ACIAD1059 / SwissProt Alignments

BLASTP 2.2.28+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: 2511435b4192cac7ab88f36604d09999.SwissProt.fasta
           5 sequences; 2,463 total letters



Query= ACIAD1059

Length=824
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  P77504 Uncharacterized ABC transporter permease YbbP [Escherich...   347    2e-109
  O31712 Uncharacterized ABC transporter permease YknZ [Bacillus ...  43.1    1e-07 
  O35005 ABC transporter permease YtrF [Bacillus subtilis (strain...  42.7    1e-07 
  Q9PEF2 Lipoprotein-releasing system transmembrane protein LolC ...  38.1    4e-06 
  Q87EF5 Lipoprotein-releasing system transmembrane protein LolC ...  38.1    4e-06 


> P77504 Uncharacterized ABC transporter permease YbbP [Escherichia 
coli (strain K12)]
Length=804

 Score =  347 bits (890),  Expect = 2e-109
 Identities = 245/805 (30%), Positives = 409/805 (51%), Gaps = 42/805 (5%)

Query  11   QSFRTGGLYLLIIALSLAISATTALKFSNDQVKQAVSLQAAEMLAADLVLSDQEPIAQQW  70
            + +R+  L ++ +ALSLA++   AL   +D++++ +S Q+ E +A D  L     + Q W
Sbjct  8    REWRSPSLLIVWLALSLAVACVLALGNISDRMEKGLSQQSREFMAGDRALRSSREVPQAW  67

Query  71   TAQAQQDGLQQSKVTLFSSMARTDQNFVMVNVKAIDHKFPLRGDLKIDPVQQTLRRGEVW  130
              +AQ+ GL+  K   F++M        + NVKA+D  +P+ GDL+ +P     + G V 
Sbjct  68   LEEAQKRGLKVGKQLTFATMTFAGDTPQLANVKAVDDIYPMYGDLQTNPPGLKPQAGSVL  127

Query  131  LSPRARDLLKVKLNDLVFIADGQFKFTGLIQHDSNQELGFSGF--SPTVMINQQDVAKTN  188
            L+PR   LL +K  D + + D   +  G +  + +   GF+ F  +P +M+N  DV KT 
Sbjct  128  LAPRLMALLNLKTGDTIDVGDATLRIAGEVIQEPDS--GFNPFQMAPRLMMNLADVDKTG  185

Query  189  AIQTGSRIEYRLLMAGNPEQTKTFSQQFKHLQQPNSDNESSENQATLRLRDATQNNARLM  248
            A+Q GSR+ +R    GN  Q   + +      +P             R     Q+   L 
Sbjct  186  AVQPGSRVTWRYKFGGNENQLDGYEKWLLPQLKPEQ-----------RWYGLEQDEGALG  234

Query  249  KPIENLDTFLQLANILTILLCGIAIALTSQRYVQQNQDHIALIRCLGASKWQILRAYIGL  308
            + +E    FL L+ +LT+LL   A+A+    Y +   D +A+++ LGA + Q+ +  +G 
Sbjct  235  RSMERSQQFLLLSALLTLLLAVAAVAVAMNHYCRSRYDLVAILKTLGAGRAQLRKLIVGQ  294

Query  309  LSIVSLISIGTGTLIGIGLGYGLLQ--LMLQLMPQLNIGFSAMHLIAGPLPIAIFTSVVV  366
              +V  +S  TG  IG+     L +  LM+ L P L        L      +   T + +
Sbjct  295  WLMVLTLSAVTGGAIGL-----LFENVLMVLLKPVLPAALPPASLWPWLWALGTMTVISL  349

Query  367  LFGFILPSVWELLNTPPIRVIRQEIRSKRSLSLTFLAGISSLIIFSLI--LSENIPLSGM  424
            L G  L     LL T P+RV+R ++ +     L F   I S+++  L+  L     L   
Sbjct  350  LVG--LRPYRLLLATQPLRVLRNDVVA-NVWPLKFYLPIVSVVVVLLLAGLMGGSMLLWA  406

Query  425  MLAAILLLSLLLYGIVWSLLKFLK-------TLRNRLSAYVRLPHQTALQITALALGISL  477
            +LA  ++L+LL   + W LL  L+        LR  +S  +R P  T  Q++A +L   L
Sbjct  407  VLAGAVVLALLCGVLGWMLLNVLRRMTLKSLPLRLAVSRLLRQPWSTLSQLSAFSLSFML  466

Query  478  ITVLSVLRVDLLERWQQQLPEGTPNQFVYGLPPFEMPQLKQQLKQNEWKSTPLYPNIRGR  537
            + +L VLR DLL+RWQQQLP  +PN F+  +   ++  LK  L +++      YP +R R
Sbjct  467  LALLLVLRGDLLDRWQQQLPPESPNYFLINIATEQVAPLKAFLAEHQIVPESFYPVVRAR  526

Query  538  LIAKNDQPFTADQIKQNNALRRELNLTQAQSFPEDNQIITGITRFNQVNQVSVESKLAQE  597
            L A ND+P   +   ++ AL RELNLT   + P+ N I+ G     + ++VS+E  LA+ 
Sbjct  527  LTAINDKPTEGN---EDEALNRELNLTWQNTRPDHNPIVAG-NWPPKADEVSMEEGLAKR  582

Query  598  LGIKIGDQLTFQLPEGPLSARVVNLRTVEWESFSPNFFFIFSPSTMDENAGSYLGSFYVP  657
            L + +GD +TF        A+V +LR V+WES  PNF+FIF    +D    S+L SF   
Sbjct  583  LNVALGDTVTFMGDTQEFRAKVTSLRKVDWESLRPNFYFIFPEGALDGQPQSWLTSFRWE  642

Query  658  LQDKTKLIAVIQQFSNTVFIDVSLILDEVKRLVGVLVQIITILAVLVGVSGVLVLIACLN  717
                  L  + +QF     +D+  IL +V +++  + + + ++ VLV   G+L+L+A + 
Sbjct  643  -NGNGMLTQLNRQFPTISLLDIGAILKQVGQVLEQVSRALEVMVVLVTACGMLLLLAQVQ  701

Query  718  LLMDERRREVALLRSFGISKRKLKNMLMFEVGLIGLLSGVVACLFAEVISAIASYKMNIA  777
            + M +R +E+ + R+ G  K+ L+  L  E  ++G +SG+VA + AE   A+   K+   
Sbjct  702  VGMRQRHQELVVWRTLGAGKKLLRTTLWCEFAMLGFVSGLVAAIGAETALAVLQAKV-FD  760

Query  778  IQWHIE--IWLILPVLMMLICAMIG  800
              W  +  +W++LP    L+ ++ G
Sbjct  761  FPWEPDWRLWIVLPCSGALLLSLFG  785


 Score = 29.6 bits (65),  Expect = 0.002
 Identities = 29/131 (22%), Positives = 56/131 (43%), Gaps = 11/131 (8%)

Query  695  QIITILAVLVGVSGVLVLIACLNLLMDERRREVALLRSFGISKRKLKNMLMFEVGLIGLL  754
            Q + + A+L  +  V  +   +N     R   VA+L++ G  + +L+ +++ +  ++  L
Sbjct  242  QFLLLSALLTLLLAVAAVAVAMNHYCRSRYDLVAILKTLGAGRAQLRKLIVGQWLMVLTL  301

Query  755  S----GVVACLFAEVISAIASYKMNIAIQ----WHIEIWLILPVLMMLICAMIGRYRLSY  806
            S    G +  LF  V+  +    +  A+     W    WL     M +I  ++G      
Sbjct  302  SAVTGGAIGLLFENVLMVLLKPVLPAALPPASLWP---WLWALGTMTVISLLVGLRPYRL  358

Query  807  LCDIPPLQSLR  817
            L    PL+ LR
Sbjct  359  LLATQPLRVLR  369


 Score = 18.1 bits (35),  Expect = 6.6
 Identities = 30/137 (22%), Positives = 60/137 (44%), Gaps = 18/137 (13%)

Query  687  KRLVGVLVQIITILAVLVGVSGVL---VLIACLNLLMDERRREVAL---LRSFGISKRKL  740
            K +VG  + ++T+ AV  G  G+L   VL+  L  ++       +L   L + G      
Sbjct  289  KLIVGQWLMVLTLSAVTGGAIGLLFENVLMVLLKPVLPAALPPASLWPWLWALGTM----  344

Query  741  KNMLMFEVGL----IGLLSGVVACLFAEVISAIASYKMNIAIQWHIEIWLILPVL---MM  793
              ++   VGL    + L +  +  L  +V++ +   K  + I   + + L+  ++   M+
Sbjct  345  -TVISLLVGLRPYRLLLATQPLRVLRNDVVANVWPLKFYLPIVSVVVVLLLAGLMGGSML  403

Query  794  LICAMIGRYRLSYLCDI  810
            L   + G   L+ LC +
Sbjct  404  LWAVLAGAVVLALLCGV  420


> O31712 Uncharacterized ABC transporter permease YknZ [Bacillus 
subtilis (strain 168)]
Length=397

 Score = 43.1 bits (100),  Expect = 1e-07
 Identities = 34/143 (24%), Positives = 72/143 (50%), Gaps = 12/143 (8%)

Query  683  LDEVKRLVGVLVQIIT-ILAVLVGVSGVLVLIACLNLLM---DERRREVALLRSFGISKR  738
            ++E+   +G +  I+T I+  + G+S ++  I  +N+++    ER RE+ + +S G ++ 
Sbjct  257  MEEIAAGIGKVTAIMTTIIGSIAGISLLVGGIGVMNIMLVSVTERTREIGIRKSLGATRG  316

Query  739  KLKNMLMFEVGLIGLLSGVVACLF----AEVISAIASYKMNIAIQWHIEIWLILPVLMML  794
            ++    + E  ++ L+ G+V        A ++SAIA +     I W +    +L    ML
Sbjct  317  QILTQFLIESVVLTLIGGLVGIGIGYGGAALVSAIAGWPS--LISWQVVCGGVL--FSML  372

Query  795  ICAMIGRYRLSYLCDIPPLQSLR  817
            I  + G    +    + P+++LR
Sbjct  373  IGVIFGMLPANKAAKLDPIEALR  395


 Score = 36.2 bits (82),  Expect = 1e-05
 Identities = 45/183 (25%), Positives = 80/183 (44%), Gaps = 30/183 (16%)

Query  217  KHLQQPNSDNESSENQATLRLRDATQNNARLMKPIENLDTFLQLANILTILLCGIAIALT  276
            K   Q  +DN  +E+  + ++ +  +  A + K    + T +     +++L+ GI +   
Sbjct  236  KEAAQLVNDNHGTED--SYQVMNMEEIAAGIGKVTAIMTTIIGSIAGISLLVGGIGVMNI  293

Query  277  SQRYVQQNQDHIALIRCLGASKWQILRAYIGLLSIVSLISIGTGTLIGIGLGYGLLQLML  336
                V +    I + + LGA++ QIL  ++    I S++    G L+GIG+GYG      
Sbjct  294  MLVSVTERTREIGIRKSLGATRGQILTQFL----IESVVLTLIGGLVGIGIGYG------  343

Query  337  QLMPQLNIGFSAMHLIAGPLPIAIFTSVV---VLFGFILPSVWELL------NTPPIRVI  387
                    G + +  IAG  P  I   VV   VLF  ++  ++ +L         PI  +
Sbjct  344  --------GAALVSAIAG-WPSLISWQVVCGGVLFSMLIGVIFGMLPANKAAKLDPIEAL  394

Query  388  RQE  390
            R E
Sbjct  395  RYE  397


 Score = 24.6 bits (52),  Expect = 0.058
 Identities = 8/19 (42%), Positives = 16/19 (84%), Gaps = 0/19 (0%)

Query  696  IITILAVLVGVSGVLVLIA  714
            I+T+L +++GV  V+V++A
Sbjct  22   ILTMLGIIIGVGSVIVVVA  40


 Score = 18.1 bits (35),  Expect = 6.2
 Identities = 6/20 (30%), Positives = 14/20 (70%), Gaps = 0/20 (0%)

Query  301  ILRAYIGLLSIVSLISIGTG  320
            +L   IG+ S++ ++++G G
Sbjct  25   MLGIIIGVGSVIVVVAVGQG  44


 Score = 18.1 bits (35),  Expect = 6.2
 Identities = 9/31 (29%), Positives = 15/31 (48%), Gaps = 0/31 (0%)

Query  224  SDNESSENQATLRLRDATQNNARLMKPIENL  254
            SD E + N         T+N+ + +K IE +
Sbjct  67   SDEELASNPNAAAESTFTENDIKGLKGIEGI  97


> O35005 ABC transporter permease YtrF [Bacillus subtilis (strain 
168)]
Length=436

 Score = 42.7 bits (99),  Expect = 1e-07
 Identities = 47/229 (21%), Positives = 93/229 (41%), Gaps = 28/229 (12%)

Query  563  LTQAQSFPEDNQIITGITR--FNQVNQVSV---ESKLAQELGIKIGDQLTFQLPEGPLSA  617
            + +A+  PED +   G T+   N+  ++SV   +SK       K  D     + + P   
Sbjct  161  IEEAKGNPEDIKEPKGYTKDILNKTIELSVSKTDSKTGDVTKTKTYDFKIVGITKKPSQD  220

Query  618  RVVNLRTVEWESFSPNF--FFIFSPSTMDENAGSYLGSFYVPLQDKTKLIAVIQQFSNTV  675
             + +      + F  +F  F  F    ++ N G +   F             ++Q +N +
Sbjct  221  WMEDSNIFISDQFKKDFSEFLDFKGGNVETNIGVFADKF-----------ENVEQLTNDL  269

Query  676  FIDVSLILDEVKRLVGVLVQIITILAVLVGVSGVLVLIACLNLL------MDERRREVAL  729
              D   +      L G     +     L+ V  + V+I+ + +       + ER +E+ +
Sbjct  270  TDDGYYVTSVTTELEGANTFFMVFKIGLIFVGCIAVIISAIGIFNTMTMAVTERTQEIGI  329

Query  730  LRSFGISKRKLKNMLMFEVGLIGLLSGVVACLFAEVISAIASYKMNIAI  778
            +++ G S   ++ M + E   IG+L     C+   +IS   SY +N+A+
Sbjct  330  MKAIGASPSIIRRMFLMESAYIGILG----CVIGIIISYGVSYLVNLAV  374


 Score = 32.7 bits (73),  Expect = 2e-04
 Identities = 32/132 (24%), Positives = 54/132 (41%), Gaps = 23/132 (17%)

Query  224  SDNESSENQATLRLRDATQNNARLMKPIENLDTFLQLANI-------LTILLCGIAIALT  276
            +D   +  Q T  L D       +   +E  +TF  +  I       + +++  I I  T
Sbjct  256  ADKFENVEQLTNDLTDDGYYVTSVTTELEGANTFFMVFKIGLIFVGCIAVIISAIGIFNT  315

Query  277  SQRYVQQNQDHIALIRCLGASKWQILR------AYIGLLSIVSLISIGTGTLIGIGLGYG  330
                V +    I +++ +GAS   I R      AYIG+L          G +IGI + YG
Sbjct  316  MTMAVTERTQEIGIMKAIGASPSIIRRMFLMESAYIGIL----------GCVIGIIISYG  365

Query  331  LLQLMLQLMPQL  342
            +  L+   +P +
Sbjct  366  VSYLVNLAVPMI  377


> Q9PEF2 Lipoprotein-releasing system transmembrane protein LolC 
[Xylella fastidiosa (strain 9a5c)]
Length=413

 Score = 38.1 bits (87),  Expect = 4e-06
 Identities = 19/66 (29%), Positives = 40/66 (61%), Gaps = 3/66 (5%)

Query  696  IITILAVLVGVSGVLVLIACLNLLMDERRREVALLRSFGISKRKLKNMLMFE---VGLIG  752
            ++ IL  L+   G   L++   +L+ +++ ++A+LR+ G+S   +  + M +   +G+IG
Sbjct  270  VMGILLSLIIAMGAFNLVSSQVMLVTDKQADIAILRTLGLSPAGVMRVFMVQGSLIGIIG  329

Query  753  LLSGVV  758
             LSGV+
Sbjct  330  TLSGVI  335


> Q87EF5 Lipoprotein-releasing system transmembrane protein LolC 
[Xylella fastidiosa (strain Temecula1 / ATCC 700964)]
Length=413

 Score = 38.1 bits (87),  Expect = 4e-06
 Identities = 19/66 (29%), Positives = 40/66 (61%), Gaps = 3/66 (5%)

Query  696  IITILAVLVGVSGVLVLIACLNLLMDERRREVALLRSFGISKRKLKNMLMFE---VGLIG  752
            ++ IL  L+   G   L++   +L+ +++ ++A+LR+ G+S   +  + M +   +G+IG
Sbjct  270  VMGILLSLIIAMGAFNLVSSQVMLVTDKQADIAILRTLGLSPAGVMRVFMVQGSLIGIIG  329

Query  753  LLSGVV  758
             LSGV+
Sbjct  330  TLSGVI  335



Lambda      K        H        a         alpha
   0.324    0.138    0.394    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1718950


  Database: 2511435b4192cac7ab88f36604d09999.SwissProt.fasta
    Posted date:  Sep 18, 2020  3:01 PM
  Number of letters in database: 2,463
  Number of sequences in database:  5



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40