ACIAD1345 / SwissProt Alignments

BLASTP 2.2.28+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: bbbde48d1504f27ad6c4710d05c6d5ac.SwissProt.fasta
           4 sequences; 984 total letters



Query= ACIAD1345

Length=209
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  O06740 UPF0750 membrane protein YitE [Bacillus subtilis (strain...  55.8    8e-14
  O34792 UPF0750 membrane protein YvjA [Bacillus subtilis (strain...  45.8    4e-10
  P39803 UPF0750 membrane protein YitT [Bacillus subtilis (strain...  37.0    4e-07
  Q9X972 Glycerol-3-phosphate acyltransferase [Streptococcus gord...  35.4    1e-06


> O06740 UPF0750 membrane protein YitE [Bacillus subtilis (strain 
168)]
Length=209

 Score = 55.8 bits (133),  Expect = 8e-14
 Identities = 36/153 (24%), Positives = 76/153 (50%), Gaps = 2/153 (1%)

Query  46   TGGTAGLSLLIHYMTGIKFGLVFFTINIPFYYLAFKRLGTPMVIKTFLAVGLLSILTEVH  105
            TGG AG+++L+HY+  I  G   + +N+   + A K L       T  ++ + S+   + 
Sbjct  36   TGGAAGIAVLLHYLFQIPHGFSVWAVNVSMLFTALKWLEMRTFTGTLASITVTSVSVLIF  95

Query  106  PLFIHLDALSPLYATILAN-VFMGLGFLILFRHRSSLGGFNLLVLFLQERYKIPAGKIQM  164
               +  D  S L+  + +  V +GLG  +L++++ S GGF  L L +        G I +
Sbjct  96   DA-VFPDITSNLWLDLASGAVLLGLGIGLLYKYKISNGGFGALALMISIYRGGNPGTILL  154

Query  165  GLDICILVASMAFISFPLLLISILGAVILNLIL  197
             ++  I + + + I + +++ +++  VI   ++
Sbjct  155  IMNCIIFMVTASIIDWGIVIQALICQVISTRVI  187


 Score = 26.9 bits (58),  Expect = 6e-04
 Identities = 15/62 (24%), Positives = 30/62 (48%), Gaps = 1/62 (2%)

Query  118  YATILANVFMGLGF-LILFRHRSSLGGFNLLVLFLQERYKIPAGKIQMGLDICILVASMA  176
            +  ++  V  GLG  L LF H    GG   + + L   ++IP G     +++ +L  ++ 
Sbjct  12   FMIVVGGVLQGLGMSLFLFPHDIPTGGAAGIAVLLHYLFQIPHGFSVWAVNVSMLFTALK  71

Query  177  FI  178
            ++
Sbjct  72   WL  73


> O34792 UPF0750 membrane protein YvjA [Bacillus subtilis (strain 
168)]
Length=281

 Score = 45.8 bits (107),  Expect = 4e-10
 Identities = 44/180 (24%), Positives = 78/180 (43%), Gaps = 13/180 (7%)

Query  19   IEDMLAMVIATFI--ISFGMMLMQKAGAMTGGTAGLSLLIHYMTGIKFGLVFFTINIPFY  76
            + D + ++I   I  +SF + L+    A  GG +G+S ++    G +   V + INIP +
Sbjct  11   LRDYVYILIGAAITAVSFNVFLLPNKIA-AGGVSGISTILQSY-GFEAAYVQWIINIPLF  68

Query  77   YLAFKRLGTPMVIKTFLAVGLLSILT----EVHPLFIHLDALSPLYATILANVFMGLGFL  132
                  LG    +KT      L ++     ++ P   H      L A I   V +G+G  
Sbjct  69   IAGVILLGGKFGLKTLAGSVFLPLVVFLTRDIQPATHH-----ELLAAIFGGVGIGIGIG  123

Query  133  ILFRHRSSLGGFNLLVLFLQERYKIPAGKIQMGLDICILVASMAFISFPLLLISILGAVI  192
            I++  + S GG  L    + +   +  GK    +D  I+V +M   +    L ++LG  +
Sbjct  124  IVYLGKGSTGGTALAAQIIHKYSGLSLGKCLAIIDGMIVVTAMIVFNIEQGLYAMLGVYV  183


> P39803 UPF0750 membrane protein YitT [Bacillus subtilis (strain 
168)]
Length=280

 Score = 37.0 bits (84),  Expect = 4e-07
 Identities = 36/164 (22%), Positives = 75/164 (46%), Gaps = 14/164 (9%)

Query  22   MLAMVIATFIISFGMML-MQKAGAMTGGTAGLSLLIHYMTG------IKFGLVFFTINIP  74
            +L ++I   + + G+ L +  A     G  G++ L+  +        I  G + F +NIP
Sbjct  9    LLIVIIGALLNAAGLNLFLIPADVYASGFTGVAQLLSSVVDQYAPFYISTGTLLFLLNIP  68

Query  75   FYYLAFKRLGTPMVIKTFLAVGLLSILTEVHP--LFIHLDALSPLYATILANVFMGLGFL  132
               L + ++G    + + L+V L ++   + P     H   L+ ++  +++ V +GL   
Sbjct  69   VGILGWLKVGKSFTVYSILSVALTTLFMGILPETSLSHDILLNAVFGGVISAVGIGL---  125

Query  133  ILFRHRSSLGGFNLLVLFLQERYKIPAGKIQMGLD-ICILVASM  175
               ++ +S GG +++ + L +    P G     L+ I IL A +
Sbjct  126  -TLKYGASTGGLDIVAMVLAKWKDKPVGTYFFILNGIIILTAGL  168


 Score = 25.8 bits (55),  Expect = 0.002
 Identities = 19/66 (29%), Positives = 32/66 (48%), Gaps = 1/66 (2%)

Query  7    FLVTIPKKSHSSIEDMLAMVIATFIISFGMMLMQKAGAMTGGTAGLSLLIHYMTGIKFGL  66
            F+  +P+ S S  + +L  V    I + G+ L  K GA TGG   +++++        G 
Sbjct  95   FMGILPETSLSH-DILLNAVFGGVISAVGIGLTLKYGASTGGLDIVAMVLAKWKDKPVGT  153

Query  67   VFFTIN  72
             FF +N
Sbjct  154  YFFILN  159


 Score = 16.9 bits (32),  Expect = 1.2
 Identities = 10/19 (53%), Positives = 13/19 (68%), Gaps = 4/19 (21%)

Query  183  LLISILGAVI----LNLIL  197
            LLI I+GA++    LNL L
Sbjct  9    LLIVIIGALLNAAGLNLFL  27


 Score = 15.0 bits (27),  Expect = 5.1
 Identities = 6/20 (30%), Positives = 10/20 (50%), Gaps = 0/20 (0%)

Query  8    LVTIPKKSHSSIEDMLAMVI  27
            + T+P K   + E    M+I
Sbjct  223  ITTVPAKGAFTNEQKEMMII  242


> Q9X972 Glycerol-3-phosphate acyltransferase [Streptococcus gordonii 
(strain Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 
/ V288)]
Length=214

 Score = 35.4 bits (80),  Expect = 1e-06
 Identities = 51/189 (27%), Positives = 81/189 (43%), Gaps = 45/189 (24%)

Query  52   LSLLIHYM-----TGIKFGLVFFTINIPFYYLA-------FKRLGTPMVIKTFLAVGLLS  99
            L L++ Y+     TG+  G +FF  N+  Y          F+ LG      TF    L  
Sbjct  6    LGLILAYLLGSIPTGLWIGQIFFKKNLREYGSGNTGTTNTFRILGKTAGTVTFAIDFLKG  65

Query  100  ILTEVHPLFIHLDALSPLYATILANVFMGLGFLILFRHR------SSLG---GFN-----  145
             L  + PLF+H++ +SP+   ++A   +G  F I    +      +S G   GF+     
Sbjct  66   TLATLLPLFLHINGISPMIFGLIA--VLGHTFPIFAEFKGGKAVATSAGVVLGFSPLFFS  123

Query  146  -LLVLFLQERYKIPAGKIQMGLDICILVASMAFIS---FPLL--------LISILGAVIL  193
             L+++F+   Y      I +     I+VA  A IS   FPLL        L+  L  ++L
Sbjct  124  YLIIIFIVTLYL--GSMISLA---SIVVAGFAIISVLIFPLLGIILPSYDLLFTLIIILL  178

Query  194  NLILTLNHR  202
              I+ + HR
Sbjct  179  ASIILIRHR  187


 Score = 30.0 bits (66),  Expect = 6e-05
 Identities = 29/125 (23%), Positives = 53/125 (42%), Gaps = 12/125 (10%)

Query  17   SSIEDMLAMVIATFIISFGMMLMQKAGAMTGGTAGLSLLIHYMTGIKFGLVFFTINIPFY  76
            + I  M+  +IA    +F +    K G     +AG+ L         F  +FF+  I  +
Sbjct  78   NGISPMIFGLIAVLGHTFPIFAEFKGGKAVATSAGVVL--------GFSPLFFSYLIIIF  129

Query  77   YLAFKRLGTPMVIKTFLAVGLLSILTEVHPLFIHLDALSPLYATILANVFMGLGFLILFR  136
             +    LG+ + + + +  G   I   + PL   L  + P Y  +   + + L  +IL R
Sbjct  130  IVTLY-LGSMISLASIVVAGFAIISVLIFPL---LGIILPSYDLLFTLIIILLASIILIR  185

Query  137  HRSSL  141
            HR ++
Sbjct  186  HRDNM  190



Lambda      K        H        a         alpha
   0.336    0.150    0.442    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 151512


  Database: bbbde48d1504f27ad6c4710d05c6d5ac.SwissProt.fasta
    Posted date:  Sep 19, 2020  2:21 PM
  Number of letters in database: 984
  Number of sequences in database:  4



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40