 
Sbjct  12   LSPVQLIAAGFFILILFGGSLLTLPFFSRSGESTHFIDALFTATSAVCVTGLTTLNTAEH  71

Query  71   LTHVGQIILLFLIQCGGLGFMTFAILAALSLAPQLGLKQQLMAQDSMGQTSLSKVTFIAQ  130
                GQ +++ LI+ GGLGFM   IL       ++    +++ ++++    +S V  +  
Sbjct  72   WNSAGQFLIMTLIEIGGLGFMMIPILFFAIAKKKISFSMRIVLKEALNLEEMSGVIKLMI  131

Query  131  AVFIYTLIFELMGTCILTFAWMNQFGFFHALYYAFFYSISAFNNAGFSLFPNNLMNFQTH  190
             +  + ++ +++G   L+  ++ +FG+   ++++ F+++S+F NAGF L  ++L+  QT+
Sbjct  132  YILKFAVVIQVIGAVALSVVFIPEFGWAKGIWFSIFHAVSSFCNAGFDLLGDSLLADQTN  191

Query  191  YIACLTISFLYILGGLGFLVIMDIKERKRWKKLSPNSKIVIISIAILNTSAFLIIWLLEV  250
                + +S L I GGLGF+V  DI    R KK++ +SK+ +   A+L    F I++L+  
Sbjct  192  VYLIMVVSALIIAGGLGFIVWRDILSYHRVKKITLHSKVALSVTALLLIGGF-ILFLITE  250

Query  251  NNPLTLYSMSFSEQALNAWFQATVPRSSGFNTIDIASMNNSSTLLTMFLMFIGGGSLSTA  310
             N LTL   +F+E+  N +F +  PR++G+ +ID   M+++  +LTMFLM+IGG S STA
Sbjct  251  RNGLTLVKGTFTERLANTFFMSVTPRTAGYYSIDYLQMSHAGLILTMFLMYIGGTSGSTA  310

Query  311  GGIKVGTFVILVFSVIAFLKRHDEVRIFNHSISYENTFKALAVVVITLILIFIGFFSILI  370
            GG+K  T  IL+  + A  K       F  +I      +AL +  +TL L  +    + +
Sbjct  311  GGLKTTTLGILLIQMHAMFKGKTRAEAFGRTIRQAAVLRALTLFFVTLSLCVVAIMVLSV  370

Query  371  LE--PHKNFLD-LFFEIVSAACTVGLSRGITPQLNNSSLFVLSLLMYAGRLGPLTLAYLI  427
             E  P  + ++ + FE+ SA  TVGL+ G+TP L      V+  LMY GR+G +T+ + +
Sbjct  371  TETIPKTSGIEYIAFEVFSAFGTVGLTMGLTPDLTLIGKLVIISLMYIGRVGIMTVVFSL  430

Query  428  ---ATPKKSRLKHPSADIQIG  445
               A   ++  K+P   I +G
Sbjct  431  LVKANRAEANYKYPEESIMLG  451


> O31658 Ktr system potassium uptake protein D [Bacillus subtilis 
(strain 168)]
Length=449

 Score =  214 bits (545),  Expect = 1e-66
 Identities = 133/441 (30%), Positives = 228/441 (52%), Gaps = 11/441 (2%)

Query  13   LSPPSMLALGFLSFIVAGTLLLKLPISNNGHLSW--MDAFFTATSAVTITGLSVINIGQS  70
            LSP  ++AL +   +    +LL LP ++     W  +DA FTA S+V++TGL+V++   +
Sbjct  12   LSPAQLIALYYFLAVTVAVILLSLPAAHKPGADWTFIDALFTAVSSVSVTGLTVVDTADT  71

Query  71   LTHVGQIILLFLIQCGGLGFMTFAILAALSLAPQLGLKQQLMAQDSMGQTSLSKVTFIAQ  130
             + +G  IL F++Q GG+G MT      L +  ++GLK++ +      Q+  S +  + +
Sbjct  72   FSTIGIFILAFVLQFGGIGIMTLGTFIWLIMGKRIGLKERKLIMVDQNQSQFSGIVNLMK  131

Query  131  AVFIYTLIFELMGTCILTFAWMNQFGFFHALY-YAFFYSISAFNNAGFSLFPNNLMNFQT  189
             V    L  E  G  IL   ++  +  +   Y + FF SISA  N GF +  N+++ F+ 
Sbjct  132  QVLFLILWIEFFGGLILGTYFLTYYDSYQEAYLHGFFASISATTNGGFDITGNSMIPFRH  191

Query  190  HYIACLTISFLYILGGLGFLVIMDIKE----RKRWKKLSPNSKIVIISIAILNTSAFLII  245
             Y        L I G +GF V++++K+    + R    +  +KI  I+   L     + I
Sbjct  192  DYFVQFITMLLIIFGAIGFPVLVEVKDFLFSKHRRYPFTLFTKITTITFGSLVLFGAIGI  251

Query  246  WLLEVNNPLTLYSMSFSEQALNAWFQATVPRSSGFNTIDIASMNNSSTLLTMFLMFIGGG  305
            + LE N+       S+ +    + FQ+T  RS G  TIDI+ +++S+      LMFIG  
Sbjct  252  FALEANHAFA--GKSWHDILFLSLFQSTATRSGGLATIDISQLSDSTLFFICALMFIGAS  309

Query  306  SLSTAGGIKVGTFVILVFSVIAFLKRHDEVRIFNHSISYENTFKALAVVVITLILIFIGF  365
              S  GGI+  TF + + ++  F + +  V++F   +   +  K+L V ++ ++L+F   
Sbjct  310  PSSVGGGIRTTTFALNLLALFHFARGNKAVKVFKRELHPADLMKSLVVTMMAILLVFGAT  369

Query  366  FSILILEPHKNFLDLFFEIVSAACTVGLSRGITPQLNNSSLFVLSLLMYAGRLGPLTLAY  425
              + I E H + L+L FE+ SA  T GLS GIT  L++    V+ ++M+ GR+G LT  Y
Sbjct  370  LILTITEKH-SLLELLFEVCSAFGTTGLSLGITADLSSVGKCVIMIVMFIGRIGILTFLY  428

Query  426  LIATPK-KSRLKHPSADIQIG  445
            LI   + ++   +P   + IG
Sbjct  429  LIGRKEIEANYHYPKERVIIG  449


> P47564 Uncharacterized cation transporter MG322 [Mycoplasma genitalium 
(strain ATCC 33530 / G-37 / NCTC 10195)]
Length=558

 Score =  140 bits (354),  Expect = 1e-39
 Identities = 139/535 (26%), Positives = 230/535 (43%), Gaps = 113/535 (21%)

Query  23   FLSFIVAGTLLLKLPISNNGH--------LSW-------------MDAFFTATSAVTITG  61
            ++  I+ G+LLL LPI+   +        + W             +DA F +TSA + TG
Sbjct  25   YIYCILFGSLLLFLPIALQDNYQKVVSYGIDWQGKRFEQKTDYNFLDALFLSTSAFSDTG  84

Query  62   LSVINIGQSLTHVGQIILLFLIQCGGLGFMTFAILA----ALSLAPQLGLKQQLMAQDSM  117
            LS + + ++ +  GQI+L  L+Q GG+GF+  A LA          Q    ++LM Q   
Sbjct  85   LSTVVVSKTYSIFGQIVLAVLLQLGGIGFVVIAFLAWRLFNFHKKEQYSFYEKLMLQSER  144

Query  118  GQTSLSKVTFIAQAVFIYTLIFELMGTCILTFAWMNQFGFFHALYYA-------------  164
            G + L   + +     I+  I EL+   +    +    GF  A  +A             
Sbjct  145  GGSKLGNTSEMILVSIIFLFIVELIYGFLYGILFYFIPGFEPANLFADHAKVSTQLKALV  204

Query  165  --------------------FFYSISAFNNAGFSLFPNNLM----NFQTHYIACLTISFL  200
                                FF+S+SA NNAG  L   +      N     I  LTIS +
Sbjct  205  VDSNQTIAAFNDINKAFQAGFFHSLSAVNNAGIDLIGGSSFVPYRNGLGIIIQWLTISQI  264

Query  201  YILGGLGFLVIMD----IKERKRWKKLSPN-----SKIVIISIAILNTSAFLIIWLLE--  249
             I GG+G+  + D    IK++ ++ + + +     +K+ +I+  ++    F ++ ++E  
Sbjct  265  -IFGGIGYPCLFDGFEAIKKKIKYGRHTKHQFSLFTKLTVITNIVVILLFFTLLLMVEFI  323

Query  250  ----VNNPLTLYS-----------MSFSEQALNA---------------WFQATVPRSSG  279
                + N +  +S            S S QA++A               +F     RS+G
Sbjct  324  ASDSLTNTIVNFSDEKKSLINTQLQSQSNQAIHASVFGNNPNASRVMQLFFMVISSRSAG  383

Query  280  FNTIDIASMNNSSTLLTMFLMFIGGGSLSTAGGIKVGTFVILVFSVIAFLKRHDEVRIFN  339
            F+   +AS   ++ ++    MFIG    STAGGI+  T  ++  +++A  K   EV+ F 
Sbjct  384  FSVFPVASEIQTTKIIIALAMFIGASPSSTAGGIRTTTLAVIFLALVAKFKGQKEVKAFK  443

Query  340  HSISYENTFKALAVVVITLILIFIGFFSI-LILEPHKNFLDLFFEIVSAACTVGLSRGIT  398
             SI       A  V++I+LI + +    + L +E   +F+D  FE  SA  TVGLS G T
Sbjct  444  RSIDQTTVIDAFLVLIISLIAVLLTAVLLPLSMEQPVSFIDALFETTSAFGTVGLSSGAT  503

Query  399  ------PQLNNSSLFVLSLLMYAGRLG--PLTLAYLIATPKKSRLKHPSADIQIG  445
                  P  N  +   L LLM  G++G     L ++   PK +   +P   ++IG
Sbjct  504  VNIALDPNRNTFNFLALCLLMVMGQVGVSSSVLTFVRKHPKANSYSYPKEAVKIG  558


 Score = 27.3 bits (59),  Expect = 0.016
 Identities = 19/61 (31%), Positives = 32/61 (52%), Gaps = 4/61 (7%)

Query  3    KQKINQKTFNLSPPSMLALGFLSFIVAGTLLLKLPISNNGHLSWMDAFFTATSAVTITGL  62
            K+ I+Q T  +    +L +  ++ ++   LL   P+S    +S++DA F  TSA    GL
Sbjct  443  KRSIDQTTV-IDAFLVLIISLIAVLLTAVLL---PLSMEQPVSFIDALFETTSAFGTVGL  498

Query  63   S  63
            S
Sbjct  499  S  499


> P75323 Uncharacterized cation transporter MG322 homolog [Mycoplasma 
pneumoniae (strain ATCC 29342 / M129)]
Length=565

 Score =  139 bits (349),  Expect = 6e-39
 Identities = 129/490 (26%), Positives = 214/490 (44%), Gaps = 91/490 (19%)

Query  46   WMDAFFTATSAVTITGLSVINIGQSLTHVGQIILLFLIQCGGLGFMTFAILA----ALSL  101
            ++DA F A SA + TGLS   + ++ +  GQ +L  L+Q GG+GF+  A L      L  
Sbjct  77   FLDALFLAVSAFSDTGLSTTVVSETYSVFGQTVLAILLQLGGIGFVVIAFLVWRLFKLHK  136

Query  102  APQLGLKQQLMAQDSMGQTSLS--------KVTFIAQAVFIYTLIFELMGTCILTFAWMN  153
              +    ++LM Q   G + L          V F+     +Y  ++ ++   I  F   +
Sbjct  137  KGKYSFYEKLMLQSERGGSKLGTTSEMIVVSVLFLFMVELLYGFLYTILFYFIPAFESAS  196

Query  154  QF-------------------------GFFHALYYAFFYSISAFNNAGFSLF-PNNLMNF  187
             F                             A  Y FF+S+SA NNAG  L   N+   +
Sbjct  197  VFQSSGKVSNQLKALIVDSTKRLPVVHNLNLAFQYGFFHSLSAVNNAGIDLLGANSFAPY  256

Query  188  QTHY---IACLTISFLYILGGLGFLVIMD----IKERKRWKK-----LSPNSKIVIISIA  235
            +T++   I  L IS + I GG+G+ V+ D    IK+R+ + K      S  +K+ +++  
Sbjct  257  RTNWGIVIQWLAISQI-IFGGIGYPVLFDAYEAIKKRRLYGKYYKHQFSLFTKLAVLTNL  315

Query  236  ILNTSAFLIIWLLE--VNNPLT------------------------LYSMSF-----SEQ  264
            I+    FL++ ++E  V   LT                        L S+ F     + +
Sbjct  316  IVTAWCFLMLLMVEFIVITSLTNTIAHLNVEKAYLVEGLKNKSNQELQSLIFGPIPAASR  375

Query  265  ALNAWFQATVPRSSGFNTIDIASMNNSSTLLTMFLMFIGGGSLSTAGGIKVGTFVILVFS  324
             +  WF     RS+GF+    ++ ++    + +  MFIGG   STAGGI+  T  ++  +
Sbjct  376  VMQLWFGVISSRSAGFSVFPWSAESDIIKGIMVIAMFIGGSPSSTAGGIRTTTLAVIFLT  435

Query  325  VIAFLKRHDEVRIFNHSISYENTFKALAVVVITLI-LIFIGFFSILILEPHKNFLDLFFE  383
            + A  +   EV++F  SI  +    A  V V  L+ ++ I     L ++   +F+D  FE
Sbjct  436  LKAKFRGQKEVKVFKRSIDGQTVINAFLVAVFGLVSVVLIAILLPLSMQQPLSFVDSLFE  495

Query  384  IVSAACTVGLSRGIT------PQLNNSSLFVLSLLMYAGRLG--PLTLAYLIATPKKSRL  435
              SA  TVGLS G T      P  N  +   L LLM  G++G     L ++   P+ +  
Sbjct  496  TTSAFGTVGLSSGATKIMALEPTRNLFNYLTLGLLMIMGQVGVSSSVLTFVKKHPQGNSF  555

Query  436  KHPSADIQIG  445
             +P  D+++G
Sbjct  556  SYPREDVKVG  565


 Score = 28.5 bits (62),  Expect = 0.007
 Identities = 25/105 (24%), Positives = 48/105 (46%), Gaps = 30/105 (29%)

Query  155  FGFFHALYYAFFYSISAFNNAGFSLFPNNLMNFQTHYIACLTI-SFLYILGGLGFLVI--  211
            +GF  AL+ A    +SAF++ G S      +  +T+ +   T+ + L  LGG+GF+VI  
Sbjct  75   YGFLDALFLA----VSAFSDTGLS----TTVVSETYSVFGQTVLAILLQLGGIGFVVIAF  126

Query  212  -------------------MDIKERKRWKKLSPNSKIVIISIAIL  237
                               + ++  +   KL   S+++++S+  L
Sbjct  127  LVWRLFKLHKKGKYSFYEKLMLQSERGGSKLGTTSEMIVVSVLFL  171


 Score = 26.9 bits (58),  Expect = 0.021
 Identities = 16/42 (38%), Positives = 23/42 (55%), Gaps = 3/42 (7%)

Query  22   GFLSFIVAGTLLLKLPISNNGHLSWMDAFFTATSAVTITGLS  63
            G +S ++   LL   P+S    LS++D+ F  TSA    GLS
Sbjct  468  GLVSVVLIAILL---PLSMQQPLSFVDSLFETTSAFGTVGLS  506


 Score = 25.4 bits (54),  Expect = 0.062
 Identities = 16/62 (26%), Positives = 31/62 (50%), Gaps = 6/62 (10%)

Query  35   KLPISNNGHLSWMDAFFTATSAVTITGLSVINIGQSLTH------VGQIILLFLIQCGGL  88
            +LP+ +N +L++   FF + SAV   G+ ++       +      V Q + +  I  GG+
Sbjct  218  RLPVVHNLNLAFQYGFFHSLSAVNNAGIDLLGANSFAPYRTNWGIVIQWLAISQIIFGGI  277

Query  89   GF  90
            G+
Sbjct  278  GY  279


> Q58880 Uncharacterized cation transporter MJ1485 [Methanocaldococcus 
jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 
10045 / NBRC 100440)]
Length=474

 Score = 77.4 bits (189),  Expect = 2e-18
 Identities = 94/437 (22%), Positives = 194/437 (44%), Gaps = 56/437 (13%)

Query  7    NQKTFNLSPPSMLALGFLSFIVAGTLLLKLPISNNGHLSWMDAFFTATSAVTITGLSVIN  66
            N K  +    S LA    SFI A  L L +      + S++DA + + SA T TG+++I 
Sbjct  69   NLKLHHTMVASALAWLIASFIGAIPLYLSID-----YFSYVDAVYESMSAWTTTGMTLIP  123

Query  67   IGQSLTHVGQIILLFLIQCGGLGFMTFAILAALSLAPQLGLKQQLMAQDSMGQTSL-SKV  125
              + L         F    GG+G +   +L+AL LA    +   L   ++  +  + S +
Sbjct  124  NVEVLPKSILFWRSFQQWIGGVGIL---VLSALVLARSGTVAYLLYTSEARQERIMPSAI  180

Query  126  TFIAQAVFIYTLIFELMGTCILTFAWMNQFGFFHALYYAFFYSISAFNNAGFSL----FP  181
              I   ++IY +++ ++G  +L   +++   F+ AL      +++  +  G S+    FP
Sbjct  181  GTIKTIIWIY-ILYTILGVLLL---YLSGLSFWDALNL----TMTGISTGGMSISNYSFP  232

Query  182  NNLMNFQTHYIACLTISFLYILGGLGFLVIMDIKERKRWKKLSPNSKIVIISIAILNTSA  241
             N       +   + I  + + G + F +   +   K +  +     +++        +A
Sbjct  233  YN------DFAKIVMIGIMMVGGVMSFSIHHKLLTGKYFNDIQTKYALIV--------TA  278

Query  242  FLIIWLLEVNNPLTLYSMSFSEQALNAWFQATVPRSSGFNTIDIASMNNSSTLLTMFLMF  301
            F+ I ++ + + + +    F+          +   S+GF TI++ ++++ S  L +FLM 
Sbjct  279  FISI-IISIKDKVPIIDSLFTV--------VSAMTSTGFTTINVGNLSSLSLFLIIFLML  329

Query  302  IGGGSLSTAGGIKVGTFVILVFSVIAFLKR---HDEVRIFNHSISYENTFKALAVVVITL  358
            IGGG+ +T GG+K+  F++++ +++  +K         I  H    +  ++ +    +  
Sbjct  330  IGGGAGTTTGGVKIIRFLVILKALLYEIKEIIYPKSAVIHEHLDDMDLNYRIIREAFVVF  389

Query  359  ILIFIGFF--SILILEPHKNFLDLFFEIVSAACTVGLSRGI----TPQLNNSSLFVLSLL  412
             L  +  F  +++ +    N  D  F+ VS    +G+S G+    TP +   +  +    
Sbjct  390  FLYCLSSFLTALIFIALGYNPYDSIFDAVSFTSNIGISLGVVTLKTPVIGKIAGII---A  446

Query  413  MYAGRLGPLTLAYLIAT  429
            M+ GRL  + +  L AT
Sbjct  447  MWIGRLEIIPVLVLFAT  463


> Q87TN7 Trk system potassium uptake protein TrkH [Vibrio parahaemolyticus 
serotype O3:K6 (strain RIMD 2210633)]
Length=485

 Score = 73.2 bits (178),  Expect = 5e-17
 Identities = 110/431 (26%), Positives = 183/431 (42%), Gaps = 46/431 (11%)

Query  22   GFLSFIVAGTLL-----LKLPISNNGHLSWMDAFFTATSAVTITGLSVINIGQSLTHVGQ  76
            GFL  ++  T+L     L   I++N ++S  DAFF + SA+T TG +VI     L     
Sbjct  69   GFLIVVLFWTVLGSAGSLPFLIADNPNISVTDAFFESFSALTTTGATVIVGLDELPKAIL  128

Query  77   IILLFLIQCGGLGFMTFAILAALSLAPQLGLK-QQLMAQDSMGQTSLSKVT--FIAQAVF  133
                FL   GG+G     I+ A+++ P LG+   QL   +  G    +K+T      A  
Sbjct  129  FYRQFLQWFGGMGI----IVLAVAILPVLGIGGMQLYRAEIPGPVKDTKMTPRIAETAKA  184

Query  134  IYTLIFELMGTCILTFAWMNQFGFFHALYYAFFYSISAFNNAGFSLFPNNLMNFQTHYIA  193
            ++ +   L   C + F W+     F A+ ++F    S     GFS    ++  F ++ I 
Sbjct  185  LWYIYLSLTIACAVAF-WLAGMTPFDAISHSF----STIAIGGFSTHDASMGYFDSYAIN  239

Query  194  CLTISFLYILG---GLGFLVIMD--IKERKRWKKLSPNSKIVIISIAILNTSAFLIIWLL  248
             +T+ FL I      L F       +  +  WK   P  +  I    +L    FL+ +LL
Sbjct  240  LITVVFLLISACNFTLHFAAFASGGVHPKYYWK--DPEFRAFIFIQVLL----FLVCFLL  293

Query  249  EVNNPLTLYSMSFSEQALNAWFQA-TVPRSSGFNTIDIASMNNSSTLLTMFLMFIGGGSL  307
             + +          +QAL   FQ  ++  ++GF T   A       +L +F  FIGG + 
Sbjct  294  LLKHHSYTSPYDAFDQAL---FQTVSISTTAGFTTTGFADWPLFLPVLLLFSSFIGGCAG  350

Query  308  STAGGIKVGTFVILVFSVIAFLKRHDEVRIFNHSISYENTFKALAVVVITLILIFIGFFS  367
            ST GG+KV   ++L       LKR    R   ++I    +  AL   V+  +  F   ++
Sbjct  351  STGGGMKVIRILLLTLQGARELKRLVHPRAV-YTIKVGGS--ALPQRVVDAVWGFFSAYA  407

Query  368  IL-------ILEPHKNFLDLFFEIVSAACTVGLSRGITP----QLNNSSLFVLSLLMYAG  416
            ++       ++    + L  F  + +    +G   G        +N+ + +VL + M  G
Sbjct  408  LVFVVCMLGLIATGMDELSAFSAVAATLNNLGPGLGEVALHFGDVNDKAKWVLIVSMLFG  467

Query  417  RLGPLTLAYLI  427
            RL   TL  L+
Sbjct  468  RLEIFTLLILL  478


> Q9L6L2 Trk system potassium uptake protein TrkH [Salmonella typhimurium 
(strain LT2 / SGSC1412 / ATCC 700720)]
Length=483

 Score = 67.4 bits (163),  Expect = 4e-15
 Identities = 105/426 (25%), Positives = 176/426 (41%), Gaps = 40/426 (9%)

Query  22   GFLSFIVAGTLL-----LKLPISNNGHLSWMDAFFTATSAVTITGLSVINIGQSLTHVGQ  76
            GFL  ++  T+L     L    S + +L+  DAFF + S +T TG + +    SL H   
Sbjct  69   GFLIVVLFWTVLGSVGALPFIFSESPNLTITDAFFESFSGLTTTGATTLVGLDSLPHAIL  128

Query  77   IILLFLIQCGGLGFMTFAILAALSLAPQLGL-KQQLMAQDSMGQTSLSKV-TFIAQAVFI  134
                 L   GG+G     I+ A+++ P LG+   QL   +  G    +K+   IA+    
Sbjct  129  FYRQMLQWFGGMGI----IVLAVAILPILGVGGMQLYRAEMPGPLKDNKMRPRIAETAKT  184

Query  135  YTLIFELMGTCILTFAWMNQFGFFHALYYAFFYSISAFNNAGFSLFPNNLMNFQTHYIAC  194
              LI+ L+        W      F A+ ++F    S     GFS    ++  F +  I  
Sbjct  185  LWLIYVLLTVACALALWFAGMPAFDAIGHSF----STIAIGGFSTHDASVGYFDSPTINT  240

Query  195  LTISFLYILG---GLGFLVIMDIKERKRWKKLSPNSKIVIISIAILNTSAFLIIWLLEV-  250
            +   FL I G   GL F ++     +  W+   P  ++ I     L     L++W   + 
Sbjct  241  IIAIFLLISGCNYGLHFSLLSGRSLKVYWR--DPEFRMFIGVQLTLVVICTLVLWFHNIY  298

Query  251  NNPLTLYSMSFSEQALNAWFQATVPRSSGFNTIDIASMNNSSTLLTMFLMFIGGGSLSTA  310
            ++ LT  + +F +         ++  ++GF T  IA       +L +   FIGG + ST 
Sbjct  299  DSALTTLNQAFFQ-------VVSMATTAGFTTDSIARWPLFLPVLLLCSAFIGGCAGSTG  351

Query  311  GGIKVGTFVILVFSVIAFLKR--HD----EVRIFNHSISYENTFKALAVVVITLILIFIG  364
            GG+KV   ++L       LKR  H      +++ N ++  E   +A+        L+FI 
Sbjct  352  GGLKVIRILLLFKQGNRELKRLVHPNAVYSIKLGNRALP-ERILEAVWGFFSAYALVFIV  410

Query  365  FFSILILEPHKNFLDLFFEIVSAACTVGLSRGIT----PQLNNSSLFVLSLLMYAGRLGP  420
                +I     +F   F  +V+    +G   G+       +N  + ++L   M  GRL  
Sbjct  411  SMLAIIATGVDDF-SAFASVVATLNNLGPGLGVVADNFASMNPVAKWILIANMLFGRLEV  469

Query  421  LTLAYL  426
             TL  L
Sbjct  470  FTLLVL  475


> P0AFZ8 Trk system potassium uptake protein TrkH [Escherichia 
coli O157:H7]
Length=483

 Score = 66.2 bits (160),  Expect = 8e-15
 Identities = 106/426 (25%), Positives = 178/426 (42%), Gaps = 40/426 (9%)

Query  22   GFLSFIVAGTLL-----LKLPISNNGHLSWMDAFFTATSAVTITGLSVINIGQSLTHVGQ  76
            GFL  ++  T+L     L    S + +L+  DAFF + S +T TG + +    SL H   
Sbjct  69   GFLIVVLFWTVLGSVGALPFIFSESPNLTITDAFFESFSGLTTTGATTLVGLDSLPHAIL  128

Query  77   IILLFLIQCGGLGFMTFAILAALSLAPQLGL-KQQLMAQDSMGQTSLSKV-TFIAQAVFI  134
                 L   GG+G     I+ A+++ P LG+   QL   +  G    +K+   IA+    
Sbjct  129  FYRQMLQWFGGMGI----IVLAVAILPILGVGGMQLYRAEMPGPLKDNKMRPRIAETAKT  184

Query  135  YTLIFELMGTCILTFAWMNQFGFFHALYYAFFYSISAFNNAGFSLFPNNLMNFQTHYIAC  194
              LI+ L+        W      F A+ ++F    +     GFS    ++  F +  I  
Sbjct  185  LWLIYVLLTVACALALWFAGMDAFDAIGHSF----ATIAIGGFSTHDASIGYFDSPTINT  240

Query  195  LTISFLYILG---GLGFLVIMDIKERKRWKKLSPNSKIVIISIAILNTSAFLIIWLLEVN  251
            +   FL I G   GL F ++     +  W+   P  ++ I     L     L++W    +
Sbjct  241  IIAIFLLISGCNYGLHFSLLSGRSLKVYWR--DPEFRMFIGVQFTLVVICTLVLWF---H  295

Query  252  NPLTLYSMSFSEQALNAWFQ-ATVPRSSGFNTIDIASMNNSSTLLTMFLMFIGGGSLSTA  310
            N  +   M+ ++    A+FQ  ++  ++GF T  IA       +L +   FIGG + ST 
Sbjct  296  NVYSSALMTINQ----AFFQVVSMATTAGFTTDSIARWPLFLPVLLLCSAFIGGCAGSTG  351

Query  311  GGIKVGTFVILVFSVIAFLKR--HD----EVRIFNHSISYENTFKALAVVVITLILIFIG  364
            GG+KV   ++L       LKR  H      +++ N ++  E   +A+        L+FI 
Sbjct  352  GGLKVIRILLLFKQGNRELKRLVHPNAVYSIKLGNRALP-ERILEAVWGFFSAYALVFIV  410

Query  365  FFSILILEPHKNFLDLFFEIVSAACTVGLSRGIT----PQLNNSSLFVLSLLMYAGRLGP  420
                +I     +F   F  +V+    +G   G+       +N  + ++L   M  GRL  
Sbjct  411  SMLAIIATGVDDF-SAFASVVATLNNLGPGLGVVADNFTSMNPVAKWILIANMLFGRLEV  469

Query  421  LTLAYL  426
             TL  L
Sbjct  470  FTLLVL  475


> P0AFZ9 Trk system potassium uptake protein TrkH [Shigella flexneri]
Length=483

 Score = 66.2 bits (160),  Expect = 8e-15
 Identities = 106/426 (25%), Positives = 178/426 (42%), Gaps = 40/426 (9%)

Query  22   GFLSFIVAGTLL-----LKLPISNNGHLSWMDAFFTATSAVTITGLSVINIGQSLTHVGQ  76
            GFL  ++  T+L     L    S + +L+  DAFF + S +T TG + +    SL H   
Sbjct  69   GFLIVVLFWTVLGSVGALPFIFSESPNLTITDAFFESFSGLTTTGATTLVGLDSLPHAIL  128

Query  77   IILLFLIQCGGLGFMTFAILAALSLAPQLGL-KQQLMAQDSMGQTSLSKV-TFIAQAVFI  134
                 L   GG+G     I+ A+++ P LG+   QL   +  G    +K+   IA+    
Sbjct  129  FYRQMLQWFGGMGI----IVLAVAILPILGVGGMQLYRAEMPGPLKDNKMRPRIAETAKT  184

Query  135  YTLIFELMGTCILTFAWMNQFGFFHALYYAFFYSISAFNNAGFSLFPNNLMNFQTHYIAC  194
              LI+ L+        W      F A+ ++F    +     GFS    ++  F +  I  
Sbjct  185  LWLIYVLLTVACALALWFAGMDAFDAIGHSF----ATIAIGGFSTHDASIGYFDSPTINT  240

Query  195  LTISFLYILG---GLGFLVIMDIKERKRWKKLSPNSKIVIISIAILNTSAFLIIWLLEVN  251
            +   FL I G   GL F ++     +  W+   P  ++ I     L     L++W    +
Sbjct  241  IIAIFLLISGCNYGLHFSLLSGRSLKVYWR--DPEFRMFIGVQFTLVVICTLVLWF---H  295

Query  252  NPLTLYSMSFSEQALNAWFQ-ATVPRSSGFNTIDIASMNNSSTLLTMFLMFIGGGSLSTA  310
            N  +   M+ ++    A+FQ  ++  ++GF T  IA       +L +   FIGG + ST 
Sbjct  296  NVYSSALMTINQ----AFFQVVSMATTAGFTTDSIARWPLFLPVLLLCSAFIGGCAGSTG  351

Query  311  GGIKVGTFVILVFSVIAFLKR--HD----EVRIFNHSISYENTFKALAVVVITLILIFIG  364
            GG+KV   ++L       LKR  H      +++ N ++  E   +A+        L+FI 
Sbjct  352  GGLKVIRILLLFKQGNRELKRLVHPNAVYSIKLGNRALP-ERILEAVWGFFSAYALVFIV  410

Query  365  FFSILILEPHKNFLDLFFEIVSAACTVGLSRGIT----PQLNNSSLFVLSLLMYAGRLGP  420
                +I     +F   F  +V+    +G   G+       +N  + ++L   M  GRL  
Sbjct  411  SMLAIIATGVDDF-SAFASVVATLNNLGPGLGVVADNFTSMNPVAKWILIANMLFGRLEV  469

Query  421  LTLAYL  426
             TL  L
Sbjct  470  FTLLVL  475


> P0AFZ7 Trk system potassium uptake protein TrkH [Escherichia 
coli (strain K12)]
Length=483

 Score = 66.2 bits (160),  Expect = 8e-15
 Identities = 106/426 (25%), Positives = 178/426 (42%), Gaps = 40/426 (9%)

Query  22   GFLSFIVAGTLL-----LKLPISNNGHLSWMDAFFTATSAVTITGLSVINIGQSLTHVGQ  76
            GFL  ++  T+L     L    S + +L+  DAFF + S +T TG + +    SL H   
Sbjct  69   GFLIVVLFWTVLGSVGALPFIFSESPNLTITDAFFESFSGLTTTGATTLVGLDSLPHAIL  128

Query  77   IILLFLIQCGGLGFMTFAILAALSLAPQLGL-KQQLMAQDSMGQTSLSKV-TFIAQAVFI  134
                 L   GG+G     I+ A+++ P LG+   QL   +  G    +K+   IA+    
Sbjct  129  FYRQMLQWFGGMGI----IVLAVAILPILGVGGMQLYRAEMPGPLKDNKMRPRIAETAKT  184

Query  135  YTLIFELMGTCILTFAWMNQFGFFHALYYAFFYSISAFNNAGFSLFPNNLMNFQTHYIAC  194
              LI+ L+        W      F A+ ++F    +     GFS    ++  F +  I  
Sbjct  185  LWLIYVLLTVACALALWFAGMDAFDAIGHSF----ATIAIGGFSTHDASIGYFDSPTINT  240

Query  195  LTISFLYILG---GLGFLVIMDIKERKRWKKLSPNSKIVIISIAILNTSAFLIIWLLEVN  251
            +   FL I G   GL F ++     +  W+   P  ++ I     L     L++W    +
Sbjct  241  IIAIFLLISGCNYGLHFSLLSGRSLKVYWR--DPEFRMFIGVQFTLVVICTLVLWF---H  295

Query  252  NPLTLYSMSFSEQALNAWFQ-ATVPRSSGFNTIDIASMNNSSTLLTMFLMFIGGGSLSTA  310
            N  +   M+ ++    A+FQ  ++  ++GF T  IA       +L +   FIGG + ST 
Sbjct  296  NVYSSALMTINQ----AFFQVVSMATTAGFTTDSIARWPLFLPVLLLCSAFIGGCAGSTG  351

Query  311  GGIKVGTFVILVFSVIAFLKR--HD----EVRIFNHSISYENTFKALAVVVITLILIFIG  364
            GG+KV   ++L       LKR  H      +++ N ++  E   +A+        L+FI 
Sbjct  352  GGLKVIRILLLFKQGNRELKRLVHPNAVYSIKLGNRALP-ERILEAVWGFFSAYALVFIV  410

Query  365  FFSILILEPHKNFLDLFFEIVSAACTVGLSRGIT----PQLNNSSLFVLSLLMYAGRLGP  420
                +I     +F   F  +V+    +G   G+       +N  + ++L   M  GRL  
Sbjct  411  SMLAIIATGVDDF-SAFASVVATLNNLGPGLGVVADNFTSMNPVAKWILIANMLFGRLEV  469

Query  421  LTLAYL  426
             TL  L
Sbjct  470  FTLLVL  475


> P23849 Trk system potassium uptake protein TrkG [Escherichia 
coli (strain K12)]
Length=485

 Score = 65.9 bits (159),  Expect = 1e-14
 Identities = 92/401 (23%), Positives = 168/401 (42%), Gaps = 44/401 (11%)

Query  38   ISNNGHLSWMDAFFTATSAVTITGLSVINIGQSLTHVGQIILLFLIQCGGLGFMTFAILA  97
            I +  +L+++DA F   S +T TG +VI+   SL          L   GGLG     I+ 
Sbjct  93   IDSELNLTFIDALFEGVSGITTTGATVIDDVSSLPRAYLYYRSQLNFIGGLG----VIVL  148

Query  98   ALSLAPQLGLKQQLMAQDSM-GQTSLSKVT-FIAQAVFIYTLIFELMG-TCILTFAWMNQ  154
            A+++ P LG+    + Q  M G     K+T  +A       + + L+G  CI+ +     
Sbjct  149  AVAVLPLLGIGGAKLYQSEMPGPFKDDKLTPRLADTSRTLWITYSLLGIACIVCYRLAGM  208

Query  155  FGFFHALYYAFFYSISAFNNAGFSLFPNNLMNFQTHYIACLTISFLYILGGLGFLVIMDI  214
                  L+ A  + IS  +  GFS    ++  F  + +  +  SF  +L    F +   +
Sbjct  209  -----PLFDAICHGISTVSLGGFSTHSESIGYFNNYLVELVAGSFS-LLSAFNFTLWYIV  262

Query  215  KERKRWKKLSPNSKI---VIISIAILNTSAFLIIWLLEVNNPLTLYSMSFSEQALNAWFQ  271
              RK  K L  + ++   ++I++ ++  ++F + W + + +    +  SF       +  
Sbjct  263  ISRKTIKPLIRDIELRFFLLIALGVIIVTSFQV-WHIGMYDLHGSFIHSF-------FLA  314

Query  272  ATVPRSSGFNTIDIASMNNSSTLLTMFLMFIGGGSLSTAGGIKVGTFVILVFSVIAFLKR  331
            +++   +G  T D AS    + +  +   F GG   ST GGIK   F+IL      F + 
Sbjct  315  SSMLTDNGLATQDYASWPTHTIVFLLLSSFFGGCIGSTCGGIKSLRFLIL------FKQS  368

Query  332  HDEVRIFNHSISYENTFKALAVVV----------ITLILIFIGFFSILILEPHKNFLDLF  381
              E+   +H  +  +      +V             L  +F  FF +++     +FL  F
Sbjct  369  KHEINQLSHPRALLSVNVGGKIVTDRVMRSVWSFFFLYTLFTVFFILVLNGMGYDFLTSF  428

Query  382  FEIVSAACTVGLSRGITPQ----LNNSSLFVLSLLMYAGRL  418
              + +    +GL  G T      LN+ +  ++ + M  GRL
Sbjct  429  ATVAACINNMGLGFGATASSFGVLNDIAKCLMCIAMILGRL  469


> Q10065 Potassium transport protein 2 [Schizosaccharomyces pombe 
(strain 972 / ATCC 24843)]
Length=880

 Score = 65.1 bits (157),  Expect = 3e-14
 Identities = 78/351 (22%), Positives = 144/351 (41%), Gaps = 56/351 (16%)

Query  121  SLSKVTFIAQAVFIYTLIFELMGTCILTFAWMNQF-----GFFHALYYAFFYSISAFNNA  175
            SL  +T I    F++  I  L+   I  +           G  +  ++A F S S F+N 
Sbjct  487  SLRILTVILVVYFLFWHILGLVAFLIFIYTAKTSGRVVTDGGINRGWWAAFTSSSLFDNL  546

Query  176  GFSLFPNNLMNFQTHYIACLTISFLYILGGLGFLVIMD--IKERKRWKKLSPNSK-----  228
            G+SL  ++L +FQ      +  + L  LG   F +++   I    R  + SPN +     
Sbjct  547  GYSLNSDSLNSFQKAIFPQVLGTILIFLGNTFFPIMLRFIIWIMIRTTRFSPNFQQALYF  606

Query  229  -------------------IVIISIAILNTSAFLIIWLLEVNNPLTLYSMSFSEQALNAW  269
                               ++ +++ +LN ++F    +L++ N   +  +    + +NA 
Sbjct  607  LFEHPRRSFTLLFPSKTTWVLFLNLTLLNFASFFFFMVLDLGNSY-VDKIPVGYRIMNAI  665

Query  270  FQATVPRSSGFNTIDIASMNNSSTLLTMFLMFIGGGSLSTAGGIKVGTFVILVFSVIAFL  329
            FQ    RS+GF  +D++ +  +  +  MF+M+I    ++ +   +   +      + A  
Sbjct  666  FQNAATRSAGFTVVDLSQIAPAVMVTYMFMMYISAYPIAMSIR-QTNVYEERSLGIYAAD  724

Query  330  KRHDEVRIFNHSISYENTFKALAVVV--------ITLILIFIGFFSILIL---------E  372
              +D+    N++ +  NT K    ++          L  +F+G+F I I+         E
Sbjct  725  TENDDDNNINNNNNDNNTPKRKNFLMDHIQRQLSHDLWYLFLGYFIITIVEGRRLESEAE  784

Query  373  PHKNFLDLFFEIVSAACTVGLSRG------ITPQLNNSSLFVLSLLMYAGR  417
            P      + FE++S   TVGLS G      +T Q    S  V+  L   GR
Sbjct  785  PQFTLFAILFEVISGYGTVGLSLGYKNDPSLTAQFRKISKLVMVALQIRGR  835


 Score = 36.2 bits (82),  Expect = 3e-05
 Identities = 19/57 (33%), Positives = 33/57 (58%), Gaps = 0/57 (0%)

Query  25  SFIVAGTLLLKLPISNNGHLSWMDAFFTATSAVTITGLSVINIGQSLTHVGQIILLF  81
           SFI+  T+L  + +  +G+L ++DA   A+ + T TGL  +++ Q   +    ILLF
Sbjct  32  SFIIGMTILCSVILYGSGNLRYIDALLLASGSCTQTGLQPVDLTQISIYQQLTILLF  88


> Q6H501 Probable cation transporter HKT6 [Oryza sativa subsp. 
japonica]
Length=531

 Score = 60.8 bits (146),  Expect = 5e-13
 Identities = 104/491 (21%), Positives = 193/491 (39%), Gaps = 107/491 (22%)

Query  24   LSFIVAGTLLLKLPISNNGHLSWMDAFFTATSAVTITGLSVINIGQSLTHVGQIILLFLI  83
            +SF   G+L +  P   +  L  +D  FT+ SA T++ ++ + + +  +     +L  L+
Sbjct  57   ISFAGYGSLKVLKPRDKSNTLKDLDVLFTSVSASTVSSMATVEM-EDFSSAQLWVLTILM  115

Query  84   QCGGLGFMTFAILAALSLAPQLGLKQQLMAQDSMGQTSLSKVT-----------------  126
              GG  F +  +L    +  + G K+ +  +D      +  +T                 
Sbjct  116  LIGGEVFTS--MLGIHFMRAEFGTKESVSTRDHSPCIDIESITSTKFGPSTQGTKVTVSF  173

Query  127  -----------------FIAQAVFIYTLIFELMGTCILTFAWMNQFGFFHALY-------  162
                             F+   V  Y LI  L G+ +L + ++N     H +        
Sbjct  174  SELRMENGGHVEPKTIKFLGFVVMGYLLITNLGGS-LLIYLYLNLVPSAHKILKRKGIGI  232

Query  163  --YAFFYSISAFNNAGFSLFPNNLMNFQTHYIACLTI--------------------SFL  200
              ++ F +IS+  N GF+    N++ FQ + I  L I                    S  
Sbjct  233  IVFSVFTAISSVGNCGFTPVNENMIIFQKNSILLLLILPQILAGNTLFAPCLRLMVWSLE  292

Query  201  YILGGLGFLVIMDIKERKRWKKLSPNSKIV-----IISIAILNTSAFLII-WLLEVNNPL  254
             I G      I++  +   +K L    + V     ++S+ IL T  FL + W     + +
Sbjct  293  KITGKKDCRYILEYPKAIGYKHLMSTRESVYLTLTVVSLIILQTVLFLSLEW-----SSV  347

Query  255  TLYSMSFSEQALNAWFQATVPRSSGFNTIDIASMNNSSTLLTMFLMFIGGGSLSTAGGIK  314
             L  MS  ++ ++A FQ+   R +G +  D+++++++  +L   +M++ G +        
Sbjct  348  ALDGMSNYQKIVSALFQSVNARHAGESVTDLSNLSSAILVLYTIMMYLPGYT--------  399

Query  315  VGTFVILVFSVIAFLKRHDEVRIFNHSIS-----YEN-TFKALAVVVITLILIFIGFFSI  368
                        +FL RHD        I+      EN  F  ++ + I ++LI I     
Sbjct  400  ------------SFLPRHDGEDSKTEKINKRKGLLENWIFSHMSYLAIFVMLICITERDS  447

Query  369  LILEP-HKNFLDLFFEIVSAACTVGLSRGITPQ--LNNSSLFVLSLLMYAGRLGPLTLAY  425
            +  +P + N   + FE+VSA   VG S G + +  LN+ +    +   +AG+      A 
Sbjct  448  MATDPLNFNVFSILFEVVSAYGNVGFSVGYSCKRLLNHDARCKDASYGFAGKWSDNGKAI  507

Query  426  LIATPKKSRLK  436
            LI      RLK
Sbjct  508  LIIVMLFGRLK  518


 Score = 31.2 bits (69),  Expect = 0.001
 Identities = 28/105 (27%), Positives = 48/105 (46%), Gaps = 8/105 (8%)

Query  317  TFVILVFSVIAFLKRHDEVRIFNHSISYENTFKALAVVVITLILIFIGFFSILILEPHKN  376
            TF    FS  +F K   +   ++    Y+N    + V    LI  F G+ S+ +L+P   
Sbjct  17   TFAASKFS--SFTKSAQKSIKYSFQFIYQNNPLFVHVAYFALIS-FAGYGSLKVLKPRDK  73

Query  377  F-----LDLFFEIVSAACTVGLSRGITPQLNNSSLFVLSLLMYAG  416
                  LD+ F  VSA+    ++       +++ L+VL++LM  G
Sbjct  74   SNTLKDLDVLFTSVSASTVSSMATVEMEDFSSAQLWVLTILMLIG  118


> P28584 Low-affinity potassium transport protein [Saccharomyces 
cerevisiae (strain ATCC 204508 / S288c)]
Length=889

 Score = 60.1 bits (144),  Expect = 1e-12
 Identities = 78/341 (23%), Positives = 148/341 (43%), Gaps = 77/341 (23%)

Query  162  YYAFFYSISAFNNAGFSLFPNNLMNFQTHYIACLTISFLYILGGLGFLVIM---------  212
            ++ FF ++SAF+N G SL  +++++F T     + + F  I+G  GF +++         
Sbjct  504  WWGFFTAMSAFSNLGLSLTADSMVSFDTAPYPLIFMMFFIIIGNTGFPIMLRFIIWIMFK  563

Query  213  ------DIKE---------RKRWKKLSPNSKI--VIISIAILNTSAFLIIWLLEVNNPLT  255
                    KE         R+ +  L P+     +  ++ +LN + +++  +L+ N+ + 
Sbjct  564  TSRDLSQFKESLGFLLDHPRRCFTLLFPSGPTWWLFTTLVVLNATDWILFIILDFNSAV-  622

Query  256  LYSMSFSEQALNAWFQATVPRSSGFNTIDIASMNNSSTLLTMFLMFIGGGSLSTAGGIKV  315
            +  ++   +AL   FQ+   R++GFN +D++ ++ S  +  M +M++    L  A  I+ 
Sbjct  623  VRQVAKGYRALMGLFQSVCTRTAGFNVVDLSKLHPSIQVSYMLMMYV--SVLPLAISIR-  679

Query  316  GTFVILVFSVIAF--------LKRHDEVRIFNH--------SISYENTFKALA-------  352
             T V    S+  +        +   D+++  +H        ++S ++  K  +       
Sbjct  680  RTNVYEEQSLGLYDSGQDDENITHEDDIKETDHDGESEERDTVSTKSKPKKQSPKSFVGA  739

Query  353  ----VVVITLILIFIGFFSILILE---------PHKNFLDLFFEIVSAACTVGLSRGITP  399
                 +   L  +F+G F I I E         P  N   + FE+VSA  TVGLS G  P
Sbjct  740  HLRRQLSFDLWYLFLGLFIICICEGRKIEDVNKPDFNVFAILFEVVSAYGTVGLSLGY-P  798

Query  400  QLNN---------SSLFVLSLLMYAGRLG-PLTLAYLIATP  430
              N          S L ++++L+     G P TL   I  P
Sbjct  799  NTNTSLSAQFTVLSKLVIIAMLIRGRNRGLPYTLDRAIMLP  839


 Score = 25.4 bits (54),  Expect = 0.066
 Identities = 19/65 (29%), Positives = 32/65 (49%), Gaps = 5/65 (8%)

Query  353  VVVITLILIFIGFFSILILEPHKN--FLDLFFEIVSAACTVGLSRGITPQLN---NSSLF  407
            +VV  + LI +     ++L P KN  F+D+ F    A+   GL+   T   N      ++
Sbjct  54   IVVHYIYLITLSIIGSILLYPCKNTAFIDVLFLAAGASTQGGLATKSTNDFNLYQQIVVY  113

Query  408  VLSLL  412
            V++LL
Sbjct  114  VITLL  118


 Score = 22.7 bits (47),  Expect = 0.45
 Identities = 18/56 (32%), Positives = 23/56 (41%), Gaps = 3/56 (5%)

Query  38   ISNNGHLSWMDAFFTATSAVTITGLSVI---NIGQSLTHVGQIILLFLIQCGGLGF  90
            I  NG       FFTA SA +  GLS+     +         I ++F I  G  GF
Sbjct  495  IRRNGVSPTWWGFFTAMSAFSNLGLSLTADSMVSFDTAPYPLIFMMFFIIIGNTGF  550


 Score = 19.6 bits (39),  Expect = 4.0
 Identities = 11/19 (58%), Positives = 13/19 (68%), Gaps = 1/19 (5%)

Query  259  MSFSEQ-ALNAWFQATVPR  276
            MSFS Q +LN  FQA  P+
Sbjct  389  MSFSPQESLNLQFQAHPPK  407


 Score = 18.9 bits (37),  Expect = 6.9
 Identities = 8/22 (36%), Positives = 14/22 (64%), Gaps = 3/22 (14%)

Query  179  LFPNNLMNFQTHYIACLTISFL  200
            +FPN ++    HYI  +T+S +
Sbjct  49   VFPNFIV---VHYIYLITLSII  67



Lambda      K        H        a         alpha
   0.330    0.142    0.418    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3046143


  Database: cd19c89ab0e728ffa2393df0b2287f4b.SwissProt.fasta
    Posted date:  Sep 26, 2020  8:04 PM
  Number of letters in database: 8,599
  Number of sequences in database:  16



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40