ACIAD1345 / TrEMBL Alignments

BLASTP 2.2.28+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: a9aa23834bd08931739e2cd008c6ddff.TrEMBL.fasta
           13 sequences; 2,765 total letters



Query= ACIAD1345

Length=209
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  Q6FCJ7 Uncharacterized protein [Acinetobacter baylyi (strain AT...   404    9e-148
  A0A0M1HNE1 Membrane protein [Acinetobacter sp. C15]                  334    4e-120
  N9BMK3 Uncharacterized protein [Acinetobacter soli NIPH 2899]        333    6e-120
  A0A1P8EHZ1 Uncharacterized protein [Acinetobacter soli]              333    6e-120
  N9RWC1 Uncharacterized protein [Acinetobacter ursingii NIPH 706]     320    1e-114
  N9DCK7 Uncharacterized protein [Acinetobacter ursingii ANC 3649]     320    1e-114
  A0A2N6VDG5 Membrane protein [Acinetobacter ursingii]                 320    1e-114
  A0A009ZGK2 Uncharacterized protein [Acinetobacter sp. 479375]        318    5e-114
  A0A1E7RCL9 YitT family protein [Acinetobacter qingfengensis]         295    6e-105
  A0A2G6LFU3 Uncharacterized protein [Gammaproteobacteria bacterium]   271    1e-95 
  A0A0M2ZZ16 Membrane protein [Acinetobacter sp. AG1]                  268    5e-94 
  N8QXD4 Uncharacterized protein [Acinetobacter sp. NIPH 236]          267    7e-94 
  R4J7H7 MgtC [Bacillus sp. HH1500]                                   45.1    2e-09 


> Q6FCJ7 Uncharacterized protein [Acinetobacter baylyi (strain 
ATCC 33305 / BD413 / ADP1)]
Length=208

 Score =  404 bits (1038),  Expect = 9e-148
 Identities = 208/208 (100%), Positives = 208/208 (100%), Gaps = 0/208 (0%)

Query  1    MAKPNDFLVTIPKKSHSSIEDMLAMVIATFIISFGMMLMQKAGAMTGGTAGLSLLIHYMT  60
            MAKPNDFLVTIPKKSHSSIEDMLAMVIATFIISFGMMLMQKAGAMTGGTAGLSLLIHYMT
Sbjct  1    MAKPNDFLVTIPKKSHSSIEDMLAMVIATFIISFGMMLMQKAGAMTGGTAGLSLLIHYMT  60

Query  61   GIKFGLVFFTINIPFYYLAFKRLGTPMVIKTFLAVGLLSILTEVHPLFIHLDALSPLYAT  120
            GIKFGLVFFTINIPFYYLAFKRLGTPMVIKTFLAVGLLSILTEVHPLFIHLDALSPLYAT
Sbjct  61   GIKFGLVFFTINIPFYYLAFKRLGTPMVIKTFLAVGLLSILTEVHPLFIHLDALSPLYAT  120

Query  121  ILANVFMGLGFLILFRHRSSLGGFNLLVLFLQERYKIPAGKIQMGLDICILVASMAFISF  180
            ILANVFMGLGFLILFRHRSSLGGFNLLVLFLQERYKIPAGKIQMGLDICILVASMAFISF
Sbjct  121  ILANVFMGLGFLILFRHRSSLGGFNLLVLFLQERYKIPAGKIQMGLDICILVASMAFISF  180

Query  181  PLLLISILGAVILNLILTLNHRPDRYVV  208
            PLLLISILGAVILNLILTLNHRPDRYVV
Sbjct  181  PLLLISILGAVILNLILTLNHRPDRYVV  208


> A0A0M1HNE1 Membrane protein [Acinetobacter sp. C15]
Length=208

 Score =  334 bits (856),  Expect = 4e-120
 Identities = 166/208 (80%), Positives = 187/208 (90%), Gaps = 0/208 (0%)

Query  1    MAKPNDFLVTIPKKSHSSIEDMLAMVIATFIISFGMMLMQKAGAMTGGTAGLSLLIHYMT  60
            M+   D  + I K SHSS+EDMLAM+IATFIISFGMMLMQ++G +TGGTAGLSLLIHY+T
Sbjct  1    MSNTADLTMQISKPSHSSVEDMLAMIIATFIISFGMMLMQQSGTLTGGTAGLSLLIHYIT  60

Query  61   GIKFGLVFFTINIPFYYLAFKRLGTPMVIKTFLAVGLLSILTEVHPLFIHLDALSPLYAT  120
            GIKFG+VFFTIN+PFYYLA+KRLG  MVIKTFLAVGLLS+LTEVHPLF+HLD LSPLYAT
Sbjct  61   GIKFGVVFFTINLPFYYLAYKRLGMSMVIKTFLAVGLLSVLTEVHPLFLHLDKLSPLYAT  120

Query  121  ILANVFMGLGFLILFRHRSSLGGFNLLVLFLQERYKIPAGKIQMGLDICILVASMAFISF  180
            +LANVFMGLGFLILFRHRSSLGGFNLLVLF+QERY I AGK+QM LD+ IL+AS  F+S 
Sbjct  121  VLANVFMGLGFLILFRHRSSLGGFNLLVLFIQERYGIRAGKVQMALDVTILLASSVFVSV  180

Query  181  PLLLISILGAVILNLILTLNHRPDRYVV  208
             LL ISILGA+ILN+ILTLNHRPDRYVV
Sbjct  181  TLLAISILGAIILNMILTLNHRPDRYVV  208


> N9BMK3 Uncharacterized protein [Acinetobacter soli NIPH 2899]
Length=208

 Score =  333 bits (855),  Expect = 6e-120
 Identities = 166/208 (80%), Positives = 186/208 (89%), Gaps = 0/208 (0%)

Query  1    MAKPNDFLVTIPKKSHSSIEDMLAMVIATFIISFGMMLMQKAGAMTGGTAGLSLLIHYMT  60
            M    D  + I K SHSS+EDMLAM+IATFIISFGMMLMQ++G +TGGTAGLSLLIHY+T
Sbjct  1    MTNTADLTMQISKPSHSSVEDMLAMIIATFIISFGMMLMQQSGTLTGGTAGLSLLIHYIT  60

Query  61   GIKFGLVFFTINIPFYYLAFKRLGTPMVIKTFLAVGLLSILTEVHPLFIHLDALSPLYAT  120
            GIKFG+VFFTIN+PFYYLA+KRLG  MVIKTFLAVGLLS+LTEVHPLF+HLD LSPLYAT
Sbjct  61   GIKFGVVFFTINLPFYYLAYKRLGMSMVIKTFLAVGLLSVLTEVHPLFLHLDKLSPLYAT  120

Query  121  ILANVFMGLGFLILFRHRSSLGGFNLLVLFLQERYKIPAGKIQMGLDICILVASMAFISF  180
            +LANVFMGLGFLILFRHRSSLGGFNLLVLF+QERY I AGK+QM LD+ IL+AS  F+S 
Sbjct  121  VLANVFMGLGFLILFRHRSSLGGFNLLVLFIQERYGIRAGKVQMALDVTILLASSVFVSV  180

Query  181  PLLLISILGAVILNLILTLNHRPDRYVV  208
             LL ISILGA+ILN+ILTLNHRPDRYVV
Sbjct  181  TLLAISILGAIILNMILTLNHRPDRYVV  208


> A0A1P8EHZ1 Uncharacterized protein [Acinetobacter soli]
Length=208

 Score =  333 bits (855),  Expect = 6e-120
 Identities = 166/208 (80%), Positives = 187/208 (90%), Gaps = 0/208 (0%)

Query  1    MAKPNDFLVTIPKKSHSSIEDMLAMVIATFIISFGMMLMQKAGAMTGGTAGLSLLIHYMT  60
            M+   D  + I K SHSS+EDMLAM+IATFIISFGMMLMQ++G +TGGTAGLSLLIHY+T
Sbjct  1    MSNTADLTMQISKPSHSSVEDMLAMIIATFIISFGMMLMQQSGTLTGGTAGLSLLIHYIT  60

Query  61   GIKFGLVFFTINIPFYYLAFKRLGTPMVIKTFLAVGLLSILTEVHPLFIHLDALSPLYAT  120
            GIKFG+VFFTIN+PFYYLA+KRLG  MVIKTFLAVGLLS+LTEVHPLF+HLD LSPLYAT
Sbjct  61   GIKFGVVFFTINLPFYYLAYKRLGMSMVIKTFLAVGLLSLLTEVHPLFLHLDKLSPLYAT  120

Query  121  ILANVFMGLGFLILFRHRSSLGGFNLLVLFLQERYKIPAGKIQMGLDICILVASMAFISF  180
            +LANVFMGLGFLILFRHRSSLGGFNLLVLF+QERY I AGK+QM LD+ IL+AS  F+S 
Sbjct  121  VLANVFMGLGFLILFRHRSSLGGFNLLVLFIQERYGIRAGKVQMALDVTILLASSVFVSV  180

Query  181  PLLLISILGAVILNLILTLNHRPDRYVV  208
             LL ISILGA+ILN+ILTLNHRPDRYVV
Sbjct  181  TLLAISILGAIILNMILTLNHRPDRYVV  208


> N9RWC1 Uncharacterized protein [Acinetobacter ursingii NIPH 706]
Length=211

 Score =  320 bits (820),  Expect = 1e-114
 Identities = 158/197 (80%), Positives = 179/197 (91%), Gaps = 0/197 (0%)

Query  11   IPKKSHSSIEDMLAMVIATFIISFGMMLMQKAGAMTGGTAGLSLLIHYMTGIKFGLVFFT  70
            I  + H+ IED LAM+IATFIISFGMMLMQ+AG +TGGTAGLSLLIHY TG+KFGLVFF 
Sbjct  14   IKTRPHTYIEDGLAMIIATFIISFGMMLMQQAGTLTGGTAGLSLLIHYATGLKFGLVFFL  73

Query  71   INIPFYYLAFKRLGTPMVIKTFLAVGLLSILTEVHPLFIHLDALSPLYATILANVFMGLG  130
            INIPFYYLA+KRLG PMVIKTF+AV LLS+LTE+HP FIH+D L+PLYAT+LANV MGLG
Sbjct  74   INIPFYYLAYKRLGMPMVIKTFVAVALLSVLTELHPYFIHVDGLTPLYATVLANVLMGLG  133

Query  131  FLILFRHRSSLGGFNLLVLFLQERYKIPAGKIQMGLDICILVASMAFISFPLLLISILGA  190
            FLILFRHRSSLGGFNLLVLF+QERY +PAGK+QMGLDI IL+AS+AF+S+ LL ISILGA
Sbjct  134  FLILFRHRSSLGGFNLLVLFIQERYGVPAGKVQMGLDISILLASVAFVSWTLLAISILGA  193

Query  191  VILNLILTLNHRPDRYV  207
            +ILNLIL LNHRPDRYV
Sbjct  194  IILNLILALNHRPDRYV  210


 Score = 15.8 bits (29),  Expect = 7.8
 Identities = 6/15 (40%), Positives = 8/15 (53%), Gaps = 0/15 (0%)

Query  193  LNLILTLNHRPDRYV  207
            LNL   +  RP  Y+
Sbjct  8    LNLNAEIKTRPHTYI  22


> N9DCK7 Uncharacterized protein [Acinetobacter ursingii ANC 3649]
Length=211

 Score =  320 bits (820),  Expect = 1e-114
 Identities = 158/197 (80%), Positives = 179/197 (91%), Gaps = 0/197 (0%)

Query  11   IPKKSHSSIEDMLAMVIATFIISFGMMLMQKAGAMTGGTAGLSLLIHYMTGIKFGLVFFT  70
            I  + H+ IED LAM+IATFIISFGMMLMQ+AG +TGGTAGLSLLIHY TG+KFGLVFF 
Sbjct  14   IKTRPHTYIEDGLAMIIATFIISFGMMLMQQAGTLTGGTAGLSLLIHYATGLKFGLVFFL  73

Query  71   INIPFYYLAFKRLGTPMVIKTFLAVGLLSILTEVHPLFIHLDALSPLYATILANVFMGLG  130
            INIPFYYLA+KRLG PMVIKTF+AV LLS+LTE+HP FIH+D L+PLYAT+LANV MGLG
Sbjct  74   INIPFYYLAYKRLGMPMVIKTFVAVALLSVLTELHPYFIHVDGLTPLYATVLANVLMGLG  133

Query  131  FLILFRHRSSLGGFNLLVLFLQERYKIPAGKIQMGLDICILVASMAFISFPLLLISILGA  190
            FLILFRHRSSLGGFNLLVLF+QERY +PAGK+QMGLDI IL+AS+AF+S+ LL ISILGA
Sbjct  134  FLILFRHRSSLGGFNLLVLFIQERYGVPAGKVQMGLDISILLASVAFVSWTLLAISILGA  193

Query  191  VILNLILTLNHRPDRYV  207
            +ILNLIL LNHRPDRYV
Sbjct  194  IILNLILALNHRPDRYV  210


 Score = 15.8 bits (29),  Expect = 7.8
 Identities = 6/15 (40%), Positives = 8/15 (53%), Gaps = 0/15 (0%)

Query  193  LNLILTLNHRPDRYV  207
            LNL   +  RP  Y+
Sbjct  8    LNLNAEIKTRPHTYI  22


> A0A2N6VDG5 Membrane protein [Acinetobacter ursingii]
Length=211

 Score =  320 bits (820),  Expect = 1e-114
 Identities = 158/197 (80%), Positives = 179/197 (91%), Gaps = 0/197 (0%)

Query  11   IPKKSHSSIEDMLAMVIATFIISFGMMLMQKAGAMTGGTAGLSLLIHYMTGIKFGLVFFT  70
            I  + H+ IED LAM+IATFIISFGMMLMQ+AG +TGGTAGLSLLIHY TG+KFGLVFF 
Sbjct  14   IKTRPHTYIEDGLAMIIATFIISFGMMLMQQAGTLTGGTAGLSLLIHYATGLKFGLVFFL  73

Query  71   INIPFYYLAFKRLGTPMVIKTFLAVGLLSILTEVHPLFIHLDALSPLYATILANVFMGLG  130
            INIPFYYLA+KRLG PMVIKTF+AV LLS+LTE+HP FIH+D L+PLYAT+LANV MGLG
Sbjct  74   INIPFYYLAYKRLGMPMVIKTFVAVALLSVLTELHPYFIHVDGLTPLYATVLANVLMGLG  133

Query  131  FLILFRHRSSLGGFNLLVLFLQERYKIPAGKIQMGLDICILVASMAFISFPLLLISILGA  190
            FLILFRHRSSLGGFNLLVLF+QERY +PAGK+QMGLDI IL+AS+AF+S+ LL ISILGA
Sbjct  134  FLILFRHRSSLGGFNLLVLFIQERYGVPAGKVQMGLDISILLASVAFVSWTLLAISILGA  193

Query  191  VILNLILTLNHRPDRYV  207
            +ILNLIL LNHRPDRYV
Sbjct  194  IILNLILALNHRPDRYV  210


 Score = 15.8 bits (29),  Expect = 7.8
 Identities = 6/15 (40%), Positives = 8/15 (53%), Gaps = 0/15 (0%)

Query  193  LNLILTLNHRPDRYV  207
            LNL   +  RP  Y+
Sbjct  8    LNLNAEIKTRPHTYI  22


> A0A009ZGK2 Uncharacterized protein [Acinetobacter sp. 479375]
Length=211

 Score =  318 bits (816),  Expect = 5e-114
 Identities = 157/197 (80%), Positives = 178/197 (90%), Gaps = 0/197 (0%)

Query  11   IPKKSHSSIEDMLAMVIATFIISFGMMLMQKAGAMTGGTAGLSLLIHYMTGIKFGLVFFT  70
            I  + H+ IED LAM+IATFIISFGMMLMQ+AG +TGGTAGLSLLIHY TG+KFGLVFF 
Sbjct  14   IKTRPHTYIEDGLAMIIATFIISFGMMLMQQAGTLTGGTAGLSLLIHYATGLKFGLVFFL  73

Query  71   INIPFYYLAFKRLGTPMVIKTFLAVGLLSILTEVHPLFIHLDALSPLYATILANVFMGLG  130
            INIPFYYLA+KRLG PMVIKTF+AV LLS+LTE+HP FIH+D L+PLYAT+LANV MGLG
Sbjct  74   INIPFYYLAYKRLGMPMVIKTFVAVALLSVLTELHPYFIHVDGLTPLYATVLANVLMGLG  133

Query  131  FLILFRHRSSLGGFNLLVLFLQERYKIPAGKIQMGLDICILVASMAFISFPLLLISILGA  190
            FLILFRHRSSLGGFNLLVLF+QERY +PAGK+QMGLDI IL+AS+ F+S+ LL ISILGA
Sbjct  134  FLILFRHRSSLGGFNLLVLFIQERYGVPAGKVQMGLDISILLASVVFVSWTLLAISILGA  193

Query  191  VILNLILTLNHRPDRYV  207
            +ILNLIL LNHRPDRYV
Sbjct  194  IILNLILALNHRPDRYV  210


 Score = 15.8 bits (29),  Expect = 7.8
 Identities = 6/15 (40%), Positives = 8/15 (53%), Gaps = 0/15 (0%)

Query  193  LNLILTLNHRPDRYV  207
            LNL   +  RP  Y+
Sbjct  8    LNLNAEIKTRPHTYI  22


> A0A1E7RCL9 YitT family protein [Acinetobacter qingfengensis]
Length=198

 Score =  295 bits (755),  Expect = 6e-105
 Identities = 135/197 (69%), Positives = 174/197 (88%), Gaps = 0/197 (0%)

Query  11   IPKKSHSSIEDMLAMVIATFIISFGMMLMQKAGAMTGGTAGLSLLIHYMTGIKFGLVFFT  70
            +P +SHS +ED LAM+IATF+ISF +ML+Q++G +TGGTAGL+ L+HY+TGI+FG++FF 
Sbjct  1    MPIRSHSHVEDALAMIIATFVISFAVMLIQQSGTLTGGTAGLAFLLHYVTGIRFGIIFFL  60

Query  71   INIPFYYLAFKRLGTPMVIKTFLAVGLLSILTEVHPLFIHLDALSPLYATILANVFMGLG  130
            INIPFYYLA+KRLG  MVIKTF+AV LLSILTE+HP +IH+D L P Y T+LAN+ +G+G
Sbjct  61   INIPFYYLAYKRLGLAMVIKTFIAVALLSILTELHPHYIHIDTLMPFYGTLLANILLGIG  120

Query  131  FLILFRHRSSLGGFNLLVLFLQERYKIPAGKIQMGLDICILVASMAFISFPLLLISILGA  190
            FLILFRHRSSLGG NLL LF+Q+RY I AGK+Q+ +D+CIL+ASM F+SF LL+ISI+GA
Sbjct  121  FLILFRHRSSLGGVNLLALFIQDRYGISAGKVQLAIDMCILLASMPFVSFKLLIISIIGA  180

Query  191  VILNLILTLNHRPDRYV  207
            +ILN+ILT+NHRPDRY+
Sbjct  181  IILNMILTINHRPDRYL  197


> A0A2G6LFU3 Uncharacterized protein [Gammaproteobacteria bacterium]
Length=206

 Score =  271 bits (694),  Expect = 1e-95
 Identities = 124/192 (65%), Positives = 164/192 (85%), Gaps = 0/192 (0%)

Query  16   HSSIEDMLAMVIATFIISFGMMLMQKAGAMTGGTAGLSLLIHYMTGIKFGLVFFTINIPF  75
            HS+IED++A++  TF+ SF +MLMQ+AG +TGGTAGL+LL+HY T + F L+FF +NIPF
Sbjct  12   HSNIEDIIALLTGTFLCSFALMLMQQAGILTGGTAGLALLLHYATKLNFSLLFFLVNIPF  71

Query  76   YYLAFKRLGTPMVIKTFLAVGLLSILTEVHPLFIHLDALSPLYATILANVFMGLGFLILF  135
            YYLA+KRLGT M++KTF+++ LLSI+TEVHPLF ++D + P YATI AN+ +G+G LILF
Sbjct  72   YYLAYKRLGTTMLLKTFVSIALLSIMTEVHPLFFNIDNIDPWYATITANICIGIGLLILF  131

Query  136  RHRSSLGGFNLLVLFLQERYKIPAGKIQMGLDICILVASMAFISFPLLLISILGAVILNL  195
            RHR+SLGGFNLL L++QE YKIPAGK+QM +DIC+L+ S+A+IS  LLLIS++G VILNL
Sbjct  132  RHRASLGGFNLLALYIQEYYKIPAGKVQMAMDICVLIVSLAYISSKLLLISMIGVVILNL  191

Query  196  ILTLNHRPDRYV  207
            IL +NHR DRY+
Sbjct  192  ILAMNHRTDRYI  203


> A0A0M2ZZ16 Membrane protein [Acinetobacter sp. AG1]
Length=212

 Score =  268 bits (684),  Expect = 5e-94
 Identities = 128/192 (67%), Positives = 161/192 (84%), Gaps = 0/192 (0%)

Query  16   HSSIEDMLAMVIATFIISFGMMLMQKAGAMTGGTAGLSLLIHYMTGIKFGLVFFTINIPF  75
            HS IED LAM+I TFI+SF M L+Q+AG MTGGTAGLSLLIHY+T +KFG++FF INIPF
Sbjct  20   HSKIEDGLAMLIGTFILSFAMTLLQQAGIMTGGTAGLSLLIHYITDLKFGILFFLINIPF  79

Query  76   YYLAFKRLGTPMVIKTFLAVGLLSILTEVHPLFIHLDALSPLYATILANVFMGLGFLILF  135
            YY A+K++G  +V+KTF+AVGLL+  TE+ P F HL +++P+YA I ANV MG+ FLILF
Sbjct  80   YYFAYKKMGMALVVKTFIAVGLLAGFTEIIPHFFHLSSVNPIYAAIFANVLMGVSFLILF  139

Query  136  RHRSSLGGFNLLVLFLQERYKIPAGKIQMGLDICILVASMAFISFPLLLISILGAVILNL  195
            RHRSSLGG NLLVL+LQER+ IPAGK+QMG+D+ IL+ S+ F+ + L+LISILGAVILNL
Sbjct  140  RHRSSLGGINLLVLYLQERFNIPAGKVQMGIDVTILLVSLFFVDWKLILISILGAVILNL  199

Query  196  ILTLNHRPDRYV  207
            I+ LNH+  RYV
Sbjct  200  IILLNHKSSRYV  211


> N8QXD4 Uncharacterized protein [Acinetobacter sp. NIPH 236]
Length=212

 Score =  267 bits (683),  Expect = 7e-94
 Identities = 128/192 (67%), Positives = 161/192 (84%), Gaps = 0/192 (0%)

Query  16   HSSIEDMLAMVIATFIISFGMMLMQKAGAMTGGTAGLSLLIHYMTGIKFGLVFFTINIPF  75
            HS IED LAM+I TFI+SF M L+Q+AG MTGGTAGLSLLIHY+T +KFG++FF INIPF
Sbjct  20   HSKIEDGLAMLIGTFILSFAMTLLQQAGIMTGGTAGLSLLIHYITDLKFGILFFLINIPF  79

Query  76   YYLAFKRLGTPMVIKTFLAVGLLSILTEVHPLFIHLDALSPLYATILANVFMGLGFLILF  135
            YY A+K++G  +V+KTF+AVGLL+  TE+ P F HL +++P+YA I ANV MG+ FLILF
Sbjct  80   YYFAYKKMGMALVVKTFIAVGLLAGFTEIIPHFFHLSSVNPIYAAIFANVLMGVSFLILF  139

Query  136  RHRSSLGGFNLLVLFLQERYKIPAGKIQMGLDICILVASMAFISFPLLLISILGAVILNL  195
            RHRSSLGG NLLVL+LQER+KIPAGK+QMG+D+ IL+ S+ F+ + L+LISILGAVILN 
Sbjct  140  RHRSSLGGINLLVLYLQERFKIPAGKVQMGIDVTILLVSLFFVDWKLILISILGAVILNS  199

Query  196  ILTLNHRPDRYV  207
            I+ LNH+  RYV
Sbjct  200  IILLNHKSSRYV  211


> R4J7H7 MgtC [Bacillus sp. HH1500]
Length=261

 Score = 45.1 bits (105),  Expect = 2e-09
 Identities = 28/151 (19%), Positives = 65/151 (43%), Gaps = 1/151 (1%)

Query  37   MLMQKAGAMTGGTAGLSLLIHYMTGIKFGLVFFTINIPFYYLAFKRLGTPMVIKTFLAVG  96
            +++   G + GG   ++++ + + G+    VF  INIP      K +G    I+T  A  
Sbjct  23   LILAPNGLVDGGVTAIAIMANKVAGLPLYGVFLGINIPILLFTAKVMGKKFFIRTSYA-N  81

Query  97   LLSILTEVHPLFIHLDALSPLYATILANVFMGLGFLILFRHRSSLGGFNLLVLFLQERYK  156
            +++ L  ++         S L   +   V  G+G  I+ +   ++ G  +L +++ + + 
Sbjct  82   VVTTLGLIYLKPFPAITTSELLIVLYGGVLFGIGVGIVVKMGGAIDGSEMLAVWMNKHFN  141

Query  157  IPAGKIQMGLDICILVASMAFISFPLLLISI  187
            +P     + ++  I +      S    + S+
Sbjct  142  VPISTFLLAVNAVIFIFVAILFSIEQAMFSL  172



Lambda      K        H        a         alpha
   0.336    0.150    0.442    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 388341


  Database: a9aa23834bd08931739e2cd008c6ddff.TrEMBL.fasta
    Posted date:  Sep 26, 2020  8:02 PM
  Number of letters in database: 2,765
  Number of sequences in database:  13



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40