ACIAD1059 / TrEMBL Alignments

BLASTP 2.2.28+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: 7f81a9f5243111f45c8df3816c9a4a5b.TrEMBL.fasta
           19 sequences; 12,883 total letters



Query= ACIAD1059

Length=824
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  Q6FDB1 FtsX domain-containing protein [Acinetobacter baylyi (st...  1578    0.0  
  A0A0M1I719 ABC transporter permease [Acinetobacter sp. C15]         1328    0.0  
  N9BTA5 Uncharacterized protein [Acinetobacter soli NIPH 2899]       1327    0.0  
  A0A1P8EIK7 ABC transporter permease [Acinetobacter soli]            1320    0.0  
  N9S482 Uncharacterized protein [Acinetobacter ursingii NIPH 706]    1243    0.0  
  A0A009YBB3 FtsX-like permease family protein [Acinetobacter sp....  1243    0.0  
  N9C1B9 Uncharacterized protein [Acinetobacter ursingii ANC 3649]    1238    0.0  
  N8WBD8 FtsX domain-containing protein [Acinetobacter sp. NIPH 758]  1197    0.0  
  N9NI06 Uncharacterized protein [Acinetobacter sp. NIPH 2168]        1197    0.0  
  O24851 FtsX domain-containing protein [Acinetobacter baylyi (st...   529    0.0  
  B1AAN3 ABC transporter permease protein component [Pseudoaltero...   218    4e-64
  Q9S4Z3 Uncharacterized protein [Salmonella enteritidis]              203    6e-60
  B1AAN2 ABC transporter permease protein component [Pseudoaltero...  86.7    2e-21
  Q1A2C7 ABC transporter [Streptococcus mutans]                       53.5    5e-10
  V9PX24 ABC transporter permease [Actinoplanes sp. NAI112]           52.0    1e-09
  J7LF99 Putative ABC transporter ATPase component [Lactobacillus...  50.8    3e-09
  A8W865 ABC transporter permease [Pseudomonas fluorescens]           48.9    1e-08
  A0A1B3TQ24 FtsX-like permease family protein [Klebsiella pneumo...  46.6    4e-08
  O32735 AttF [Rhizobium radiobacter]                                 43.5    4e-07


> Q6FDB1 FtsX domain-containing protein [Acinetobacter baylyi (strain 
ATCC 33305 / BD413 / ADP1)]
Length=823

 Score = 1578 bits (4087),  Expect = 0.0
 Identities = 823/823 (100%), Positives = 823/823 (100%), Gaps = 0/823 (0%)

Query  1    MSSILKPLLLQSFRTGGLYLLIIALSLAISATTALKFSNDQVKQAVSLQAAEMLAADLVL  60
            MSSILKPLLLQSFRTGGLYLLIIALSLAISATTALKFSNDQVKQAVSLQAAEMLAADLVL
Sbjct  1    MSSILKPLLLQSFRTGGLYLLIIALSLAISATTALKFSNDQVKQAVSLQAAEMLAADLVL  60

Query  61   SDQEPIAQQWTAQAQQDGLQQSKVTLFSSMARTDQNFVMVNVKAIDHKFPLRGDLKIDPV  120
            SDQEPIAQQWTAQAQQDGLQQSKVTLFSSMARTDQNFVMVNVKAIDHKFPLRGDLKIDPV
Sbjct  61   SDQEPIAQQWTAQAQQDGLQQSKVTLFSSMARTDQNFVMVNVKAIDHKFPLRGDLKIDPV  120

Query  121  QQTLRRGEVWLSPRARDLLKVKLNDLVFIADGQFKFTGLIQHDSNQELGFSGFSPTVMIN  180
            QQTLRRGEVWLSPRARDLLKVKLNDLVFIADGQFKFTGLIQHDSNQELGFSGFSPTVMIN
Sbjct  121  QQTLRRGEVWLSPRARDLLKVKLNDLVFIADGQFKFTGLIQHDSNQELGFSGFSPTVMIN  180

Query  181  QQDVAKTNAIQTGSRIEYRLLMAGNPEQTKTFSQQFKHLQQPNSDNESSENQATLRLRDA  240
            QQDVAKTNAIQTGSRIEYRLLMAGNPEQTKTFSQQFKHLQQPNSDNESSENQATLRLRDA
Sbjct  181  QQDVAKTNAIQTGSRIEYRLLMAGNPEQTKTFSQQFKHLQQPNSDNESSENQATLRLRDA  240

Query  241  TQNNARLMKPIENLDTFLQLANILTILLCGIAIALTSQRYVQQNQDHIALIRCLGASKWQ  300
            TQNNARLMKPIENLDTFLQLANILTILLCGIAIALTSQRYVQQNQDHIALIRCLGASKWQ
Sbjct  241  TQNNARLMKPIENLDTFLQLANILTILLCGIAIALTSQRYVQQNQDHIALIRCLGASKWQ  300

Query  301  ILRAYIGLLSIVSLISIGTGTLIGIGLGYGLLQLMLQLMPQLNIGFSAMHLIAGPLPIAI  360
            ILRAYIGLLSIVSLISIGTGTLIGIGLGYGLLQLMLQLMPQLNIGFSAMHLIAGPLPIAI
Sbjct  301  ILRAYIGLLSIVSLISIGTGTLIGIGLGYGLLQLMLQLMPQLNIGFSAMHLIAGPLPIAI  360

Query  361  FTSVVVLFGFILPSVWELLNTPPIRVIRQEIRSKRSLSLTFLAGISSLIIFSLILSENIP  420
            FTSVVVLFGFILPSVWELLNTPPIRVIRQEIRSKRSLSLTFLAGISSLIIFSLILSENIP
Sbjct  361  FTSVVVLFGFILPSVWELLNTPPIRVIRQEIRSKRSLSLTFLAGISSLIIFSLILSENIP  420

Query  421  LSGMMLAAILLLSLLLYGIVWSLLKFLKTLRNRLSAYVRLPHQTALQITALALGISLITV  480
            LSGMMLAAILLLSLLLYGIVWSLLKFLKTLRNRLSAYVRLPHQTALQITALALGISLITV
Sbjct  421  LSGMMLAAILLLSLLLYGIVWSLLKFLKTLRNRLSAYVRLPHQTALQITALALGISLITV  480

Query  481  LSVLRVDLLERWQQQLPEGTPNQFVYGLPPFEMPQLKQQLKQNEWKSTPLYPNIRGRLIA  540
            LSVLRVDLLERWQQQLPEGTPNQFVYGLPPFEMPQLKQQLKQNEWKSTPLYPNIRGRLIA
Sbjct  481  LSVLRVDLLERWQQQLPEGTPNQFVYGLPPFEMPQLKQQLKQNEWKSTPLYPNIRGRLIA  540

Query  541  KNDQPFTADQIKQNNALRRELNLTQAQSFPEDNQIITGITRFNQVNQVSVESKLAQELGI  600
            KNDQPFTADQIKQNNALRRELNLTQAQSFPEDNQIITGITRFNQVNQVSVESKLAQELGI
Sbjct  541  KNDQPFTADQIKQNNALRRELNLTQAQSFPEDNQIITGITRFNQVNQVSVESKLAQELGI  600

Query  601  KIGDQLTFQLPEGPLSARVVNLRTVEWESFSPNFFFIFSPSTMDENAGSYLGSFYVPLQD  660
            KIGDQLTFQLPEGPLSARVVNLRTVEWESFSPNFFFIFSPSTMDENAGSYLGSFYVPLQD
Sbjct  601  KIGDQLTFQLPEGPLSARVVNLRTVEWESFSPNFFFIFSPSTMDENAGSYLGSFYVPLQD  660

Query  661  KTKLIAVIQQFSNTVFIDVSLILDEVKRLVGVLVQIITILAVLVGVSGVLVLIACLNLLM  720
            KTKLIAVIQQFSNTVFIDVSLILDEVKRLVGVLVQIITILAVLVGVSGVLVLIACLNLLM
Sbjct  661  KTKLIAVIQQFSNTVFIDVSLILDEVKRLVGVLVQIITILAVLVGVSGVLVLIACLNLLM  720

Query  721  DERRREVALLRSFGISKRKLKNMLMFEVGLIGLLSGVVACLFAEVISAIASYKMNIAIQW  780
            DERRREVALLRSFGISKRKLKNMLMFEVGLIGLLSGVVACLFAEVISAIASYKMNIAIQW
Sbjct  721  DERRREVALLRSFGISKRKLKNMLMFEVGLIGLLSGVVACLFAEVISAIASYKMNIAIQW  780

Query  781  HIEIWLILPVLMMLICAMIGRYRLSYLCDIPPLQSLRELNQSS  823
            HIEIWLILPVLMMLICAMIGRYRLSYLCDIPPLQSLRELNQSS
Sbjct  781  HIEIWLILPVLMMLICAMIGRYRLSYLCDIPPLQSLRELNQSS  823


> A0A0M1I719 ABC transporter permease [Acinetobacter sp. C15]
Length=825

 Score = 1328 bits (3438),  Expect = 0.0
 Identities = 672/825 (81%), Positives = 760/825 (92%), Gaps = 3/825 (0%)

Query  1    MSSILKPLLLQSFRTGGLYLLIIALSLAISATTALKFSNDQVKQAVSLQAAEMLAADLVL  60
            MSS+LKPLLLQS RTGGLYLLIIALSLAISATTALKFSN+QVKQAV+LQAA+MLAADLVL
Sbjct  1    MSSLLKPLLLQSLRTGGLYLLIIALSLAISATTALKFSNNQVKQAVNLQAAQMLAADLVL  60

Query  61   SDQEPIAQQWTAQAQQDGLQQSKVTLFSSMARTDQNFVMVNVKAIDHKFPLRGDLKIDPV  120
            SDQ+P++ QW+ +A QDGL+QS+VTLFSSMART+QNFVMVNVKAID  FPLRG+L+I P 
Sbjct  61   SDQDPLSNQWSQRATQDGLKQSRVTLFSSMARTEQNFVMVNVKAIDSAFPLRGELRIQPA  120

Query  121  QQTLRRGEVWLSPRARDLLKVKLNDLVFIADGQFKFTGLIQHDSNQELGFSGFSPTVMIN  180
            Q+T   GE+WLS RA +LLKVKLND V+IADGQF+  G+I HDSNQELGFSGFSPTV+IN
Sbjct  121  QKTPAIGEIWLSTRAMELLKVKLNDTVYIADGQFRVAGVIAHDSNQELGFSGFSPTVIIN  180

Query  181  QQDVAKTNAIQTGSRIEYRLLMAGNPEQTKTFSQQFKHLQQPNSDNES---SENQATLRL  237
            Q DVAKTNAIQ GSRIEYRLL+AG P+QTK F+ +FKHLQQ +S +     SE+  TLRL
Sbjct  181  QNDVAKTNAIQVGSRIEYRLLLAGRPDQTKRFADEFKHLQQTDSSSAQQADSESATTLRL  240

Query  238  RDATQNNARLMKPIENLDTFLQLANILTILLCGIAIALTSQRYVQQNQDHIALIRCLGAS  297
            RDATQ N RL+KPIENLDTFLQLANILTILLCGIAIALTSQRYVQQNQDHIALIRCLGAS
Sbjct  241  RDATQGNTRLVKPIENLDTFLQLANILTILLCGIAIALTSQRYVQQNQDHIALIRCLGAS  300

Query  298  KWQILRAYIGLLSIVSLISIGTGTLIGIGLGYGLLQLMLQLMPQLNIGFSAMHLIAGPLP  357
            K QIL AY+GLL+IVS ISI  G+ IG+GLG+GLLQLMLQLMPQL + FS   +  GPLP
Sbjct  301  KAQILWAYMGLLAIVSFISIVLGSAIGVGLGFGLLQLMLQLMPQLQLNFSVWDIWIGPLP  360

Query  358  IAIFTSVVVLFGFILPSVWELLNTPPIRVIRQEIRSKRSLSLTFLAGISSLIIFSLILSE  417
             AIFTSVVVLFGFILPSVWELLNTPPIRVIRQE+RSKRSL+L FLAGI SLI+FSL+LS+
Sbjct  361  TAIFTSVVVLFGFILPSVWELLNTPPIRVIRQEVRSKRSLALMFLAGIISLIVFSLVLSD  420

Query  418  NIPLSGMMLAAILLLSLLLYGIVWSLLKFLKTLRNRLSAYVRLPHQTALQITALALGISL  477
            N+ LS +MLAAILLLSLLLYG+VWS+LKF+K L+N LSAYVRLPHQ+A+QITALALGISL
Sbjct  421  NLQLSALMLAAILLLSLLLYGVVWSVLKFIKGLKNGLSAYVRLPHQSAIQITALALGISL  480

Query  478  ITVLSVLRVDLLERWQQQLPEGTPNQFVYGLPPFEMPQLKQQLKQNEWKSTPLYPNIRGR  537
            ITVLSVLRVDLLERWQ+QLPEGTPNQFVYGLPPF+MPQL+QQL QN WKSTPLYPNIRGR
Sbjct  481  ITVLSVLRVDLLERWQEQLPEGTPNQFVYGLPPFDMPQLQQQLTQNSWKSTPLYPNIRGR  540

Query  538  LIAKNDQPFTADQIKQNNALRRELNLTQAQSFPEDNQIITGITRFNQVNQVSVESKLAQE  597
            L+AKND+ FT +Q+KQNNALRRELNLTQ+++FP+DN+I++G+TRFNQVNQVSVE+KLA+E
Sbjct  541  LVAKNDRAFTPEQVKQNNALRRELNLTQSRTFPDDNKIVSGVTRFNQVNQVSVEAKLAEE  600

Query  598  LGIKIGDQLTFQLPEGPLSARVVNLRTVEWESFSPNFFFIFSPSTMDENAGSYLGSFYVP  657
            LGIKIGD+LTFQLPEGPLSARV+NLRTVEWESFSPNFFFIFSPST+DEN+GSYLGSFYVP
Sbjct  601  LGIKIGDKLTFQLPEGPLSARVINLRTVEWESFSPNFFFIFSPSTIDENSGSYLGSFYVP  660

Query  658  LQDKTKLIAVIQQFSNTVFIDVSLILDEVKRLVGVLVQIITILAVLVGVSGVLVLIACLN  717
             QDK KL+ +IQQFSNTVFIDVSLIL+EVKRLVGVLVQIIT+LAVLVG+SG+LVLIACLN
Sbjct  661  PQDKAKLVGLIQQFSNTVFIDVSLILEEVKRLVGVLVQIITVLAVLVGISGLLVLIACLN  720

Query  718  LLMDERRREVALLRSFGISKRKLKNMLMFEVGLIGLLSGVVACLFAEVISAIASYKMNIA  777
            LLMDERR+EVA+LRSFGI+K KLK +LM EVGL+GLLSG+VACLFAEVISA+ASYKMNIA
Sbjct  721  LLMDERRQEVAVLRSFGIAKTKLKQLLMLEVGLMGLLSGIVACLFAEVISAVASYKMNIA  780

Query  778  IQWHIEIWLILPVLMMLICAMIGRYRLSYLCDIPPLQSLRELNQS  822
            +QWH EIWLILP+ MM++CA+IGRYRLSYLCDIPPLQSLRELNQS
Sbjct  781  VQWHPEIWLILPLTMMVVCALIGRYRLSYLCDIPPLQSLRELNQS  825


> N9BTA5 Uncharacterized protein [Acinetobacter soli NIPH 2899]
Length=825

 Score = 1327 bits (3435),  Expect = 0.0
 Identities = 671/825 (81%), Positives = 760/825 (92%), Gaps = 3/825 (0%)

Query  1    MSSILKPLLLQSFRTGGLYLLIIALSLAISATTALKFSNDQVKQAVSLQAAEMLAADLVL  60
            MSS+LKPLLLQS RTGGLYLLIIALSLAISATTALKFSN+QVKQAV+LQAA+MLAADLVL
Sbjct  1    MSSLLKPLLLQSLRTGGLYLLIIALSLAISATTALKFSNNQVKQAVNLQAAQMLAADLVL  60

Query  61   SDQEPIAQQWTAQAQQDGLQQSKVTLFSSMARTDQNFVMVNVKAIDHKFPLRGDLKIDPV  120
            SDQ+P++ QW+ +A QDGL+QS+VTLFSSMART+QNFVMVNVKAID  FPLRG+L+I P 
Sbjct  61   SDQDPLSNQWSQRATQDGLKQSRVTLFSSMARTEQNFVMVNVKAIDSAFPLRGELRIQPA  120

Query  121  QQTLRRGEVWLSPRARDLLKVKLNDLVFIADGQFKFTGLIQHDSNQELGFSGFSPTVMIN  180
            Q+T   GE+WLS RA +LLKVKLND V+IADGQF+  G+I HDSNQELGFSGFSPTV+IN
Sbjct  121  QKTPAIGEIWLSTRAMELLKVKLNDTVYIADGQFRVAGVIAHDSNQELGFSGFSPTVIIN  180

Query  181  QQDVAKTNAIQTGSRIEYRLLMAGNPEQTKTFSQQFKHLQQPNSDNES---SENQATLRL  237
            Q DVAKTNAIQ GSRIEYRLL+AG P+QTK F+ +FKHLQQ +S +     SE+  TLRL
Sbjct  181  QNDVAKTNAIQVGSRIEYRLLLAGRPDQTKRFADEFKHLQQTDSSSTQQADSESATTLRL  240

Query  238  RDATQNNARLMKPIENLDTFLQLANILTILLCGIAIALTSQRYVQQNQDHIALIRCLGAS  297
            RDATQ N RL+KPIENLDTFLQLANILTILLCGIAIALTSQRYVQQNQDHIALIRCLGAS
Sbjct  241  RDATQGNTRLVKPIENLDTFLQLANILTILLCGIAIALTSQRYVQQNQDHIALIRCLGAS  300

Query  298  KWQILRAYIGLLSIVSLISIGTGTLIGIGLGYGLLQLMLQLMPQLNIGFSAMHLIAGPLP  357
            K Q+L AY+GLL+IVS ISI  G+ IG+GLG+GLLQLMLQLMPQL + FS   +  GPLP
Sbjct  301  KAQVLWAYMGLLAIVSFISIVLGSAIGVGLGFGLLQLMLQLMPQLQLNFSVWDIWIGPLP  360

Query  358  IAIFTSVVVLFGFILPSVWELLNTPPIRVIRQEIRSKRSLSLTFLAGISSLIIFSLILSE  417
             AIFTSVVVLFGFILPSVWELLNTPPIRVIRQE+RSKRSL+L FLAGI SLI+FSL+LS+
Sbjct  361  TAIFTSVVVLFGFILPSVWELLNTPPIRVIRQEVRSKRSLALMFLAGIISLIVFSLVLSD  420

Query  418  NIPLSGMMLAAILLLSLLLYGIVWSLLKFLKTLRNRLSAYVRLPHQTALQITALALGISL  477
            N+ LS +MLAAILLLSLLLYG+VWS+LKF+K L+N LSAYVRLPHQ+A+QITALALGISL
Sbjct  421  NLQLSALMLAAILLLSLLLYGVVWSVLKFIKGLKNGLSAYVRLPHQSAIQITALALGISL  480

Query  478  ITVLSVLRVDLLERWQQQLPEGTPNQFVYGLPPFEMPQLKQQLKQNEWKSTPLYPNIRGR  537
            ITVLSVLRVDLLERWQ+QLPEGTPNQFVYGLPPF+MPQL+QQL QN WKSTPLYPNIRGR
Sbjct  481  ITVLSVLRVDLLERWQEQLPEGTPNQFVYGLPPFDMPQLQQQLTQNGWKSTPLYPNIRGR  540

Query  538  LIAKNDQPFTADQIKQNNALRRELNLTQAQSFPEDNQIITGITRFNQVNQVSVESKLAQE  597
            L+AKND+ FT +Q+KQNNALRRELNLTQ+++FP+DN+I++G+TRFNQVNQVSVE+KLA+E
Sbjct  541  LVAKNDRAFTPEQVKQNNALRRELNLTQSRTFPDDNKIVSGVTRFNQVNQVSVEAKLAEE  600

Query  598  LGIKIGDQLTFQLPEGPLSARVVNLRTVEWESFSPNFFFIFSPSTMDENAGSYLGSFYVP  657
            LGIKIGD+LTFQLPEGPLSARV+NLRTVEWESFSPNFFFIFSPST+DEN+GSYLGSFYVP
Sbjct  601  LGIKIGDKLTFQLPEGPLSARVINLRTVEWESFSPNFFFIFSPSTIDENSGSYLGSFYVP  660

Query  658  LQDKTKLIAVIQQFSNTVFIDVSLILDEVKRLVGVLVQIITILAVLVGVSGVLVLIACLN  717
             QDK KL+ +IQQFSNTVFIDVSLIL+EVKRLVGVLVQIIT+LAVLVG+SG+LVLIACLN
Sbjct  661  PQDKAKLVGLIQQFSNTVFIDVSLILEEVKRLVGVLVQIITVLAVLVGISGLLVLIACLN  720

Query  718  LLMDERRREVALLRSFGISKRKLKNMLMFEVGLIGLLSGVVACLFAEVISAIASYKMNIA  777
            LLMDERR+EVA+LRSFGI+K KLK +LM EVGL+GLLSG+VACLFAEVISA+ASYKMNIA
Sbjct  721  LLMDERRQEVAVLRSFGIAKTKLKQLLMLEVGLMGLLSGIVACLFAEVISAVASYKMNIA  780

Query  778  IQWHIEIWLILPVLMMLICAMIGRYRLSYLCDIPPLQSLRELNQS  822
            +QWH EIWLILP+ MM++CA+IGRYRLSYLCDIPPLQSLRELNQS
Sbjct  781  VQWHPEIWLILPLTMMVVCALIGRYRLSYLCDIPPLQSLRELNQS  825


> A0A1P8EIK7 ABC transporter permease [Acinetobacter soli]
Length=825

 Score = 1320 bits (3415),  Expect = 0.0
 Identities = 668/825 (81%), Positives = 759/825 (92%), Gaps = 3/825 (0%)

Query  1    MSSILKPLLLQSFRTGGLYLLIIALSLAISATTALKFSNDQVKQAVSLQAAEMLAADLVL  60
            MSS+LKPLLLQS RTGGLYLLIIALSLAISATTALKFSN+QVKQAV+LQAA+MLAADLVL
Sbjct  1    MSSLLKPLLLQSLRTGGLYLLIIALSLAISATTALKFSNNQVKQAVNLQAAQMLAADLVL  60

Query  61   SDQEPIAQQWTAQAQQDGLQQSKVTLFSSMARTDQNFVMVNVKAIDHKFPLRGDLKIDPV  120
            SDQ+P++ QW+ +A QDGL+QS+VTLFSSMART+QNFVMVNVKAID  FPLRG+L+I P 
Sbjct  61   SDQDPLSNQWSQRATQDGLKQSRVTLFSSMARTEQNFVMVNVKAIDSAFPLRGELRIQPA  120

Query  121  QQTLRRGEVWLSPRARDLLKVKLNDLVFIADGQFKFTGLIQHDSNQELGFSGFSPTVMIN  180
            Q+T   GE+WLS RA +LLKVKLND V+IADGQF+  G+I HDSNQELGFSGFSPTV+IN
Sbjct  121  QKTPAIGEIWLSTRAMELLKVKLNDTVYIADGQFRVAGVIAHDSNQELGFSGFSPTVIIN  180

Query  181  QQDVAKTNAIQTGSRIEYRLLMAGNPEQTKTFSQQFKHLQQPNSDNES---SENQATLRL  237
            Q DVAKTNAIQ GSRIEYRLL+AG P+QTK F+ +FK+LQQ +S +     SE+  TLRL
Sbjct  181  QNDVAKTNAIQVGSRIEYRLLLAGRPDQTKRFADEFKYLQQTDSSSAQQADSESATTLRL  240

Query  238  RDATQNNARLMKPIENLDTFLQLANILTILLCGIAIALTSQRYVQQNQDHIALIRCLGAS  297
            RDATQ N RL+KPIENLDTFLQLANILTILLCGIAIALTSQRYVQQNQDHIALIRCLGAS
Sbjct  241  RDATQGNTRLVKPIENLDTFLQLANILTILLCGIAIALTSQRYVQQNQDHIALIRCLGAS  300

Query  298  KWQILRAYIGLLSIVSLISIGTGTLIGIGLGYGLLQLMLQLMPQLNIGFSAMHLIAGPLP  357
            K Q+L AY+GLL+IVS ISI  G+ IG+GLG+GLLQLMLQLMPQL + FS   +  GPLP
Sbjct  301  KAQVLWAYMGLLAIVSFISILLGSAIGVGLGFGLLQLMLQLMPQLQLNFSVWDIWIGPLP  360

Query  358  IAIFTSVVVLFGFILPSVWELLNTPPIRVIRQEIRSKRSLSLTFLAGISSLIIFSLILSE  417
             AIFTSVVVLFGFILPSVWELLNTPPIRVIRQE+RSKRSL+L FLAGI SLI+FSL+LS+
Sbjct  361  TAIFTSVVVLFGFILPSVWELLNTPPIRVIRQEVRSKRSLALMFLAGIISLIVFSLVLSD  420

Query  418  NIPLSGMMLAAILLLSLLLYGIVWSLLKFLKTLRNRLSAYVRLPHQTALQITALALGISL  477
            N+ LS +MLAAILLLSLLLYG+VWS+LKF+K L+N LSAYVRLPHQ+A+QITALALGISL
Sbjct  421  NLQLSALMLAAILLLSLLLYGVVWSVLKFIKGLKNGLSAYVRLPHQSAIQITALALGISL  480

Query  478  ITVLSVLRVDLLERWQQQLPEGTPNQFVYGLPPFEMPQLKQQLKQNEWKSTPLYPNIRGR  537
            ITVLSVLRVDLLERWQ+QLPEGTPNQFVYGLPPF+MPQL+QQL QN WKSTPLYPNIRGR
Sbjct  481  ITVLSVLRVDLLERWQEQLPEGTPNQFVYGLPPFDMPQLQQQLTQNGWKSTPLYPNIRGR  540

Query  538  LIAKNDQPFTADQIKQNNALRRELNLTQAQSFPEDNQIITGITRFNQVNQVSVESKLAQE  597
            L+AKND+ FT +Q+KQNNALRRELNLTQ+++FP+DN+I++G+TRFNQVNQVSVE+KLA+E
Sbjct  541  LVAKNDRAFTPEQVKQNNALRRELNLTQSRTFPDDNKIVSGVTRFNQVNQVSVEAKLAKE  600

Query  598  LGIKIGDQLTFQLPEGPLSARVVNLRTVEWESFSPNFFFIFSPSTMDENAGSYLGSFYVP  657
            L I+IGD+LTFQLPEGPLSARV+NLRTVEWESFSPNFFFIFSPST+DEN+GSYLGSFYVP
Sbjct  601  LRIEIGDKLTFQLPEGPLSARVINLRTVEWESFSPNFFFIFSPSTIDENSGSYLGSFYVP  660

Query  658  LQDKTKLIAVIQQFSNTVFIDVSLILDEVKRLVGVLVQIITILAVLVGVSGVLVLIACLN  717
             QDK KL+ +IQQFSNTVFIDVSLIL+EVKRLVGVLVQIIT+LAVLVG+SG+LVLIACLN
Sbjct  661  PQDKAKLVGLIQQFSNTVFIDVSLILEEVKRLVGVLVQIITVLAVLVGISGLLVLIACLN  720

Query  718  LLMDERRREVALLRSFGISKRKLKNMLMFEVGLIGLLSGVVACLFAEVISAIASYKMNIA  777
            LLMDERR+EVA+LRSFGI+K KLK +LM EVGL+GLLSG+VACLFAEVISA+ASYKMNIA
Sbjct  721  LLMDERRQEVAVLRSFGIAKTKLKQLLMLEVGLMGLLSGIVACLFAEVISAVASYKMNIA  780

Query  778  IQWHIEIWLILPVLMMLICAMIGRYRLSYLCDIPPLQSLRELNQS  822
            +QWH EIWLILP+ MM++CA+IGRYRLSYLCDIPPLQSLRELNQS
Sbjct  781  VQWHPEIWLILPLTMMVVCALIGRYRLSYLCDIPPLQSLRELNQS  825


> N9S482 Uncharacterized protein [Acinetobacter ursingii NIPH 706]
Length=821

 Score = 1243 bits (3215),  Expect = 0.0
 Identities = 624/822 (76%), Positives = 720/822 (88%), Gaps = 1/822 (0%)

Query  1    MSSILKPLLLQSFRTGGLYLLIIALSLAISATTALKFSNDQVKQAVSLQAAEMLAADLVL  60
            MS++LKPL +QSFRTGG+YLLIIALSLAISATTALKFSNDQ++ AV+LQAAEMLAADLVL
Sbjct  1    MSALLKPLFIQSFRTGGIYLLIIALSLAISATTALKFSNDQIQNAVTLQAAEMLAADLVL  60

Query  61   SDQEPIAQQWTAQAQQDGLQQSKVTLFSSMARTDQNFVMVNVKAIDHKFPLRGDLKIDPV  120
            SD EPIA  W  QA  +  QQS VT+FSSMART+  FVMVNVKAID  FPLRG L+I+P 
Sbjct  61   SDNEPIADTWKQQATTENFQQSNVTVFSSMARTNDQFVMVNVKAIDTHFPLRGKLQIEPP  120

Query  121  QQTLRRGEVWLSPRARDLLKVKLNDLVFIADGQFKFTGLIQHDSNQELGFSGFSPTVMIN  180
               +  GE+WLSPRA DLLKVKL + +FIADG FK TG+I+HDSNQELGFSGFSPTVMIN
Sbjct  121  ATQINSGEIWLSPRAMDLLKVKLGEQIFIADGAFKVTGVIKHDSNQELGFSGFSPTVMIN  180

Query  181  QQDVAKTNAIQTGSRIEYRLLMAGNPEQTKTFSQQFKHLQQPNSDNESSENQATLRLRDA  240
            Q D+AKTNAIQ GSRIEYRLLMAG PE  + F ++FK       D E+ + +++LRLR+A
Sbjct  181  QSDIAKTNAIQVGSRIEYRLLMAGTPEHIQNFEKKFKAQHHVQDDTEA-DPESSLRLRNA  239

Query  241  TQNNARLMKPIENLDTFLQLANILTILLCGIAIALTSQRYVQQNQDHIALIRCLGASKWQ  300
             Q N RLMKPIENLDTFLQLANILTILLCGIAIALTSQRYVQQNQDHIAL+RCLGA++ Q
Sbjct  240  AQGNTRLMKPIENLDTFLQLANILTILLCGIAIALTSQRYVQQNQDHIALMRCLGATRVQ  299

Query  301  ILRAYIGLLSIVSLISIGTGTLIGIGLGYGLLQLMLQLMPQLNIGFSAMHLIAGPLPIAI  360
            I+ AY+GLL++VSLISI  G+L+G+GLGYGLLQLMLQL+PQL + FS +  + GPLPIAI
Sbjct  300  IVWAYLGLLAVVSLISILIGSLLGVGLGYGLLQLMLQLIPQLELSFSVIAFLFGPLPIAI  359

Query  361  FTSVVVLFGFILPSVWELLNTPPIRVIRQEIRSKRSLSLTFLAGISSLIIFSLILSENIP  420
            FTS+VV+ GFILPS+WELLNTPPIRVIRQE RSKRS +  FLAG+ SL +FS+ LSENI 
Sbjct  360  FTSIVVMAGFILPSIWELLNTPPIRVIRQETRSKRSFAFMFLAGVLSLAVFSMALSENIQ  419

Query  421  LSGMMLAAILLLSLLLYGIVWSLLKFLKTLRNRLSAYVRLPHQTALQITALALGISLITV  480
            LSG+MLAAILLLS +LYG+VWSLLKF K L+N+ S Y+R P  TALQITALALG+SLITV
Sbjct  420  LSGLMLAAILLLSAILYGVVWSLLKFFKRLKNQFSGYIRTPAHTALQITALALGLSLITV  479

Query  481  LSVLRVDLLERWQQQLPEGTPNQFVYGLPPFEMPQLKQQLKQNEWKSTPLYPNIRGRLIA  540
            L+VLR DLL+RWQQQLPEGTPNQFVYGLPPF+MP+ KQQL++N W STPLYPNIRGRL+A
Sbjct  480  LTVLRTDLLQRWQQQLPEGTPNQFVYGLPPFDMPEFKQQLEKNGWHSTPLYPNIRGRLVA  539

Query  541  KNDQPFTADQIKQNNALRRELNLTQAQSFPEDNQIITGITRFNQVNQVSVESKLAQELGI  600
            KNDQPF AD I+ NN+LRRELNLTQA++ P+DN I  G   FNQVNQVSVE+KLA+ELGI
Sbjct  540  KNDQPFAADLIQHNNSLRRELNLTQAETLPKDNVITQGQPLFNQVNQVSVEAKLAEELGI  599

Query  601  KIGDQLTFQLPEGPLSARVVNLRTVEWESFSPNFFFIFSPSTMDENAGSYLGSFYVPLQD  660
            ++GD+LTF LPEG LSARV+NLR+VEWESFSPNFFFIFSP +MDENAGSYLGSFYVP QD
Sbjct  600  QVGDKLTFNLPEGTLSARVINLRSVEWESFSPNFFFIFSPHSMDENAGSYLGSFYVPPQD  659

Query  661  KTKLIAVIQQFSNTVFIDVSLILDEVKRLVGVLVQIITILAVLVGVSGVLVLIACLNLLM  720
            KT+LI VIQ+FSNTVFIDVSLILDE+KRLV VLVQ+IT+LA+LVG+SG+LVL+ACLNLLM
Sbjct  660  KTQLIQVIQRFSNTVFIDVSLILDEIKRLVSVLVQVITVLAILVGLSGILVLVACLNLLM  719

Query  721  DERRREVALLRSFGISKRKLKNMLMFEVGLIGLLSGVVACLFAEVISAIASYKMNIAIQW  780
            DERRREVAL+RSFG+SK KLK+ML  E+G IGL++GVV+C FAE+ISAIASYKMNIA+QW
Sbjct  720  DERRREVALMRSFGLSKSKLKHMLSLEIGFIGLIAGVVSCFFAEIISAIASYKMNIALQW  779

Query  781  HIEIWLILPVLMMLICAMIGRYRLSYLCDIPPLQSLRELNQS  822
            H EIWLILPV MMLICA+IGRYRLSYLCDIPPLQSLRE+NQS
Sbjct  780  HPEIWLILPVAMMLICALIGRYRLSYLCDIPPLQSLREINQS  821


> A0A009YBB3 FtsX-like permease family protein [Acinetobacter sp. 
479375]
Length=821

 Score = 1243 bits (3215),  Expect = 0.0
 Identities = 624/822 (76%), Positives = 720/822 (88%), Gaps = 1/822 (0%)

Query  1    MSSILKPLLLQSFRTGGLYLLIIALSLAISATTALKFSNDQVKQAVSLQAAEMLAADLVL  60
            MS++LKPL +QSFRTGG+YLLIIALSLAISATTALKFSNDQ++ AV+LQAAEMLAADLVL
Sbjct  1    MSALLKPLFIQSFRTGGIYLLIIALSLAISATTALKFSNDQIQNAVTLQAAEMLAADLVL  60

Query  61   SDQEPIAQQWTAQAQQDGLQQSKVTLFSSMARTDQNFVMVNVKAIDHKFPLRGDLKIDPV  120
            SD EPIA  W  QA  +  QQS VT+FSSMART+  FVMVNVKAID  FPLRG L+I+P 
Sbjct  61   SDNEPIADTWKQQATTENFQQSNVTVFSSMARTNDQFVMVNVKAIDTHFPLRGKLQIEPP  120

Query  121  QQTLRRGEVWLSPRARDLLKVKLNDLVFIADGQFKFTGLIQHDSNQELGFSGFSPTVMIN  180
               +  GE+WLSPRA DLLKVKL + +FIADG FK TG+I+HDSNQELGFSGFSPTVMIN
Sbjct  121  ATQINSGEIWLSPRAMDLLKVKLGEQIFIADGAFKVTGVIKHDSNQELGFSGFSPTVMIN  180

Query  181  QQDVAKTNAIQTGSRIEYRLLMAGNPEQTKTFSQQFKHLQQPNSDNESSENQATLRLRDA  240
            Q D+AKTNAIQ GSRIEYRLLMAG PE  + F ++FK       D E+ + +++LRLR+A
Sbjct  181  QSDIAKTNAIQVGSRIEYRLLMAGTPEHIQNFEKKFKAQHHVQDDTEA-DPESSLRLRNA  239

Query  241  TQNNARLMKPIENLDTFLQLANILTILLCGIAIALTSQRYVQQNQDHIALIRCLGASKWQ  300
             Q N RLMKPIENLDTFLQLANILTILLCGIAIALTSQRYVQQNQDHIAL+RCLGA++ Q
Sbjct  240  AQGNTRLMKPIENLDTFLQLANILTILLCGIAIALTSQRYVQQNQDHIALMRCLGATRVQ  299

Query  301  ILRAYIGLLSIVSLISIGTGTLIGIGLGYGLLQLMLQLMPQLNIGFSAMHLIAGPLPIAI  360
            I+ AY+GLL++VSLISI  G+L+G+GLGYGLLQLMLQL+PQL + FS +  + GPLPIAI
Sbjct  300  IVWAYLGLLAVVSLISILIGSLLGVGLGYGLLQLMLQLIPQLELSFSVIAFLFGPLPIAI  359

Query  361  FTSVVVLFGFILPSVWELLNTPPIRVIRQEIRSKRSLSLTFLAGISSLIIFSLILSENIP  420
            FTS+VV+ GFILPS+WELLNTPPIRVIRQE RSKRS +  FLAG+ SL +FS+ LSENI 
Sbjct  360  FTSIVVMAGFILPSIWELLNTPPIRVIRQETRSKRSFAFMFLAGVLSLAVFSMALSENIQ  419

Query  421  LSGMMLAAILLLSLLLYGIVWSLLKFLKTLRNRLSAYVRLPHQTALQITALALGISLITV  480
            LSG+MLAAILLLS +LYG+VWSLLKF K L+N+ S Y+R P  TALQITALALG+SLITV
Sbjct  420  LSGLMLAAILLLSAILYGVVWSLLKFFKRLKNQFSGYIRTPAHTALQITALALGLSLITV  479

Query  481  LSVLRVDLLERWQQQLPEGTPNQFVYGLPPFEMPQLKQQLKQNEWKSTPLYPNIRGRLIA  540
            L+VLR DLL+RWQQQLPEGTPNQFVYGLPPF+MP+ KQQL++N W STPLYPNIRGRL+A
Sbjct  480  LTVLRTDLLQRWQQQLPEGTPNQFVYGLPPFDMPEFKQQLEKNGWHSTPLYPNIRGRLVA  539

Query  541  KNDQPFTADQIKQNNALRRELNLTQAQSFPEDNQIITGITRFNQVNQVSVESKLAQELGI  600
            KNDQPF AD I+ NN+LRRELNLTQA++ P+DN I  G   FNQVNQVSVE+KLA+ELGI
Sbjct  540  KNDQPFAADLIQHNNSLRRELNLTQAETLPKDNVITQGQPLFNQVNQVSVEAKLAEELGI  599

Query  601  KIGDQLTFQLPEGPLSARVVNLRTVEWESFSPNFFFIFSPSTMDENAGSYLGSFYVPLQD  660
            ++GD+LTF LPEG LSARV+NLR+VEWESFSPNFFFIFSP +MDENAGSYLGSFYVP QD
Sbjct  600  QVGDKLTFNLPEGTLSARVINLRSVEWESFSPNFFFIFSPHSMDENAGSYLGSFYVPPQD  659

Query  661  KTKLIAVIQQFSNTVFIDVSLILDEVKRLVGVLVQIITILAVLVGVSGVLVLIACLNLLM  720
            KT+LI VIQ+FSNTVFIDVSLILDE+KRLV VLVQ+IT+LA+LVG+SG+LVL+ACLNLLM
Sbjct  660  KTQLIQVIQRFSNTVFIDVSLILDEIKRLVSVLVQVITVLAILVGLSGILVLVACLNLLM  719

Query  721  DERRREVALLRSFGISKRKLKNMLMFEVGLIGLLSGVVACLFAEVISAIASYKMNIAIQW  780
            DERRREVAL+RSFG+SK KLK+ML  E+G IGL++GVV+C FAE+ISAIASYKMNIA+QW
Sbjct  720  DERRREVALMRSFGLSKSKLKHMLSLEIGFIGLIAGVVSCFFAEIISAIASYKMNIALQW  779

Query  781  HIEIWLILPVLMMLICAMIGRYRLSYLCDIPPLQSLRELNQS  822
            H EIWLILPV MMLICA+IGRYRLSYLCDIPPLQSLRE+NQS
Sbjct  780  HPEIWLILPVAMMLICALIGRYRLSYLCDIPPLQSLREINQS  821


> N9C1B9 Uncharacterized protein [Acinetobacter ursingii ANC 3649]
Length=821

 Score = 1238 bits (3204),  Expect = 0.0
 Identities = 621/822 (76%), Positives = 720/822 (88%), Gaps = 1/822 (0%)

Query  1    MSSILKPLLLQSFRTGGLYLLIIALSLAISATTALKFSNDQVKQAVSLQAAEMLAADLVL  60
            MS++LKPL +QSFR+GG+YLLIIALSLAISATTALKFSNDQ++ AV+LQAAEMLAADLVL
Sbjct  1    MSALLKPLFIQSFRSGGIYLLIIALSLAISATTALKFSNDQIQNAVTLQAAEMLAADLVL  60

Query  61   SDQEPIAQQWTAQAQQDGLQQSKVTLFSSMARTDQNFVMVNVKAIDHKFPLRGDLKIDPV  120
            SD EPIA  W  QA  +  QQS VT+FSSMART+  FVMVNVKAID  FPLRG L+I+P 
Sbjct  61   SDNEPIADTWKQQATTENFQQSNVTVFSSMARTNDQFVMVNVKAIDTHFPLRGKLQIEPE  120

Query  121  QQTLRRGEVWLSPRARDLLKVKLNDLVFIADGQFKFTGLIQHDSNQELGFSGFSPTVMIN  180
             + ++ GE+WLSPRA DLLKVKL + VFIADG FK  G+I+HDSNQELGFSGFSPTVMIN
Sbjct  121  AKQIKSGEIWLSPRAMDLLKVKLGEQVFIADGAFKVAGVIKHDSNQELGFSGFSPTVMIN  180

Query  181  QQDVAKTNAIQTGSRIEYRLLMAGNPEQTKTFSQQFKHLQQPNSDNESSENQATLRLRDA  240
            Q D+AKTNAIQ GSRIEYRLLM+G PE  + F ++FK       D E+ + +++LRLR+A
Sbjct  181  QSDIAKTNAIQVGSRIEYRLLMSGLPENIQNFEKKFKAQHHVQDDTEA-DPESSLRLRNA  239

Query  241  TQNNARLMKPIENLDTFLQLANILTILLCGIAIALTSQRYVQQNQDHIALIRCLGASKWQ  300
             Q N RLMKPIENLDTFLQL NILTILLCGIAIALTSQRYVQQNQDHIAL+RCLGA++ Q
Sbjct  240  AQGNTRLMKPIENLDTFLQLTNILTILLCGIAIALTSQRYVQQNQDHIALMRCLGATRVQ  299

Query  301  ILRAYIGLLSIVSLISIGTGTLIGIGLGYGLLQLMLQLMPQLNIGFSAMHLIAGPLPIAI  360
            I+ AY+GLL++VSLISI  G+L+G+GLGYGLLQLMLQL+PQL + FS +  + GPLPIAI
Sbjct  300  IVWAYLGLLAVVSLISILIGSLLGVGLGYGLLQLMLQLIPQLELSFSVIAFLFGPLPIAI  359

Query  361  FTSVVVLFGFILPSVWELLNTPPIRVIRQEIRSKRSLSLTFLAGISSLIIFSLILSENIP  420
            FTS+VV+ GFILPS+WELLNTPPIRVIRQE RSKRS +  FLAG+ SL +FS++LSENI 
Sbjct  360  FTSIVVMAGFILPSIWELLNTPPIRVIRQETRSKRSFAFMFLAGVLSLAVFSMVLSENIQ  419

Query  421  LSGMMLAAILLLSLLLYGIVWSLLKFLKTLRNRLSAYVRLPHQTALQITALALGISLITV  480
            LSG+MLAAILLLS +LYGIVWSLLKF K L+NR S Y+R P  T+LQITALALG+SLITV
Sbjct  420  LSGLMLAAILLLSAILYGIVWSLLKFFKQLKNRFSVYIRTPAHTSLQITALALGLSLITV  479

Query  481  LSVLRVDLLERWQQQLPEGTPNQFVYGLPPFEMPQLKQQLKQNEWKSTPLYPNIRGRLIA  540
            L+VLR DLL+RWQQQLPEGTPNQFVYGLPPF+MP+ KQQ++ N W STPLYPNIRGRL+A
Sbjct  480  LTVLRTDLLQRWQQQLPEGTPNQFVYGLPPFDMPEFKQQIEHNGWHSTPLYPNIRGRLVA  539

Query  541  KNDQPFTADQIKQNNALRRELNLTQAQSFPEDNQIITGITRFNQVNQVSVESKLAQELGI  600
            KNDQPF AD I+ NN+LRRELNLTQA++ P+DN I  G   FNQVNQVSVE+KLA+ELGI
Sbjct  540  KNDQPFAADLIQHNNSLRRELNLTQAEALPKDNVITQGQPLFNQVNQVSVEAKLAEELGI  599

Query  601  KIGDQLTFQLPEGPLSARVVNLRTVEWESFSPNFFFIFSPSTMDENAGSYLGSFYVPLQD  660
            ++GD+LTF LPEG LSARV+NLR+VEWESFSPNFFFIFSP +MDENAGSYLGSFYVP QD
Sbjct  600  QVGDKLTFNLPEGTLSARVINLRSVEWESFSPNFFFIFSPHSMDENAGSYLGSFYVPPQD  659

Query  661  KTKLIAVIQQFSNTVFIDVSLILDEVKRLVGVLVQIITILAVLVGVSGVLVLIACLNLLM  720
            KT+LI VIQ+FSNTVFIDVSLILDE+KRLV VLVQ+IT+LA+LVG+SG+LVL+ACLNLLM
Sbjct  660  KTQLIQVIQRFSNTVFIDVSLILDEIKRLVSVLVQVITVLAILVGLSGILVLVACLNLLM  719

Query  721  DERRREVALLRSFGISKRKLKNMLMFEVGLIGLLSGVVACLFAEVISAIASYKMNIAIQW  780
            DERRREVAL+RSFG+SK KLK+ML  E+G IGL++GVV+C FAE+ISAIASYKMNIA+QW
Sbjct  720  DERRREVALMRSFGLSKSKLKHMLSLEIGFIGLIAGVVSCFFAEIISAIASYKMNIALQW  779

Query  781  HIEIWLILPVLMMLICAMIGRYRLSYLCDIPPLQSLRELNQS  822
            H EIWLILPV MMLICA+IGRYRLSYLCDIPPLQSLRE+NQS
Sbjct  780  HPEIWLILPVAMMLICALIGRYRLSYLCDIPPLQSLREINQS  821


> N8WBD8 FtsX domain-containing protein [Acinetobacter sp. NIPH 
758]
Length=828

 Score = 1197 bits (3098),  Expect = 0.0
 Identities = 610/829 (74%), Positives = 709/829 (86%), Gaps = 8/829 (1%)

Query  1    MSSILKPLLLQSFRTGGLYLLIIALSLAISATTALKFSNDQVKQAVSLQAAEMLAADLVL  60
            MSS+LKPL+LQSFRTGGLYLLIIALSLAISATTALKFSN QV+ AV+LQAAEMLAADLVL
Sbjct  1    MSSVLKPLMLQSFRTGGLYLLIIALSLAISATTALKFSNTQVQNAVTLQAAEMLAADLVL  60

Query  61   SDQEPIAQQWTAQAQQDGLQQSKVTLFSSMARTDQNFVMVNVKAIDHKFPLRGDLKIDPV  120
             DQ+PI  +W  QAQ+  LQQ+ VT+FSSMA T   FVMVNVKA+D  FPLRG+L+I P 
Sbjct  61   YDQDPIQTEWLQQAQKLDLQQAAVTVFSSMAHTSDQFVMVNVKAVDAHFPLRGELEIQPK  120

Query  121  QQTLRRGEVWLSPRARDLLKVKLNDLVFIADGQFKFTGLIQHDSNQELGFSGFSPTVMIN  180
             Q ++ G+VWLSPRA DLL+ K+ D V IADGQFK TG+I+HDSNQELGFSGFSPTV+I+
Sbjct  121  SQGIQTGQVWLSPRAADLLQAKVGDQVAIADGQFKVTGIIEHDSNQELGFSGFSPTVIIH  180

Query  181  QQDVAKTNAIQTGSRIEYRLLMAGNPEQTKTFSQQFKH-------LQQPNSDNESSENQA  233
            Q D+AKTNA+Q GSRIEYRLLMAG PEQ K F + F+        L+QP+        Q 
Sbjct  181  QADIAKTNAVQVGSRIEYRLLMAGPPEQIKAFKKIFRQQTQHEQTLEQPSDQQLGEGEQG  240

Query  234  TLRLRDATQNNARLMKPIENLDTFLQLANILTILLCGIAIALTSQRYVQQNQDHIALIRC  293
            +L+LRDA+Q+N RLMKPIENLDTFLQLAN+LTILLCGIAIALTSQRYVQQNQDHIAL+RC
Sbjct  241  SLKLRDASQSNTRLMKPIENLDTFLQLANLLTILLCGIAIALTSQRYVQQNQDHIALMRC  300

Query  294  LGASKWQILRAYIGLLSIVSLISIGTGTLIGIGLGYGLLQLMLQLMPQLNIGFSAMHLIA  353
            LGASK QIL AY+ LL IVS +SI  G+LIGI LGYGLLQLMLQL+PQL + F+   L+ 
Sbjct  301  LGASKRQILLAYLALLGIVSTLSIVLGSLIGIALGYGLLQLMLQLIPQLQLSFALADLLF  360

Query  354  GPLPIAIFTSVVVLFGFILPSVWELLNTPPIRVIRQEIRSKRSLSLTFLAGISSLIIFSL  413
              LP+AIFTSV+VL GFILPS+WELLNTPPIRVIRQ+ RS++S    F  GI+SL+IFSL
Sbjct  361  A-LPVAIFTSVMVLIGFILPSIWELLNTPPIRVIRQQERSRKSYFAMFAVGIASLVIFSL  419

Query  414  ILSENIPLSGMMLAAILLLSLLLYGIVWSLLKFLKTLRNRLSAYVRLPHQTALQITALAL  473
            +LS+N+ LS  +LAAIL+L   L+ ++W LLK +K L++ +SAYVR+PHQTALQITALAL
Sbjct  420  VLSDNLQLSLWVLAAILILCATLFAVIWLLLKVIKQLKHPVSAYVRIPHQTALQITALAL  479

Query  474  GISLITVLSVLRVDLLERWQQQLPEGTPNQFVYGLPPFEMPQLKQQLKQNEWKSTPLYPN  533
            G+SLITVLSVLR DLLERWQQQLPEGTPNQFVYGLPPF+MPQLKQQL+QN+W++TPLYPN
Sbjct  480  GLSLITVLSVLRTDLLERWQQQLPEGTPNQFVYGLPPFDMPQLKQQLEQNKWQTTPLYPN  539

Query  534  IRGRLIAKNDQPFTADQIKQNNALRRELNLTQAQSFPEDNQIITGITRFNQVNQVSVESK  593
            IRGRL+AKN QPF A+ +KQNN+LRRELNLTQA  +P+DN I  G + F Q+ QVSVE+K
Sbjct  540  IRGRLVAKNGQPFAAELVKQNNSLRRELNLTQAAVYPKDNVITQGSSHFTQIGQVSVEAK  599

Query  594  LAQELGIKIGDQLTFQLPEGPLSARVVNLRTVEWESFSPNFFFIFSPSTMDENAGSYLGS  653
            LA ELGIKIGDQL+F LPEGPL+A V+NLR+VEWESFSPNFFFIFSP TMDENAGSYLGS
Sbjct  600  LATELGIKIGDQLSFSLPEGPLNATVINLRSVEWESFSPNFFFIFSPKTMDENAGSYLGS  659

Query  654  FYVPLQDKTKLIAVIQQFSNTVFIDVSLILDEVKRLVGVLVQIITILAVLVGVSGVLVLI  713
            FYVP  D+ K++ +IQQFSNTVFIDV  IL+EVKRLV VLVQI+T+LA+LVG+SGVLVLI
Sbjct  660  FYVPPADQPKMVQLIQQFSNTVFIDVGRILEEVKRLVNVLVQIVTVLAMLVGLSGVLVLI  719

Query  714  ACLNLLMDERRREVALLRSFGISKRKLKNMLMFEVGLIGLLSGVVACLFAEVISAIASYK  773
            ACLN+LMDERR+EVALLRSFG++K KLK ML  E+G IGLL+GVVACLFAEVISAIASYK
Sbjct  720  ACLNVLMDERRKEVALLRSFGVAKNKLKRMLSLEIGFIGLLAGVVACLFAEVISAIASYK  779

Query  774  MNIAIQWHIEIWLILPVLMMLICAMIGRYRLSYLCDIPPLQSLRELNQS  822
            M +AIQWH EIWLILP+ MMLIC +IGRYRLSYLCDIPPLQSLRE+NQS
Sbjct  780  MQMAIQWHAEIWLILPLSMMLICTLIGRYRLSYLCDIPPLQSLREMNQS  828


> N9NI06 Uncharacterized protein [Acinetobacter sp. NIPH 2168]
Length=828

 Score = 1197 bits (3098),  Expect = 0.0
 Identities = 613/829 (74%), Positives = 709/829 (86%), Gaps = 8/829 (1%)

Query  1    MSSILKPLLLQSFRTGGLYLLIIALSLAISATTALKFSNDQVKQAVSLQAAEMLAADLVL  60
            MSS+LKPLLLQSFRTGGLYLLIIALSLAISATTALKFSN QV+ AV+LQAAEMLAADLVL
Sbjct  1    MSSVLKPLLLQSFRTGGLYLLIIALSLAISATTALKFSNTQVQNAVTLQAAEMLAADLVL  60

Query  61   SDQEPIAQQWTAQAQQDGLQQSKVTLFSSMARTDQNFVMVNVKAIDHKFPLRGDLKIDPV  120
             DQ+PI  +W  QA++  LQQ+ VT+FSSMA T   FVMVNVKA+D  FPLRG+L+I P 
Sbjct  61   YDQDPIQTEWLQQAKKLDLQQAAVTVFSSMAHTSDQFVMVNVKAVDAHFPLRGELEIQPK  120

Query  121  QQTLRRGEVWLSPRARDLLKVKLNDLVFIADGQFKFTGLIQHDSNQELGFSGFSPTVMIN  180
             Q ++ G+VWLSPRA DLL+ K+ D V IADGQFK TG+I+HDSNQELGFSGFSPTV+I+
Sbjct  121  PQGIQTGQVWLSPRAADLLQAKVGDQVAIADGQFKVTGIIEHDSNQELGFSGFSPTVIIH  180

Query  181  QQDVAKTNAIQTGSRIEYRLLMAGNPEQTKTFS----QQFKH---LQQPNSDNESSENQA  233
            Q D+AKTNA+Q GSRIEYRLLMAG PEQ K F     QQ +H   L QPN        Q 
Sbjct  181  QADIAKTNAVQVGSRIEYRLLMAGPPEQIKAFKNIFRQQTQHEQTLDQPNDQQLGEGEQG  240

Query  234  TLRLRDATQNNARLMKPIENLDTFLQLANILTILLCGIAIALTSQRYVQQNQDHIALIRC  293
            +L+LRDA+Q+N RLMKPIENLDTFLQLAN+LTILLCGIAIALTSQRYVQQNQDHIAL+RC
Sbjct  241  SLKLRDASQSNTRLMKPIENLDTFLQLANLLTILLCGIAIALTSQRYVQQNQDHIALMRC  300

Query  294  LGASKWQILRAYIGLLSIVSLISIGTGTLIGIGLGYGLLQLMLQLMPQLNIGFSAMHLIA  353
            LGASK QIL AY+ LL IVS +SI  G+LIGI LGYGLLQLMLQL+PQL + F+   L+ 
Sbjct  301  LGASKRQILLAYLALLGIVSALSIVLGSLIGIALGYGLLQLMLQLIPQLQLSFALADLLF  360

Query  354  GPLPIAIFTSVVVLFGFILPSVWELLNTPPIRVIRQEIRSKRSLSLTFLAGISSLIIFSL  413
              LP+AIFTSV+VL GFILPS+WELLNTPPIRVIRQ+ RS++S    F  GI+SL+IFSL
Sbjct  361  A-LPVAIFTSVMVLIGFILPSIWELLNTPPIRVIRQQERSRKSYFAMFAVGIASLVIFSL  419

Query  414  ILSENIPLSGMMLAAILLLSLLLYGIVWSLLKFLKTLRNRLSAYVRLPHQTALQITALAL  473
            +LS+N+ LS  +LAAIL+L   L+ ++W LLK +K L++ +SAYVR+PHQTALQITALAL
Sbjct  420  VLSDNLQLSLWVLAAILILCATLFAVIWLLLKAIKQLKHPVSAYVRIPHQTALQITALAL  479

Query  474  GISLITVLSVLRVDLLERWQQQLPEGTPNQFVYGLPPFEMPQLKQQLKQNEWKSTPLYPN  533
            G+SLITVLSVLR DLLERWQQQLPEGTPNQFVYGLPPF+MPQLKQQL+QN+W+STPLYPN
Sbjct  480  GLSLITVLSVLRTDLLERWQQQLPEGTPNQFVYGLPPFDMPQLKQQLEQNKWQSTPLYPN  539

Query  534  IRGRLIAKNDQPFTADQIKQNNALRRELNLTQAQSFPEDNQIITGITRFNQVNQVSVESK  593
            IRGRL+AKN QPF A+ +KQNN+LRRELNLTQA  +P+DN I  G + F Q+ QVSVE+K
Sbjct  540  IRGRLVAKNGQPFAAELVKQNNSLRRELNLTQAAVYPKDNVITQGSSHFTQIGQVSVEAK  599

Query  594  LAQELGIKIGDQLTFQLPEGPLSARVVNLRTVEWESFSPNFFFIFSPSTMDENAGSYLGS  653
            LA ELGIKIGDQL+F LPEGP++A V+NLR+VEWESFSPNFFFIFSP TMDENAGSYLGS
Sbjct  600  LATELGIKIGDQLSFSLPEGPMNATVINLRSVEWESFSPNFFFIFSPKTMDENAGSYLGS  659

Query  654  FYVPLQDKTKLIAVIQQFSNTVFIDVSLILDEVKRLVGVLVQIITILAVLVGVSGVLVLI  713
            FYVP  D+ K++ +IQQFSNTVFIDV  IL+EVKRLV VLVQI+T+LA+LVG+SGVLVLI
Sbjct  660  FYVPPADQPKMVQLIQQFSNTVFIDVGRILEEVKRLVNVLVQIVTVLAMLVGLSGVLVLI  719

Query  714  ACLNLLMDERRREVALLRSFGISKRKLKNMLMFEVGLIGLLSGVVACLFAEVISAIASYK  773
            ACLN+LMDERR+EVALLRSFG++K KLK ML  E+G IGLL+GVVACLFAEVISAIASYK
Sbjct  720  ACLNVLMDERRKEVALLRSFGVAKNKLKRMLSLEIGFIGLLAGVVACLFAEVISAIASYK  779

Query  774  MNIAIQWHIEIWLILPVLMMLICAMIGRYRLSYLCDIPPLQSLRELNQS  822
            M +AIQWH EIWLILP+ MMLIC +IGRYRLSYLCDIPPLQSLRE+NQS
Sbjct  780  MQMAIQWHAEIWLILPLSMMLICTLIGRYRLSYLCDIPPLQSLREMNQS  828


> O24851 FtsX domain-containing protein [Acinetobacter baylyi (strain 
ATCC 33305 / BD413 / ADP1)]
Length=275

 Score =  529 bits (1362),  Expect = 0.0
 Identities = 275/275 (100%), Positives = 275/275 (100%), Gaps = 0/275 (0%)

Query  549  DQIKQNNALRRELNLTQAQSFPEDNQIITGITRFNQVNQVSVESKLAQELGIKIGDQLTF  608
            DQIKQNNALRRELNLTQAQSFPEDNQIITGITRFNQVNQVSVESKLAQELGIKIGDQLTF
Sbjct  1    DQIKQNNALRRELNLTQAQSFPEDNQIITGITRFNQVNQVSVESKLAQELGIKIGDQLTF  60

Query  609  QLPEGPLSARVVNLRTVEWESFSPNFFFIFSPSTMDENAGSYLGSFYVPLQDKTKLIAVI  668
            QLPEGPLSARVVNLRTVEWESFSPNFFFIFSPSTMDENAGSYLGSFYVPLQDKTKLIAVI
Sbjct  61   QLPEGPLSARVVNLRTVEWESFSPNFFFIFSPSTMDENAGSYLGSFYVPLQDKTKLIAVI  120

Query  669  QQFSNTVFIDVSLILDEVKRLVGVLVQIITILAVLVGVSGVLVLIACLNLLMDERRREVA  728
            QQFSNTVFIDVSLILDEVKRLVGVLVQIITILAVLVGVSGVLVLIACLNLLMDERRREVA
Sbjct  121  QQFSNTVFIDVSLILDEVKRLVGVLVQIITILAVLVGVSGVLVLIACLNLLMDERRREVA  180

Query  729  LLRSFGISKRKLKNMLMFEVGLIGLLSGVVACLFAEVISAIASYKMNIAIQWHIEIWLIL  788
            LLRSFGISKRKLKNMLMFEVGLIGLLSGVVACLFAEVISAIASYKMNIAIQWHIEIWLIL
Sbjct  181  LLRSFGISKRKLKNMLMFEVGLIGLLSGVVACLFAEVISAIASYKMNIAIQWHIEIWLIL  240

Query  789  PVLMMLICAMIGRYRLSYLCDIPPLQSLRELNQSS  823
            PVLMMLICAMIGRYRLSYLCDIPPLQSLRELNQSS
Sbjct  241  PVLMMLICAMIGRYRLSYLCDIPPLQSLRELNQSS  275


> B1AAN3 ABC transporter permease protein component [Pseudoalteromonas 
sp. 643A]
Length=546

 Score =  218 bits (554),  Expect = 4e-64
 Identities = 149/537 (28%), Positives = 276/537 (51%), Gaps = 27/537 (5%)

Query  290  LIRCLGASKWQILRAYIGLLSIVSLISIGTGTLIGIGLGYGLLQLMLQLMPQLNIGFSAM  349
            +++ LG S+  I + Y+  L +V  +++G G LIG    YGL ++    + + ++G    
Sbjct  1    MMKTLGGSRSMIRKIYMLHLLLVCSMAVGVGLLIG----YGLQEVATSYLSK-SMGTELP  55

Query  350  HLIAGPLPIAIFTSVVVLFGFILPSVWELLNTPPIRVIRQEIRSKRSLSLTFLAGISSLI  409
                 P  +AI T V+    F +  +++L + PP+RV+R+ +  K ++S   L  +S+L 
Sbjct  56   MGGFKPWLVAISTGVICAVMFSIKPLFDLFDIPPLRVLRRNLGDKLAVSRVHLT-MSALT  114

Query  410  IFSL--ILSENIPLSGMMLAAILLL-------SLLLYGIVWSL-LKFLKTLRNRLSAYVR  459
            +F L  + S NI ++ ++  + L L       S L++G    L LK   +    +++  +
Sbjct  115  VFLLMWLFSNNIKITLILFTSTLALIGVLFVVSKLIFGGGRKLGLKPGNSWSLAIASIQK  174

Query  460  LPHQTALQITALALGISLITVLSVLRVDLLERWQQQLPEGTPNQFVYGLPPFEMPQLKQQ  519
              +  A+Q+ + +L I L+  L VL+ D++  WQ QLP+  PN F+  +   ++  +   
Sbjct  175  RANVNAVQLISFSLAIKLLLFLVVLKNDMISDWQSQLPDDAPNAFLVNITQNDLAPINDY  234

Query  520  LKQNEWKSTPLYPNIRGRLIAKNDQPFTADQIKQNN---------ALRRELNLTQAQSFP  570
            L+Q   + +  YP IRGR+ A N +    +   Q+N          + RELNLT  +  P
Sbjct  235  LEQKNIQVSEFYPTIRGRVNAVNGELVAREVSLQDNEEKDEDARSGIGRELNLTWLKDEP  294

Query  571  EDNQIITGIT-RFNQVNQVSVESKLAQELGIKIGDQLTFQLPEGPLSARVVNLRTVEWES  629
              N++I G     N V + SVE  + + L +KIGD LTF +      A++ ++R V W +
Sbjct  295  AQNEVIEGEWFGENAVAEASVEESMLERLDVKIGDTLTFLIGAQSFDAKITSVRKVNWAT  354

Query  630  FSPNFFFIFSPSTMDENAGSYLGSFYVPLQDKTKLIAVIQQFSNTVFIDVSLILDEVKRL  689
              PNFF I SP  + +   +Y+ S  +  + K     +++ +     ID+   + +++  
Sbjct  355  LKPNFFIILSPDVLADFPATYISSVRINPEQKRDFSQLLRTYPTITAIDIDNFVKQIQST  414

Query  690  VGVLVQIITILAVLVGVSGVLVLIACLNLLMDERRREVALLRSFGISKRKLKNMLMFEVG  749
            +  +   I  +  +V + G LVLI+ +   + ER +E+ +LR+ G   R +KN  ++E  
Sbjct  415  IKQVSLAIGFVLAIVVLCGALVLISQVQASLGERMQEIVILRTLGAKSRLIKNATLYEFL  474

Query  750  LIGLLSGVVACLFAEVISAIASYKM-NIAIQWHIEIWLILPVLMMLICAMIGRYRLS  805
            L+G L+G+VA  F+++   I   +M ++A + H  IW+I PV   +  A +G + ++
Sbjct  475  LLGGLAGLVAAFFSDIALLIVQQQMFDLAGKLHPHIWIIGPVAGGIFVAGLGYFMIA  531


 Score = 25.4 bits (54),  Expect = 0.19
 Identities = 19/94 (20%), Positives = 44/94 (47%), Gaps = 5/94 (5%)

Query  729  LLRSFGISKRKLKNMLMFEVGLIGLLSGVVACLFAEVISAIASYKMNIAIQWHIEI----  784
            ++++ G S+  ++ + M  + L+  ++  V  L    +  +A+  ++ ++   + +    
Sbjct  1    MMKTLGGSRSMIRKIYMLHLLLVCSMAVGVGLLIGYGLQEVATSYLSKSMGTELPMGGFK  60

Query  785  -WLILPVLMMLICAMIGRYRLSYLCDIPPLQSLR  817
             WL+     ++   M     L  L DIPPL+ LR
Sbjct  61   PWLVAISTGVICAVMFSIKPLFDLFDIPPLRVLR  94


 Score = 24.3 bits (51),  Expect = 0.42
 Identities = 25/105 (24%), Positives = 43/105 (41%), Gaps = 23/105 (22%)

Query  205  NPEQTKTFSQ---QFKHLQQPNSDNESSENQATLRLRDATQNNARLMKPIENLDTFLQLA  261
            NPEQ + FSQ    +  +   + DN   + Q+T++                     L + 
Sbjct  382  NPEQKRDFSQLLRTYPTITAIDIDNFVKQIQSTIK------------------QVSLAIG  423

Query  262  NILTI-LLCGIAIALTS-QRYVQQNQDHIALIRCLGASKWQILRA  304
             +L I +LCG  + ++  Q  + +    I ++R LGA    I  A
Sbjct  424  FVLAIVVLCGALVLISQVQASLGERMQEIVILRTLGAKSRLIKNA  468


> Q9S4Z3 Uncharacterized protein [Salmonella enteritidis]
Length=448

 Score =  203 bits (516),  Expect = 6e-60
 Identities = 139/435 (32%), Positives = 236/435 (54%), Gaps = 20/435 (5%)

Query  378  LLNTPPIRVIRQEIRSKRSLSLTFLAGISSLIIFSLI--LSENIPLSGMMLAAILLLSLL  435
            LL T P+RV+R+++ + R   L     ++  ++ +L+  L     L   +LA  ++L+LL
Sbjct  3    LLATQPLRVLRRDVVA-RVWPLKIYLPVACAVVVALLAGLMGGSMLLWAVLAGAVILALL  61

Query  436  LYGIVWSLLKFLK-------TLRNRLSAYVRLPHQTALQITALALGISLITVLSVLRVDL  488
               + W LL  L+        LR  +S  +R P  T  Q++A +L   L+ +L VLR DL
Sbjct  62   CGLVGWMLLNVLRGMTLTSLPLRLAVSRLLRQPWSTLSQLSAFSLSFMLLALLLVLRGDL  121

Query  489  LERWQQQLPEGTPNQFVYGLPPFEMPQLKQQLKQNEWKSTPLYPNIRGRLIAKNDQPFTA  548
            L+RWQQQLP  +PN F+  +   ++  LK  L +++      YP +R RL   N  P   
Sbjct  122  LDRWQQQLPPESPNYFLINIASEQVAPLKAFLAEHQVIPQTFYPIVRARLTRINGNP---  178

Query  549  DQIKQNNALRRELNLTQAQSFPEDNQIITGITRFNQVNQVSVESKLAQELGIKIGDQLTF  608
             + +Q+ +L RELNLT   + P  N ++ G     +  +VS+E  LA+ L +K+GD +TF
Sbjct  179  TEGQQDESLNRELNLTWQDTRPAHNPLVAGHWP-PKPGEVSMEEGLAKRLNVKLGDSVTF  237

Query  609  QLPEGPLSARVVNLRTVEWESFSPNFFFIFSPSTMDENAGSYLGSFYVPLQDKTKLIAVI  668
                   SA+V +LR V+WES  PNFFFIF    +D    S+L SF         L  + 
Sbjct  238  MGDTQAFSAKVTSLRQVDWESLRPNFFFIFPSGALDGQPQSWLTSFRWE-NGNGMLTQLN  296

Query  669  QQFSNTVFIDVSLILDEVKRLVGVLVQIITILAVLVGVSGVLVLIACLNLLMDERRREVA  728
            ++F     +D+  IL +V +++  + + + ++ VLV + G+L+L+A + + M +R +E+ 
Sbjct  297  REFPTVSLLDIGAILKQVGQVLEQVSRALEVMVVLVTLCGMLLLLAQVQVGMRQRHQELV  356

Query  729  LLRSFGISKRKLKNMLMFEVGLIGLLSGVVACLFAEVISAIASYKMNI-AIQWHIE--IW  785
            + R+ G  K+ L+  L  E  ++GL++G+VA + AE  +A+A  ++N+    W  +  +W
Sbjct  357  VWRTLGAGKKLLRTTLWCEFAMLGLVAGLVAAIGAE--TALAILQINVFDFPWEPDWRLW  414

Query  786  LILPVLMMLICAMIG  800
              LP    L+ ++ G
Sbjct  415  GALPFCGALLLSVCG  429


 Score = 20.8 bits (42),  Expect = 4.9
 Identities = 14/50 (28%), Positives = 25/50 (50%), Gaps = 5/50 (10%)

Query  758  VACLFAEVISAIASYKMNIAIQWHIEIWLILPVLMMLICAMIGRYRLSYL  807
            VAC  A V++ +A       + W +   L   V++ L+C ++G   L+ L
Sbjct  29   VAC--AVVVALLAGLMGGSMLLWAV---LAGAVILALLCGLVGWMLLNVL  73


> B1AAN2 ABC transporter permease protein component [Pseudoalteromonas 
sp. 643A]
Length=222

 Score = 86.7 bits (213),  Expect = 2e-21
 Identities = 55/206 (27%), Positives = 99/206 (48%), Gaps = 8/206 (4%)

Query  8    LLLQSFRTGGLYLLIIALSLAISATTALKFSNDQVKQAVSLQAAEMLAADLVLSDQEPIA  67
            L  + FR G L ++  A++LA+     L    +++ Q+++ +++  +AAD VL+    + 
Sbjct  9    LFAREFRRGELTVISAAIALAVLTVLTLSMVTERIGQSIAQKSSAFIAADRVLASDHVLD  68

Query  68   QQWTAQAQQDGLQQSKVTLFSSMARTDQNFVMVNVKAIDHKFPLRGDLKIDPV---QQTL  124
              + A+A+ + L+ +++  F +M   +      +VKA  +  PL+G LK+      +  +
Sbjct  69   TSFIAKAETENLKPAQMVYFDTMLFANDEMQFSSVKAASNASPLKGQLKVKDTLVGETKI  128

Query  125  RR-----GEVWLSPRARDLLKVKLNDLVFIADGQFKFTGLIQHDSNQELGFSGFSPTVMI  179
             R     G VWLS      L + +   V +    F    +I  + +        S  V+I
Sbjct  129  ARNGPSLGNVWLSESVFYSLNIDIGSQVELGAALFNVEKVIVEEPDAPFNVFSSSRRVLI  188

Query  180  NQQDVAKTNAIQTGSRIEYRLLMAGN  205
            N  DV KT  +Q GSR+ YR L AG+
Sbjct  189  NIADVPKTEVVQPGSRVYYRQLYAGD  214


> Q1A2C7 ABC transporter [Streptococcus mutans]
Length=877

 Score = 53.5 bits (127),  Expect = 5e-10
 Identities = 108/570 (19%), Positives = 226/570 (40%), Gaps = 76/570 (13%)

Query  252  ENLDTFLQLANILTILLCGIAIALTSQRYVQQNQDHIALIRCLGASKWQILRAYIGLLSI  311
            +N+     +  ++  L+  +    T  R+V + +++  +++  G S   +++ ++    +
Sbjct  343  KNISNIGNIFPVVLYLVAALVTFTTMTRFVNEERNNSGILKSFGYSDSDVMKKFV----V  398

Query  312  VSLISIGTGTLIGIGLGYGLLQLMLQLMPQLNIGFSAMHLIAGPLPIAIFTSVVVLFGFI  371
              LI+  TGT++G+  G+ LL  ++       +  S+ HL        +    + L   +
Sbjct  399  YGLIASLTGTILGVIGGHYLLPKIITRNVTTTMTISSPHLYF-YWSYTLLAVGLGLLSAV  457

Query  372  LPSVWELLNTPPIRVIRQEIRSKRSLSLTFLAGISSLIIFSLILSENIPLSGMMLAAILL  431
             P+ W         V R+E+  K +  L                   +P   M  + ILL
Sbjct  458  FPAFW---------VARRELSEKPAQLL-------------------LPKPPMRGSKILL  489

Query  432  LSLLLYGIVWSLLKFLKTLRNRLSAYVRLPHQTALQITALALGISLITVLSVLRVDLLER  491
              +   G +W  L F +    +++A     ++  + +T   +  S+  + + L +     
Sbjct  490  EHV---GFIWRRLSFTQ----KVTARNIFRYKQRMFMTVFGVAGSVALLFAGLGI-----  537

Query  492  WQQQLPEGTPNQFVYGLPPFEMPQLKQQLKQNEWKSTPLYPNIR-----GRLIAKNDQPF  546
             Q  L     NQF + L  ++M  LK    Q+       +           + ++N    
Sbjct  538  -QSSLGRVIDNQFNH-LTTYDMLVLKNNTTQSNINEVSQFLKSNTVSNYQEISSQNMDVM  595

Query  547  TADQIKQNNALRRELNLTQAQSFPEDNQIITGITRFNQVNQVSVESKLAQELGIKIGDQL  606
             + Q ++        N    +SF    +  TG           +  KLA   G++ GD L
Sbjct  596  ISGQKEKKTISILATNKNDFESFIHLKEAKTGKKVILSNEGAVISKKLAAYYGVQKGDLL  655

Query  607  TFQLPEGPLS----ARVVNLRTVEWESFSPNFF---FIFSPSTMDENAGSYLGSFYVPLQ  659
            +F+   G       + VV +    +   +  ++   F  +PS          GS      
Sbjct  656  SFKDENGKKRKIKVSDVVEMNVNHYLFMTNKYYREVFNENPSKNAVLVSLKDGSVKNISN  715

Query  660  DKTKLIAV--IQQFSNTVFIDVSLILDEVKRLVGVLVQIITILAVLVGVSGVLVLIACLN  717
              TKL+A+  +   S       S ++  V   V  L   + IL ++  +  V++L    N
Sbjct  716  QATKLLAMKGVSAVSQN-----SSLIKMVNTAVNGLNASMAILVIVSILLAVVILYNLTN  770

Query  718  LLMDERRREVALLRSFGISKRKLKNMLMFE---VGLIGLLSGVVA--CLFAEVISAIASY  772
            + + ER RE++ ++  G    ++   +  E   + + G+L G++   CL   +IS ++  
Sbjct  771  INVAERIRELSTIKVLGFHNEEITMYIYKETISLSIFGILLGLIGGDCLHKVIISVMSRD  830

Query  773  KM-NIAIQWHIEIWLILPVLMML-ICAMIG  800
             +   A+ W++    +LPV++++ I A++G
Sbjct  831  TVYPTAVDWYV---FVLPVVVIIVILAVLG  857


 Score = 26.9 bits (58),  Expect = 0.067
 Identities = 31/150 (21%), Positives = 67/150 (45%), Gaps = 12/150 (8%)

Query  231  NQATLRLR----DATQNNARLMK----PIENLDTFLQLANILTILLCGIAIALTSQRYVQ  282
            NQAT  L      A   N+ L+K     +  L+  + +  I++ILL  + +   +   V 
Sbjct  715  NQATKLLAMKGVSAVSQNSSLIKMVNTAVNGLNASMAILVIVSILLAVVILYNLTNINVA  774

Query  283  QNQDHIALIRCLGASKWQILRAYIGLLSIVSLISIGTGTLIGIGLGYGLLQLMLQLMPQL  342
            +    ++ I+ LG    +I          +S+     G L+G+  G  L ++++ +M + 
Sbjct  775  ERIRELSTIKVLGFHNEEITMYIYKETISLSIF----GILLGLIGGDCLHKVIISVMSRD  830

Query  343  NIGFSAMHLIAGPLPIAIFTSVVVLFGFIL  372
             +  +A+      LP+ +   ++ + G+I+
Sbjct  831  TVYPTAVDWYVFVLPVVVIIVILAVLGWIV  860


> V9PX24 ABC transporter permease [Actinoplanes sp. NAI112]
Length=841

 Score = 52.0 bits (123),  Expect = 1e-09
 Identities = 51/207 (25%), Positives = 92/207 (44%), Gaps = 27/207 (13%)

Query  257  FLQLANILTILLCGIAIALTSQRYVQQNQDHIALIRCLGASKWQILRAYIGLLSIVSLIS  316
            F+ L     + + G+ IA T    VQ  +  IAL+R +GA+  ++ R  +G  + + L +
Sbjct  259  FVGLMAASALGIAGLVIASTLAVSVQHRRREIALLRTVGATPARVRRLVVGEAAFIGLFA  318

Query  317  IGTGTLIGIGLGYGLLQLMLQLMPQLNIGFSAMHLIAGPLPIAIFTSVVVLFGFILPSV-  375
               G L+G+GLG       ++      +   ++ L  G  P    T V V+   +  S+ 
Sbjct  319  GLLGGLLGVGLG----AAAIRFFAAQGMVADSVRLQLGATPFLAGTGVAVVVAVLAGSLP  374

Query  376  -WELLNTPPIRVIRQ-EIRSKRSLSLTFLAGISSLIIFSLILSEN-----------IPLS  422
             W+     P   +R  +++  RS  L  ++G   L I +L ++             I ++
Sbjct  375  AWKASRISPAEALRSADVQPTRSSRLRIVSGFVLLGIAALFVTAGAVVANTGGYTAIDVA  434

Query  423  G---------MMLAAILLLSLLLYGIV  440
            G         ++LAA+LL  LLL G++
Sbjct  435  GVLFILSAPFLVLAAVLLGRLLLAGLL  461


 Score = 48.5 bits (114),  Expect = 2e-08
 Identities = 45/191 (24%), Positives = 85/191 (45%), Gaps = 9/191 (5%)

Query  586  NQVSVESKLAQELGIKIGDQLTFQLPEGPLSARVVNLRTVEWESFSPNFFFIFSPSTMDE  645
            + V ++   A   G  +GDQ+T     G    R+  +  V W         + +     +
Sbjct  146  DDVVLDRDTAAAAGATVGDQVTLVTLRGTAEYRLTGI--VTWPGAQYEHAVLLTDEHAAD  203

Query  646  NAGSYLGSFYVPLQDKTKLIAVIQQFSNTVFIDV----SLILDE-VKRLVGVLVQIITIL  700
              G  L +      D+  +   ++     V +      +LILD     L G   Q + ++
Sbjct  204  LGGDPLLALVRVSGDRAAVAKALRAALPGVEVTTDRSHALILDRRTAELSGGSSQFVGLM  263

Query  701  AV-LVGVSGVLVLIACLNLLMDERRREVALLRSFGISKRKLKNMLMFEVGLIGLLSGVVA  759
            A   +G++G LV+ + L + +  RRRE+ALLR+ G +  +++ +++ E   IGL +G++ 
Sbjct  264  AASALGIAG-LVIASTLAVSVQHRRREIALLRTVGATPARVRRLVVGEAAFIGLFAGLLG  322

Query  760  CLFAEVISAIA  770
             L    + A A
Sbjct  323  GLLGVGLGAAA  333


 Score = 25.0 bits (53),  Expect = 0.26
 Identities = 19/65 (29%), Positives = 28/65 (43%), Gaps = 2/65 (3%)

Query  270  GIAIALTSQRYVQQNQDHIALIRCLGASKWQILRAYIGLLSIVSLISIGTGTLIGIG--L  327
            GIA            +   AL+R  GA    I+RA +   +++    I  GTL+     L
Sbjct  729  GIAAINVLVSSAMARRGQFALLRLAGAQPAYIIRAVVCETAVIVAGGIILGTLVAAVPLL  788

Query  328  GYGLL  332
            GYG +
Sbjct  789  GYGYI  793


> J7LF99 Putative ABC transporter ATPase component [Lactobacillus 
brevis]
Length=641

 Score = 50.8 bits (120),  Expect = 3e-09
 Identities = 28/111 (25%), Positives = 66/111 (59%), Gaps = 13/111 (12%)

Query  699  ILAVLVGVS---GVLVLIACLNLLMDERRREVALLRSFGISKRKLKNMLMFEVGLIGLLS  755
            +LA + G+S     +++I  L + + ER +E+ +LR+ G+ ++ ++ + + E   +GL S
Sbjct  513  VLAAIAGISLLVSAIMIIVVLYISVSERTKEIGILRALGVRRKDIRRLFLSEAFFLGLFS  572

Query  756  GVVACLFAEVISAIASYKMNIAIQW----HIEI---WLILPVLMMLICAMI  799
             V+A +F E+++  A+   N+A ++     IEI   ++I  +++ +I +++
Sbjct  573  SVLALIFTELVAYFAN---NVATKYIGYSIIEITSNYMIFGIVVAIIISLL  620


 Score = 26.9 bits (58),  Expect = 0.064
 Identities = 16/73 (22%), Positives = 34/73 (47%), Gaps = 7/73 (10%)

Query  251  IENLDTFLQLANILTILLCGIAIALTSQRY-------VQQNQDHIALIRCLGASKWQILR  303
            +  L+T++QLA  +   + GI++ +++          V +    I ++R LG  +  I R
Sbjct  500  VSTLNTYIQLAFYVLAAIAGISLLVSAIMIIVVLYISVSERTKEIGILRALGVRRKDIRR  559

Query  304  AYIGLLSIVSLIS  316
             ++     + L S
Sbjct  560  LFLSEAFFLGLFS  572


 Score = 20.4 bits (41),  Expect = 6.6
 Identities = 14/52 (27%), Positives = 26/52 (50%), Gaps = 1/52 (2%)

Query  687  KRLVGVLVQIITILAVLVGVSGVLVLIACLNLLMDERR-REVALLRSFGISK  737
            ++ +G + Q   +++ L  +  VLV +    L   E+R R V LL   G+ +
Sbjct  84   RQTIGFVFQNFNLISHLSILDNVLVSLQMTGLSRKEQRERAVQLLDRVGLKE  135


 Score = 20.4 bits (41),  Expect = 6.6
 Identities = 7/20 (35%), Positives = 13/20 (65%), Gaps = 0/20 (0%)

Query  301  ILRAYIGLLSIVSLISIGTG  320
            I  A IG+ S++ ++ +G G
Sbjct  267  IFGASIGIFSVILMLGLGRG  286


> A8W865 ABC transporter permease [Pseudomonas fluorescens]
Length=820

 Score = 48.9 bits (115),  Expect = 1e-08
 Identities = 129/627 (21%), Positives = 252/627 (40%), Gaps = 121/627 (19%)

Query  233  ATLRLRDATQNN-ARLMKPIE-NLDTFLQLANILTILLCGIAIALTSQRYVQQNQDHIAL  290
            A L+L+    NN +RL +    NLD    L+ ++ + +   AI L     ++Q +  +  
Sbjct  217  AALQLKQGEDNNLSRLTESFHLNLDAVGFLSFVVGLFIVHAAIGLA----LEQRRGLLRT  272

Query  291  IRCLGASKWQILRAYIGL-LSIVSLISIGTGTLIGIGLGYGLLQLMLQLMPQLNIGFSAM  349
            +R  G S  ++L   +GL L  ++++S     ++GI  GY L  L+L   P +      +
Sbjct  273  LRACGVSA-RLLILSLGLELGALAVLS----GVLGIASGYLLASLLL---PDVAASLRGL  324

Query  350  H--LIAGPLPIAIFTSV----VVLFGFILP---SVWELLNTPPIRVIRQEI---------  391
            +   +AG L ++ +  +    V L G +L    S+W     P + +   +          
Sbjct  325  YGAEVAGQLNLSPWWWLAGLGVSLLGALLAGASSLWRAARLPLLALANAQAWHQAHGRWL  384

Query  392  -RSKRSLSLTFLAGISSLIIFSLILSENIPLSGMMLAAILLLSLLLYGIVWSLLK-----  445
             R     S   L  + +L +   + +  + ++ ++L A L L +LL G++ ++L      
Sbjct  385  RRQGWVASAALLIALLALWLGDSLAAGFVLMAALLLGAALALPVLLNGLLKAVLGRGRSV  444

Query  446  ----FLKTLRNRLSAYVRLPHQTALQITALALGISLITVLSVLRVDLLERWQQQLPEGTP  501
                FL   R +L A   L       + ALA  I   ++ S  R       +Q+L     
Sbjct  445  LGQWFLADCRQQLPA---LSLALMALLLALAANIGAGSMTSGFRQTFTHWLEQRLTAEL-  500

Query  502  NQFVYGLPPFEMPQLKQQLKQ-NEWKSTPLYPNIRGRL------IAKNDQPFTADQIKQN  554
                     +  PQ  QQ +Q N W S    P ++  L      +     P     +  N
Sbjct  501  ---------YLNPQNPQQAEQLNAWLSRQ--PLVQAVLPAWQVSVQLQGWPAEVFGVVDN  549

Query  555  NALRRELNLTQAQSFPEDNQIITGITRFNQVNQVSVESKLAQELGIKIGDQLTFQLPEGP  614
               R+   L +A   P D        R  Q + + +  +LA+ L +++GD ++   P+G 
Sbjct  550  PTYRQHWPLLEAADAPWD--------RLLQDDSLMLSEQLARRLKVQLGDTVSIPTPQGT  601

Query  615  LSARVVNLRT-----------------VEWESFSPNFFFIFSPSTMDENAGSYLGSFYVP  657
             + ++V +                     W + SP  F                 +  V 
Sbjct  602  WAPKIVGIYADYGNPKGHLLVNAQHLLAHWPTLSPARF-----------------NLRVA  644

Query  658  LQDKTKLIAVIQQFSNTVFIDVSLILDEVKRLVGVLVQII--------TILAVLVGVSGV  709
              D   LI  +Q+      ++ S I+D+ ++L G   Q+          + ++ +GV+GV
Sbjct  645  PADVPPLIREVQR---EFALEDSRIVDQ-QQLKGWSSQVFERTFAATAALNSLTLGVAGV  700

Query  710  LVLIACLNLLMDERRREVALLRSFGISKRKLKNMLMFEVGLIGLLSGVVACLFAEVISAI  769
             + I+ L      R  ++A L + G+++R+L  + + +  L+ +L+ ++A     +++  
Sbjct  701  ALFISLLT-QSQSRLGQLAPLWALGVTRRQLMLLNLGQTWLLAVLTLILALPLGLLLAWC  759

Query  770  ASYKMNI-AIQWHIEIWLILPVLMMLI  795
                +N+ A  W + + +    L  L+
Sbjct  760  LDAVINVQAFGWRLPLQVFPGQLAQLL  786


 Score = 35.0 bits (79),  Expect = 2e-04
 Identities = 66/310 (21%), Positives = 122/310 (39%), Gaps = 34/310 (11%)

Query  18   LYLLIIALSLAISATTALKFSNDQVKQAVSLQAAEMLAADLVLSDQEPI-AQQWTAQAQQ  76
            L L ++AL LA++A           +Q  +    + L A+L L+ Q P  A+Q  A   +
Sbjct  460  LSLALMALLLALAANIGAGSMTSGFRQTFTHWLEQRLTAELYLNPQNPQQAEQLNAWLSR  519

Query  77   DGLQQSKVTLFSSMARTD----QNFVMVNVKAIDHKFPLRGDLKIDPVQQTLRRGEVWLS  132
              L Q+ +  +    +      + F +V+       +PL  +    P  + L+   + LS
Sbjct  520  QPLVQAVLPAWQVSVQLQGWPAEVFGVVDNPTYRQHWPLL-EAADAPWDRLLQDDSLMLS  578

Query  133  PRARDLLKVKLNDLVFIADGQF----KFTGLIQHDSNQELGFSGFSPTVMINQQDVAKTN  188
             +    LKV+L D V I   Q     K  G+     N +         +++N Q +    
Sbjct  579  EQLARRLKVQLGDTVSIPTPQGTWAPKIVGIYADYGNPK-------GHLLVNAQHLLAHW  631

Query  189  AIQTGSRIEYRLLMAGNPEQTKTFSQQFKHLQQPNSDNESSENQATLRLRDATQNNARLM  248
               + +R   R+  A  P   +   ++F          E S      R+ D  Q      
Sbjct  632  PTLSPARFNLRVAPADVPPLIREVQREFAL--------EDS------RIVDQQQLKGWSS  677

Query  249  KPIENLDTFLQLANILTILLCGIAIALTSQRYVQQNQDHIALIRCLGASKWQILRAYIG-  307
            +  E         N LT+ + G+A+ ++     Q     +A +  LG ++ Q++   +G 
Sbjct  678  QVFERTFAATAALNSLTLGVAGVALFISLLTQSQSRLGQLAPLWALGVTRRQLMLLNLGQ  737

Query  308  --LLSIVSLI  315
              LL++++LI
Sbjct  738  TWLLAVLTLI  747


 Score = 29.3 bits (64),  Expect = 0.013
 Identities = 28/96 (29%), Positives = 44/96 (46%), Gaps = 6/96 (6%)

Query  446  FLKTLRNRLSAYVRLPHQTALQITALALGISLITVLSVLRVDLLERWQQ--QLPEGTPNQ  503
            F  TLR  LS + R P Q    +T L L  +L+T +  L     + + +  QL  G P  
Sbjct  4    FYWTLRALLSHWRRHPVQFFSVLTGLWLATALLTGVQALNSQARDSYARASQLIGGEPQA  63

Query  504  FVYGLPPFEMPQ-LKQQLKQNEWKSTPLYPNIRGRL  538
             +        PQ L  +L++  W   P+ P ++GR+
Sbjct  64   SLVAPDAASFPQALFAELRRAGW---PVSPVVQGRV  96


> A0A1B3TQ24 FtsX-like permease family protein [Klebsiella pneumoniae]
Length=376

 Score = 46.6 bits (109),  Expect = 4e-08
 Identities = 54/239 (23%), Positives = 105/239 (44%), Gaps = 29/239 (12%)

Query  159  LIQHDSNQELGFSGF------SPTVMINQQDVAKTNAIQTGSRIEYRLLMAGNPE-QTKT  211
            L+ H+  + L   G       +  ++I   DVA+    Q G +I + LL   N   Q + 
Sbjct  160  LVDHNQRKNLQIKGIVESGDATDNMLIVSLDVAQAWLHQPG-KISHGLLSVSNDVGQVEN  218

Query  212  FSQQFKHLQQPNSDNESSENQATLRLRDATQNNARLMKPIENLDTFLQLANILTILLCGI  271
            ++ + +  Q P+           L +R   + +A   + ++ +   + L +I+ + L  +
Sbjct  219  YASRLQ-AQYPD-----------LEIRPVRKVSASEGQVLDKIKGLMGLVSIVILALSSL  266

Query  272  AIALTSQRYVQQNQDHIALIRCLGASKWQILRAYIGLLSIVSLISIGTGTLIGIGLGYGL  331
             +  T    V +     AL + LG+S   I+R  +   SI++L ++  G +    LGY L
Sbjct  267  CVNTTLMAIVGERAREFALQKALGSSNGDIVRQILLETSIIALAAVACGWV----LGYLL  322

Query  332  LQLMLQLMPQLNIGFSAMHLIAGPLPIAIFTSVVVLFGFILPSVWELLNTPPIRVIRQE  390
             QL+      L +  +A+ L    LPI +  S++V     +  V   ++  P +V++ E
Sbjct  323  AQLL-----GLTVFNAAISLRLPVLPITLVLSLLVAILAAIVPVRRAVSVEPAKVLKGE  376


 Score = 37.7 bits (86),  Expect = 3e-05
 Identities = 33/142 (23%), Positives = 64/142 (45%), Gaps = 18/142 (13%)

Query  682  ILDEVKRLVGVLVQIITILAVLVGVSGVLVLIACLNLLMDERRREVALLRSFGISKRKLK  741
            +LD++K L+G++  +I  L+ L   + ++ ++        ER RE AL ++ G S   + 
Sbjct  245  VLDKIKGLMGLVSIVILALSSLCVNTTLMAIVG-------ERAREFALQKALGSSNGDIV  297

Query  742  NMLMFEVGLIGLLSGVVAC------LFAEVISAIASYKMNIAIQWHIEIWLILPVLMMLI  795
              ++ E  +I L    VAC      L A+++        N AI   + +  I  VL +L+
Sbjct  298  RQILLETSIIAL--AAVACGWVLGYLLAQLLGLTV---FNAAISLRLPVLPITLVLSLLV  352

Query  796  CAMIGRYRLSYLCDIPPLQSLR  817
              +     +     + P + L+
Sbjct  353  AILAAIVPVRRAVSVEPAKVLK  374


> O32735 AttF [Rhizobium radiobacter]
Length=420

 Score = 43.5 bits (101),  Expect = 4e-07
 Identities = 24/84 (29%), Positives = 41/84 (49%), Gaps = 0/84 (0%)

Query  685  EVKRLVGVLVQIITILAVLVGVSGVLVLIACLNLLMDERRREVALLRSFGISKRKLKNML  744
            +V RL       +T    L  V G+ ++ +   L  ++RR     +RS G+S R L  ML
Sbjct  215  DVARLTDSFHLNLTAFGFLAFVVGLFIVYSATGLSFEQRRGSFRTMRSLGVSLRSLTAML  274

Query  745  MFEVGLIGLLSGVVACLFAEVISA  768
            + E  L  L+SG +  +   V+++
Sbjct  275  VIETALFALVSGALGIVVGYVVAS  298



Lambda      K        H        a         alpha
   0.324    0.138    0.394    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 8945412


  Database: 7f81a9f5243111f45c8df3816c9a4a5b.TrEMBL.fasta
    Posted date:  Sep 19, 2020  2:16 PM
  Number of letters in database: 12,883
  Number of sequences in database:  19



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40