ACIAD1256 / TrEMBL Alignments

BLASTP 2.2.28+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: 02b2aa6011f08b3fc95b73d00ef78bef.TrEMBL.fasta
           1 sequences; 44 total letters



Query= ACIAD1256

Length=45
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  Q6FCS9 Uncharacterized protein [Acinetobacter baylyi (strain AT...  95.9    3e-33


> Q6FCS9 Uncharacterized protein [Acinetobacter baylyi (strain 
ATCC 33305 / BD413 / ADP1)]
Length=44

 Score = 95.9 bits (237),  Expect = 3e-33
 Identities = 43/44 (98%), Positives = 44/44 (100%), Gaps = 0/44 (0%)

Query  1   VHGNNYRARLGEIGCAPDFFMRIEYRFDQILGLKHADFRDMVAP  44
           +HGNNYRARLGEIGCAPDFFMRIEYRFDQILGLKHADFRDMVAP
Sbjct  1   MHGNNYRARLGEIGCAPDFFMRIEYRFDQILGLKHADFRDMVAP  44



Lambda      K        H        a         alpha
   0.343    0.157    0.529    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1980


  Database: 02b2aa6011f08b3fc95b73d00ef78bef.TrEMBL.fasta
    Posted date:  Sep 26, 2020  7:32 PM
  Number of letters in database: 44
  Number of sequences in database:  1



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40