ACIAD0982 / TrEMBL Alignments

BLASTP 2.2.28+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: 7a2dfc78e4ab9fc56ef11203d64e9d63.TrEMBL.fasta
           26 sequences; 11,725 total letters



Query= ACIAD0982

Length=449
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  O24842 VanK [Acinetobacter baylyi (strain ATCC 33305 / BD413 / ...   866    0.0   
  A0A009H0K3 Sugar (And other) transporter family protein [Acinet...   767    0.0   
  A0A0J1A2D4 Transporter, major facilitator family protein [Acine...   767    0.0   
  A0A0D5YKL4 MFS transporter [Acinetobacter baumannii]                 767    0.0   
  N9HWS6 MFS domain-containing protein [Acinetobacter baumannii N...   766    0.0   
  A0A009S7K2 Sugar (And other) transporter family protein [Acinet...   766    0.0   
  A0A062FAM5 Sugar (And other) transporter family protein [Acinet...   766    0.0   
  A0A0N8Y586 MFS transporter [Acinetobacter baumannii]                 766    0.0   
  S3TC26 MFS domain-containing protein [Acinetobacter baumannii N...   764    0.0   
  A0A241ZI54 MFS transporter [Acinetobacter baumannii]                 764    0.0   
  N9J9A4 MFS domain-containing protein [Acinetobacter baumannii N...   764    0.0   
  A0A158LS67 MFS domain-containing protein [Acinetobacter baumann...   764    0.0   
  A0A171EV13 Transporter, major facilitator family protein [Acine...   764    0.0   
  A0A0M3FUR4 4-hydroxybenzoate transporter PcaK [Acinetobacter ba...   764    0.0   
  A0A1Y5NSF8 MFS superfamily vanillate transporter [Acinetobacter...   763    0.0   
  A0A2L1VI88 MFS transporter [Acinetobacter nosocomialis]              763    0.0   
  A0A204EYG5 MFS transporter [Acinetobacter baumannii]                 763    0.0   
  Q2KQ80 IvaK [Comamonas testosteroni]                                 462    2e-162
  O05147 Putative 3-(3-hydroxyphenyl) propionate transport protei...   297    4e-98 
  A0A2H4ZC34 DsmF [Rhizorhabdus dicambivorans]                         228    2e-71 
  A0A291HHA7 4-hydroxybenzoate transporter [Acidovorax sp]             216    6e-67 
  D1MW95 4-hydroxybenzoate transporter [Comamonas sp. E6]              212    1e-65 
  Q93PT0 4-hydroxybenzoate transporter [Comamonas testosteroni]        210    1e-64 
  Q9AQI2 Putative transporter [Pseudomonas straminea]                  209    3e-64 
  B2BEM2 Benzoate transport protein [Acinetobacter calcoaceticus]      206    2e-63 
  Q9L7Y1 Benzoate transport protein [Pseudomonas putida]               202    7e-62 


> O24842 VanK [Acinetobacter baylyi (strain ATCC 33305 / BD413 
/ ADP1)]
Length=448

 Score =  866 bits (2237),  Expect = 0.0
 Identities = 448/448 (100%), Positives = 448/448 (100%), Gaps = 0/448 (0%)

Query  1    MQRDILSEINQNNMSRYQWFVIVVCVCLNIIDGFDVMVMAFTAPSVSAEWSLSGAQIGLL  60
            MQRDILSEINQNNMSRYQWFVIVVCVCLNIIDGFDVMVMAFTAPSVSAEWSLSGAQIGLL
Sbjct  1    MQRDILSEINQNNMSRYQWFVIVVCVCLNIIDGFDVMVMAFTAPSVSAEWSLSGAQIGLL  60

Query  61   LSAGLFGMAAGSIFLAPLADKIGRRLLILICLAIAGISMLACGLVHSHSMLAALRFVTGI  120
            LSAGLFGMAAGSIFLAPLADKIGRRLLILICLAIAGISMLACGLVHSHSMLAALRFVTGI
Sbjct  61   LSAGLFGMAAGSIFLAPLADKIGRRLLILICLAIAGISMLACGLVHSHSMLAALRFVTGI  120

Query  121  GVGGILASSNVLASEYANLRWRSLAVSLMSTGYGIGATLGGILSLLLIEHLGWRSIFLAG  180
            GVGGILASSNVLASEYANLRWRSLAVSLMSTGYGIGATLGGILSLLLIEHLGWRSIFLAG
Sbjct  121  GVGGILASSNVLASEYANLRWRSLAVSLMSTGYGIGATLGGILSLLLIEHLGWRSIFLAG  180

Query  181  GVTTVVMLLVSLWLLPESLDYLLAKKPKQALEKINLTVQRIGLVRLNALPQHEKNTQQHS  240
            GVTTVVMLLVSLWLLPESLDYLLAKKPKQALEKINLTVQRIGLVRLNALPQHEKNTQQHS
Sbjct  181  GVTTVVMLLVSLWLLPESLDYLLAKKPKQALEKINLTVQRIGLVRLNALPQHEKNTQQHS  240

Query  241  SDIAKLFQGKQGFQTLCLWFAFFLVMFGFYFVMSWTPKILIAMGMSPSQGVTTGILISIG  300
            SDIAKLFQGKQGFQTLCLWFAFFLVMFGFYFVMSWTPKILIAMGMSPSQGVTTGILISIG
Sbjct  241  SDIAKLFQGKQGFQTLCLWFAFFLVMFGFYFVMSWTPKILIAMGMSPSQGVTTGILISIG  300

Query  301  GVFGAAIIGLLASRIKIFHALSLFLGLTAVCVWLFVAVSSQVSIALMVGLLLGTLINGCV  360
            GVFGAAIIGLLASRIKIFHALSLFLGLTAVCVWLFVAVSSQVSIALMVGLLLGTLINGCV
Sbjct  301  GVFGAAIIGLLASRIKIFHALSLFLGLTAVCVWLFVAVSSQVSIALMVGLLLGTLINGCV  360

Query  361  AGLYSISPTIYDADIRSRGVGYAIGFGRIGAILSPTVAGIFLDKGLAPSTLYAYYGIVFI  420
            AGLYSISPTIYDADIRSRGVGYAIGFGRIGAILSPTVAGIFLDKGLAPSTLYAYYGIVFI
Sbjct  361  AGLYSISPTIYDADIRSRGVGYAIGFGRIGAILSPTVAGIFLDKGLAPSTLYAYYGIVFI  420

Query  421  LAIFLILSLSKAFYRQKEGLGSSIKTVA  448
            LAIFLILSLSKAFYRQKEGLGSSIKTVA
Sbjct  421  LAIFLILSLSKAFYRQKEGLGSSIKTVA  448


> A0A009H0K3 Sugar (And other) transporter family protein [Acinetobacter 
baumannii 118362]
Length=448

 Score =  767 bits (1981),  Expect = 0.0
 Identities = 383/446 (86%), Positives = 418/446 (94%), Gaps = 0/446 (0%)

Query  1    MQRDILSEINQNNMSRYQWFVIVVCVCLNIIDGFDVMVMAFTAPSVSAEWSLSGAQIGLL  60
            M+RD+LSEIN NNMSRYQWF+I++C+CLNIIDGFDVMVMAFTAPSVSAEWSLSGAQIGLL
Sbjct  1    MERDVLSEINHNNMSRYQWFIILICICLNIIDGFDVMVMAFTAPSVSAEWSLSGAQIGLL  60

Query  61   LSAGLFGMAAGSIFLAPLADKIGRRLLILICLAIAGISMLACGLVHSHSMLAALRFVTGI  120
            LS+GLFGMAAGSIFLAPLADKIGRRLLIL+CL IAG+SML C LV SH MLAALRF+TGI
Sbjct  61   LSSGLFGMAAGSIFLAPLADKIGRRLLILVCLVIAGLSMLGCALVQSHGMLAALRFITGI  120

Query  121  GVGGILASSNVLASEYANLRWRSLAVSLMSTGYGIGATLGGILSLLLIEHLGWRSIFLAG  180
            GVGGILASSNVLASEYAN RWRSLAVSLMSTGYGIGATLGG+LSL LIEHLGWRSIFLAG
Sbjct  121  GVGGILASSNVLASEYANARWRSLAVSLMSTGYGIGATLGGVLSLALIEHLGWRSIFLAG  180

Query  181  GVTTVVMLLVSLWLLPESLDYLLAKKPKQALEKINLTVQRIGLVRLNALPQHEKNTQQHS  240
            G+TT+VMLL+S WLLPESLDYLLAK+PKQALE+IN TV R+GL  L ALP + KN Q+++
Sbjct  181  GITTIVMLLISAWLLPESLDYLLAKRPKQALERINATVNRMGLTALKALPYYGKNNQKNT  240

Query  241  SDIAKLFQGKQGFQTLCLWFAFFLVMFGFYFVMSWTPKILIAMGMSPSQGVTTGILISIG  300
             DI KLF G+QGFQTLCLWFAFFLVMFGFYFVMSWTPKILI+MGMSP QGV+TGILISIG
Sbjct  241  GDIGKLFSGQQGFQTLCLWFAFFLVMFGFYFVMSWTPKILISMGMSPEQGVSTGILISIG  300

Query  301  GVFGAAIIGLLASRIKIFHALSLFLGLTAVCVWLFVAVSSQVSIALMVGLLLGTLINGCV  360
            G+FGAAIIGLLASR+KIF+ALSLFLGLTAVCV+LFVAVSSQVSIAL+VGLLLGTLINGCV
Sbjct  301  GIFGAAIIGLLASRMKIFYALSLFLGLTAVCVFLFVAVSSQVSIALIVGLLLGTLINGCV  360

Query  361  AGLYSISPTIYDADIRSRGVGYAIGFGRIGAILSPTVAGIFLDKGLAPSTLYAYYGIVFI  420
            AGLYSISPTIYDA+IRSRGVGYAIGFGRIGAILSPTVAGIFLDKG+AP+TLYAYYG+VFI
Sbjct  361  AGLYSISPTIYDAEIRSRGVGYAIGFGRIGAILSPTVAGIFLDKGIAPATLYAYYGVVFI  420

Query  421  LAIFLILSLSKAFYRQKEGLGSSIKT  446
            LAIFLILSL  AFYR K+    S+KT
Sbjct  421  LAIFLILSLGSAFYRSKKEQNFSLKT  446


> A0A0J1A2D4 Transporter, major facilitator family protein [Acinetobacter 
baumannii MRSN 3527]
Length=448

 Score =  767 bits (1980),  Expect = 0.0
 Identities = 383/446 (86%), Positives = 419/446 (94%), Gaps = 0/446 (0%)

Query  1    MQRDILSEINQNNMSRYQWFVIVVCVCLNIIDGFDVMVMAFTAPSVSAEWSLSGAQIGLL  60
            M+RD+LSEIN NNMSRYQWFVI++C+CLNIIDGFDVMVMAFTAPSVSAEWSLSGAQIGLL
Sbjct  1    MERDVLSEINHNNMSRYQWFVILICICLNIIDGFDVMVMAFTAPSVSAEWSLSGAQIGLL  60

Query  61   LSAGLFGMAAGSIFLAPLADKIGRRLLILICLAIAGISMLACGLVHSHSMLAALRFVTGI  120
            LS+GLFGMAAGSIFLAPLADKIGRRLLIL+CL IAG+SML C LV SH MLAALRF+TGI
Sbjct  61   LSSGLFGMAAGSIFLAPLADKIGRRLLILVCLVIAGLSMLGCALVQSHGMLAALRFITGI  120

Query  121  GVGGILASSNVLASEYANLRWRSLAVSLMSTGYGIGATLGGILSLLLIEHLGWRSIFLAG  180
            GVGGILASSNVLASEYAN+RWRSLAVSLMSTGYGIGATLGG+LSL LIEHLGWRSIFLAG
Sbjct  121  GVGGILASSNVLASEYANVRWRSLAVSLMSTGYGIGATLGGVLSLALIEHLGWRSIFLAG  180

Query  181  GVTTVVMLLVSLWLLPESLDYLLAKKPKQALEKINLTVQRIGLVRLNALPQHEKNTQQHS  240
            G+TT+VMLL+S WLLPESLDYLLAK+PKQAL++IN TV R+GL  L ALP + KN Q+++
Sbjct  181  GITTIVMLLISAWLLPESLDYLLAKRPKQALKRINTTVNRMGLTALKALPYYGKNNQKNT  240

Query  241  SDIAKLFQGKQGFQTLCLWFAFFLVMFGFYFVMSWTPKILIAMGMSPSQGVTTGILISIG  300
             DI KLF G+QGFQTLCLWFAFFLVMFGFYFVMSWTPKILI+MGMSP QGV+TGILISIG
Sbjct  241  GDIGKLFSGQQGFQTLCLWFAFFLVMFGFYFVMSWTPKILISMGMSPEQGVSTGILISIG  300

Query  301  GVFGAAIIGLLASRIKIFHALSLFLGLTAVCVWLFVAVSSQVSIALMVGLLLGTLINGCV  360
            G+FGAAIIGLLASR+KIF+ALSLFLGLTAVCV+LFVAVSSQVSIAL+VGLLLGTLINGCV
Sbjct  301  GIFGAAIIGLLASRMKIFYALSLFLGLTAVCVFLFVAVSSQVSIALIVGLLLGTLINGCV  360

Query  361  AGLYSISPTIYDADIRSRGVGYAIGFGRIGAILSPTVAGIFLDKGLAPSTLYAYYGIVFI  420
            AGLYSISPTIYDA+IRSRGVGYAIGFGRIGAILSPTVAGIFLDKG+AP+TLYAYYG+VFI
Sbjct  361  AGLYSISPTIYDAEIRSRGVGYAIGFGRIGAILSPTVAGIFLDKGIAPATLYAYYGVVFI  420

Query  421  LAIFLILSLSKAFYRQKEGLGSSIKT  446
            LAIFLILSL  AFYR K+    S+KT
Sbjct  421  LAIFLILSLGNAFYRSKKEQNFSLKT  446


> A0A0D5YKL4 MFS transporter [Acinetobacter baumannii]
Length=448

 Score =  767 bits (1980),  Expect = 0.0
 Identities = 383/446 (86%), Positives = 419/446 (94%), Gaps = 0/446 (0%)

Query  1    MQRDILSEINQNNMSRYQWFVIVVCVCLNIIDGFDVMVMAFTAPSVSAEWSLSGAQIGLL  60
            M+RD+LSEIN NNMSRYQWFVI++C+CLNIIDGFDVMVMAFTAPSVSAEWSLSGAQIGLL
Sbjct  1    MERDVLSEINHNNMSRYQWFVILICICLNIIDGFDVMVMAFTAPSVSAEWSLSGAQIGLL  60

Query  61   LSAGLFGMAAGSIFLAPLADKIGRRLLILICLAIAGISMLACGLVHSHSMLAALRFVTGI  120
            LS+GLFGMAAGSIFLAPLADKIGRRLLIL+CL IAG+SML C LV SH MLAALRF+TGI
Sbjct  61   LSSGLFGMAAGSIFLAPLADKIGRRLLILVCLVIAGLSMLGCALVQSHGMLAALRFITGI  120

Query  121  GVGGILASSNVLASEYANLRWRSLAVSLMSTGYGIGATLGGILSLLLIEHLGWRSIFLAG  180
            GVGGILASSNVLASEYAN+RWRSLAVSLMSTGYGIGATLGG+LSL LIEHLGWRSIFLAG
Sbjct  121  GVGGILASSNVLASEYANVRWRSLAVSLMSTGYGIGATLGGVLSLALIEHLGWRSIFLAG  180

Query  181  GVTTVVMLLVSLWLLPESLDYLLAKKPKQALEKINLTVQRIGLVRLNALPQHEKNTQQHS  240
            G+TT+VMLL+S WLLPESLDYLLAK+PKQAL++IN TV R+GL  L ALP + KN Q+++
Sbjct  181  GITTIVMLLISAWLLPESLDYLLAKRPKQALKRINTTVNRMGLTALKALPYYGKNNQKNT  240

Query  241  SDIAKLFQGKQGFQTLCLWFAFFLVMFGFYFVMSWTPKILIAMGMSPSQGVTTGILISIG  300
             DI KLF G+QGFQTLCLWFAFFLVMFGFYFVMSWTPKILI+MGMSP QGV+TGILISIG
Sbjct  241  GDIGKLFSGQQGFQTLCLWFAFFLVMFGFYFVMSWTPKILISMGMSPEQGVSTGILISIG  300

Query  301  GVFGAAIIGLLASRIKIFHALSLFLGLTAVCVWLFVAVSSQVSIALMVGLLLGTLINGCV  360
            G+FGAAIIGLLASR+KIF+ALSLFLGLTAVCV+LFVAVSSQVSIAL+VGLLLGTLINGCV
Sbjct  301  GIFGAAIIGLLASRMKIFYALSLFLGLTAVCVFLFVAVSSQVSIALIVGLLLGTLINGCV  360

Query  361  AGLYSISPTIYDADIRSRGVGYAIGFGRIGAILSPTVAGIFLDKGLAPSTLYAYYGIVFI  420
            AGLYSISPTIYDA+IRSRGVGYAIGFGRIGAILSPTVAGIFLDKG+AP+TLYAYYG+VFI
Sbjct  361  AGLYSISPTIYDAEIRSRGVGYAIGFGRIGAILSPTVAGIFLDKGIAPATLYAYYGVVFI  420

Query  421  LAIFLILSLSKAFYRQKEGLGSSIKT  446
            LAIFLILSL  AFYR K+    S+KT
Sbjct  421  LAIFLILSLGNAFYRSKKEQNFSLKT  446


> N9HWS6 MFS domain-containing protein [Acinetobacter baumannii 
NIPH 201]
Length=448

 Score =  766 bits (1978),  Expect = 0.0
 Identities = 382/446 (86%), Positives = 418/446 (94%), Gaps = 0/446 (0%)

Query  1    MQRDILSEINQNNMSRYQWFVIVVCVCLNIIDGFDVMVMAFTAPSVSAEWSLSGAQIGLL  60
            M+RD+LSEIN NNMSRYQWF+I++C+CLNIIDGFDVMVMAFTAPSVSAEWSLSGAQIGLL
Sbjct  1    MERDVLSEINHNNMSRYQWFIILICICLNIIDGFDVMVMAFTAPSVSAEWSLSGAQIGLL  60

Query  61   LSAGLFGMAAGSIFLAPLADKIGRRLLILICLAIAGISMLACGLVHSHSMLAALRFVTGI  120
            LS+GLFGMAAGSIFLAPLADKIGRRLLIL+CL IAG+SML C LV SH MLAALRF+TGI
Sbjct  61   LSSGLFGMAAGSIFLAPLADKIGRRLLILVCLVIAGLSMLGCALVQSHGMLAALRFITGI  120

Query  121  GVGGILASSNVLASEYANLRWRSLAVSLMSTGYGIGATLGGILSLLLIEHLGWRSIFLAG  180
            GVGGILASSNVLASEYAN RWRSLAVSLMSTGYGIGATLGG+LSL LIEHLGWRSIFLAG
Sbjct  121  GVGGILASSNVLASEYANARWRSLAVSLMSTGYGIGATLGGVLSLALIEHLGWRSIFLAG  180

Query  181  GVTTVVMLLVSLWLLPESLDYLLAKKPKQALEKINLTVQRIGLVRLNALPQHEKNTQQHS  240
            G+TT+VMLL+S WLLPESLDYLLAK+PKQALE+IN TV R+GL  L ALP + KN Q+++
Sbjct  181  GITTIVMLLISAWLLPESLDYLLAKRPKQALERINATVNRMGLTALKALPYYGKNNQKNT  240

Query  241  SDIAKLFQGKQGFQTLCLWFAFFLVMFGFYFVMSWTPKILIAMGMSPSQGVTTGILISIG  300
             DI KLF G+QGFQTLCLWFAFFLVMFGFYFVMSWTPKILI+MGMSP QGV+TGILISIG
Sbjct  241  GDIGKLFSGQQGFQTLCLWFAFFLVMFGFYFVMSWTPKILISMGMSPEQGVSTGILISIG  300

Query  301  GVFGAAIIGLLASRIKIFHALSLFLGLTAVCVWLFVAVSSQVSIALMVGLLLGTLINGCV  360
            G+FGAAIIGLLASR+KIF+ALSLFLGLT+VCV+LFVAVSSQVSIAL+VGLLLGTLINGCV
Sbjct  301  GIFGAAIIGLLASRMKIFYALSLFLGLTSVCVFLFVAVSSQVSIALIVGLLLGTLINGCV  360

Query  361  AGLYSISPTIYDADIRSRGVGYAIGFGRIGAILSPTVAGIFLDKGLAPSTLYAYYGIVFI  420
            AGLYSISPTIYDA+IRSRGVGYAIGFGRIGAILSPTVAGIFLDKG+AP+TLYAYYG+VFI
Sbjct  361  AGLYSISPTIYDAEIRSRGVGYAIGFGRIGAILSPTVAGIFLDKGIAPATLYAYYGVVFI  420

Query  421  LAIFLILSLSKAFYRQKEGLGSSIKT  446
            LAIFLILSL  AFYR K+    S+KT
Sbjct  421  LAIFLILSLGSAFYRSKKEQNFSLKT  446


> A0A009S7K2 Sugar (And other) transporter family protein [Acinetobacter 
baumannii 951631]
Length=448

 Score =  766 bits (1977),  Expect = 0.0
 Identities = 382/446 (86%), Positives = 418/446 (94%), Gaps = 0/446 (0%)

Query  1    MQRDILSEINQNNMSRYQWFVIVVCVCLNIIDGFDVMVMAFTAPSVSAEWSLSGAQIGLL  60
            M+RD+LSEIN NNMSRYQWF+I++C+CLNIIDGFDVMVMAFTAPSVSAEWSLSGAQIGLL
Sbjct  1    MERDVLSEINHNNMSRYQWFIILICICLNIIDGFDVMVMAFTAPSVSAEWSLSGAQIGLL  60

Query  61   LSAGLFGMAAGSIFLAPLADKIGRRLLILICLAIAGISMLACGLVHSHSMLAALRFVTGI  120
            LS+GLFGMAAGSIFLAPLADKIGRRLLIL+CL IAG+SML C LV SH MLAALRF+TGI
Sbjct  61   LSSGLFGMAAGSIFLAPLADKIGRRLLILVCLVIAGLSMLGCALVQSHGMLAALRFITGI  120

Query  121  GVGGILASSNVLASEYANLRWRSLAVSLMSTGYGIGATLGGILSLLLIEHLGWRSIFLAG  180
            GVGGILASSNVLASEYAN RWRSLAVSLMSTGYGIGATLGG+LSL LIEHLGWRSIFLAG
Sbjct  121  GVGGILASSNVLASEYANARWRSLAVSLMSTGYGIGATLGGVLSLALIEHLGWRSIFLAG  180

Query  181  GVTTVVMLLVSLWLLPESLDYLLAKKPKQALEKINLTVQRIGLVRLNALPQHEKNTQQHS  240
            G+TT+VMLL+S WLLPESLDYLLAK+PKQALE+IN+TV R+GL  L ALP + +N Q+++
Sbjct  181  GITTIVMLLISAWLLPESLDYLLAKRPKQALERINVTVNRMGLTALKALPYYGQNNQKNT  240

Query  241  SDIAKLFQGKQGFQTLCLWFAFFLVMFGFYFVMSWTPKILIAMGMSPSQGVTTGILISIG  300
             DI KLF G+QGFQTLCLWFAFFLVMFGFYFVMSWTPKILI+MGMSP QGV+TGILISIG
Sbjct  241  GDIGKLFSGQQGFQTLCLWFAFFLVMFGFYFVMSWTPKILISMGMSPEQGVSTGILISIG  300

Query  301  GVFGAAIIGLLASRIKIFHALSLFLGLTAVCVWLFVAVSSQVSIALMVGLLLGTLINGCV  360
            G+FGAAIIGLLASR+KIF+ALSLFLGLTAVCV+LFVAVSSQVSIAL VGLLLGTLINGCV
Sbjct  301  GIFGAAIIGLLASRMKIFYALSLFLGLTAVCVFLFVAVSSQVSIALTVGLLLGTLINGCV  360

Query  361  AGLYSISPTIYDADIRSRGVGYAIGFGRIGAILSPTVAGIFLDKGLAPSTLYAYYGIVFI  420
            AGLYSISPTIYDA+IRSRGVGYAIGFGRIGAILSPTVAGIFLDKG+AP+TLYAYYG+VFI
Sbjct  361  AGLYSISPTIYDAEIRSRGVGYAIGFGRIGAILSPTVAGIFLDKGIAPATLYAYYGVVFI  420

Query  421  LAIFLILSLSKAFYRQKEGLGSSIKT  446
            LAIFLILSL  AFYR K+    S+KT
Sbjct  421  LAIFLILSLGNAFYRSKKEQNFSLKT  446


> A0A062FAM5 Sugar (And other) transporter family protein [Acinetobacter 
baumannii 754286]
Length=448

 Score =  766 bits (1977),  Expect = 0.0
 Identities = 382/446 (86%), Positives = 418/446 (94%), Gaps = 0/446 (0%)

Query  1    MQRDILSEINQNNMSRYQWFVIVVCVCLNIIDGFDVMVMAFTAPSVSAEWSLSGAQIGLL  60
            M+RD+LSEIN NNMSRYQWF+I++C+CLNIIDGFDVMVMAFTAPSVSAEWSLSGAQIGLL
Sbjct  1    MERDVLSEINHNNMSRYQWFIILICICLNIIDGFDVMVMAFTAPSVSAEWSLSGAQIGLL  60

Query  61   LSAGLFGMAAGSIFLAPLADKIGRRLLILICLAIAGISMLACGLVHSHSMLAALRFVTGI  120
            LS+GLFGMAAGSIFLAPLADKIGRRLLIL+CL IAG+SML C LV SH MLAALRF+TGI
Sbjct  61   LSSGLFGMAAGSIFLAPLADKIGRRLLILVCLVIAGLSMLGCALVQSHGMLAALRFITGI  120

Query  121  GVGGILASSNVLASEYANLRWRSLAVSLMSTGYGIGATLGGILSLLLIEHLGWRSIFLAG  180
            GVGGILASSNVLASEYAN RWRSLAVSLMSTGYGIGATLGG+LSL LIEHLGWRSIFLAG
Sbjct  121  GVGGILASSNVLASEYANARWRSLAVSLMSTGYGIGATLGGVLSLALIEHLGWRSIFLAG  180

Query  181  GVTTVVMLLVSLWLLPESLDYLLAKKPKQALEKINLTVQRIGLVRLNALPQHEKNTQQHS  240
            G+TT+VMLL+S WLLPESLDYLLAK+PKQALE+IN+TV R+GL  L ALP + +N Q+++
Sbjct  181  GITTIVMLLISAWLLPESLDYLLAKRPKQALERINVTVNRMGLTALKALPYYGQNNQKNT  240

Query  241  SDIAKLFQGKQGFQTLCLWFAFFLVMFGFYFVMSWTPKILIAMGMSPSQGVTTGILISIG  300
             DI KLF G+QGFQTLCLWFAFFLVMFGFYFVMSWTPKILI+MGMSP QGV+TGILISIG
Sbjct  241  GDIGKLFSGQQGFQTLCLWFAFFLVMFGFYFVMSWTPKILISMGMSPEQGVSTGILISIG  300

Query  301  GVFGAAIIGLLASRIKIFHALSLFLGLTAVCVWLFVAVSSQVSIALMVGLLLGTLINGCV  360
            G+FGAAIIGLLASR+KIF+ALSLFLGLTAVCV+LFVAVSSQVSIAL VGLLLGTLINGCV
Sbjct  301  GIFGAAIIGLLASRMKIFYALSLFLGLTAVCVFLFVAVSSQVSIALTVGLLLGTLINGCV  360

Query  361  AGLYSISPTIYDADIRSRGVGYAIGFGRIGAILSPTVAGIFLDKGLAPSTLYAYYGIVFI  420
            AGLYSISPTIYDA+IRSRGVGYAIGFGRIGAILSPTVAGIFLDKG+AP+TLYAYYG+VFI
Sbjct  361  AGLYSISPTIYDAEIRSRGVGYAIGFGRIGAILSPTVAGIFLDKGIAPATLYAYYGVVFI  420

Query  421  LAIFLILSLSKAFYRQKEGLGSSIKT  446
            LAIFLILSL  AFYR K+    S+KT
Sbjct  421  LAIFLILSLGNAFYRSKKEQNFSLKT  446


> A0A0N8Y586 MFS transporter [Acinetobacter baumannii]
Length=448

 Score =  766 bits (1977),  Expect = 0.0
 Identities = 382/446 (86%), Positives = 418/446 (94%), Gaps = 0/446 (0%)

Query  1    MQRDILSEINQNNMSRYQWFVIVVCVCLNIIDGFDVMVMAFTAPSVSAEWSLSGAQIGLL  60
            M+RD+LSEIN NNMSRYQWF+I++C+CLNIIDGFDVMVMAFTAPSVSAEWSLSGAQIGLL
Sbjct  1    MERDVLSEINHNNMSRYQWFIILICICLNIIDGFDVMVMAFTAPSVSAEWSLSGAQIGLL  60

Query  61   LSAGLFGMAAGSIFLAPLADKIGRRLLILICLAIAGISMLACGLVHSHSMLAALRFVTGI  120
            LS+GLFGMAAGSIFLAPLADKIGRRLLIL+CL IAG+SML C LV SH MLAALRF+TGI
Sbjct  61   LSSGLFGMAAGSIFLAPLADKIGRRLLILVCLVIAGLSMLGCALVQSHGMLAALRFITGI  120

Query  121  GVGGILASSNVLASEYANLRWRSLAVSLMSTGYGIGATLGGILSLLLIEHLGWRSIFLAG  180
            GVGGILASSNVLASEYAN RWRSLAVSLMSTGYGIGATLGG+LSL LIEHLGWRSIFLAG
Sbjct  121  GVGGILASSNVLASEYANARWRSLAVSLMSTGYGIGATLGGVLSLALIEHLGWRSIFLAG  180

Query  181  GVTTVVMLLVSLWLLPESLDYLLAKKPKQALEKINLTVQRIGLVRLNALPQHEKNTQQHS  240
            G+TT+VMLL+S WLLPESLDYLLAK+PKQALE+IN TV R+GL  L ALP + +N Q+++
Sbjct  181  GITTIVMLLISAWLLPESLDYLLAKRPKQALERINATVNRMGLTALKALPYYGQNNQRNT  240

Query  241  SDIAKLFQGKQGFQTLCLWFAFFLVMFGFYFVMSWTPKILIAMGMSPSQGVTTGILISIG  300
             DI KLF G+QGFQTLCLWFAFFLVMFGFYFVMSWTPKILI+MGMSP QGV+TGILISIG
Sbjct  241  GDIGKLFSGQQGFQTLCLWFAFFLVMFGFYFVMSWTPKILISMGMSPEQGVSTGILISIG  300

Query  301  GVFGAAIIGLLASRIKIFHALSLFLGLTAVCVWLFVAVSSQVSIALMVGLLLGTLINGCV  360
            G+FGAAIIGLLASR+KIF+ALSLFLGLTAVCV+LFVAVSSQVSIAL+VGLLLGTLINGCV
Sbjct  301  GIFGAAIIGLLASRMKIFYALSLFLGLTAVCVFLFVAVSSQVSIALIVGLLLGTLINGCV  360

Query  361  AGLYSISPTIYDADIRSRGVGYAIGFGRIGAILSPTVAGIFLDKGLAPSTLYAYYGIVFI  420
            AGLYSISPTIYDA+IRSRGVGYAIGFGRIGAILSPTVAGIFLDKG+AP+TLYAYYG+VFI
Sbjct  361  AGLYSISPTIYDAEIRSRGVGYAIGFGRIGAILSPTVAGIFLDKGIAPATLYAYYGVVFI  420

Query  421  LAIFLILSLSKAFYRQKEGLGSSIKT  446
            LAIFLILSL  AFYR K+    S+KT
Sbjct  421  LAIFLILSLGSAFYRSKKEQNFSLKT  446


> S3TC26 MFS domain-containing protein [Acinetobacter baumannii 
NIPH 410]
Length=448

 Score =  764 bits (1974),  Expect = 0.0
 Identities = 381/446 (85%), Positives = 418/446 (94%), Gaps = 0/446 (0%)

Query  1    MQRDILSEINQNNMSRYQWFVIVVCVCLNIIDGFDVMVMAFTAPSVSAEWSLSGAQIGLL  60
            M+RD+LSEIN NNMSRYQWF+I++C+CLNIIDGFDVMVMAFTAPSVSAEWSLSGAQIGLL
Sbjct  1    MERDVLSEINHNNMSRYQWFIILICICLNIIDGFDVMVMAFTAPSVSAEWSLSGAQIGLL  60

Query  61   LSAGLFGMAAGSIFLAPLADKIGRRLLILICLAIAGISMLACGLVHSHSMLAALRFVTGI  120
            LS+GLFGMAAGSIFLAPLADKIGRRLLIL+CL IAG+SML C LV SH MLAALRF+TGI
Sbjct  61   LSSGLFGMAAGSIFLAPLADKIGRRLLILVCLVIAGLSMLGCALVQSHGMLAALRFITGI  120

Query  121  GVGGILASSNVLASEYANLRWRSLAVSLMSTGYGIGATLGGILSLLLIEHLGWRSIFLAG  180
            GVGGILASSNVLASEYAN RWRSLAVSLMSTGYGIGATLGG+LSL LIEHLGWRSIFLAG
Sbjct  121  GVGGILASSNVLASEYANARWRSLAVSLMSTGYGIGATLGGVLSLALIEHLGWRSIFLAG  180

Query  181  GVTTVVMLLVSLWLLPESLDYLLAKKPKQALEKINLTVQRIGLVRLNALPQHEKNTQQHS  240
            G+TT+VMLL+S WLLPESLDYLLAK+PKQALE+IN TV R+GL  L ALP + +N Q+++
Sbjct  181  GITTIVMLLISAWLLPESLDYLLAKRPKQALERINTTVNRMGLTALKALPYYGQNNQKNT  240

Query  241  SDIAKLFQGKQGFQTLCLWFAFFLVMFGFYFVMSWTPKILIAMGMSPSQGVTTGILISIG  300
             DI KLF G+QGFQTLCLWFAFFLVMFGFYFVMSWTPKILI+MGMSP QGV+TGILISIG
Sbjct  241  GDIGKLFSGQQGFQTLCLWFAFFLVMFGFYFVMSWTPKILISMGMSPEQGVSTGILISIG  300

Query  301  GVFGAAIIGLLASRIKIFHALSLFLGLTAVCVWLFVAVSSQVSIALMVGLLLGTLINGCV  360
            G+FGAAIIGLLASR+KIF+ALSLFLGLT+VCV+LFVAVSSQVSIAL+VGLLLGTLINGCV
Sbjct  301  GIFGAAIIGLLASRMKIFYALSLFLGLTSVCVFLFVAVSSQVSIALIVGLLLGTLINGCV  360

Query  361  AGLYSISPTIYDADIRSRGVGYAIGFGRIGAILSPTVAGIFLDKGLAPSTLYAYYGIVFI  420
            AGLYSISPTIYDA+IRSRGVGYAIGFGRIGAILSPTVAGIFLDKG+AP+TLYAYYG+VFI
Sbjct  361  AGLYSISPTIYDAEIRSRGVGYAIGFGRIGAILSPTVAGIFLDKGIAPATLYAYYGVVFI  420

Query  421  LAIFLILSLSKAFYRQKEGLGSSIKT  446
            LAIFLILSL  AFYR K+    S+KT
Sbjct  421  LAIFLILSLGSAFYRSKKEQNFSLKT  446


> A0A241ZI54 MFS transporter [Acinetobacter baumannii]
Length=448

 Score =  764 bits (1974),  Expect = 0.0
 Identities = 381/446 (85%), Positives = 418/446 (94%), Gaps = 0/446 (0%)

Query  1    MQRDILSEINQNNMSRYQWFVIVVCVCLNIIDGFDVMVMAFTAPSVSAEWSLSGAQIGLL  60
            M+RD+LSEIN NNMSRYQWF+I++C+CLNIIDGFDVMVMAFTAPSVSAEWSLSGAQIGLL
Sbjct  1    MERDVLSEINHNNMSRYQWFIILICICLNIIDGFDVMVMAFTAPSVSAEWSLSGAQIGLL  60

Query  61   LSAGLFGMAAGSIFLAPLADKIGRRLLILICLAIAGISMLACGLVHSHSMLAALRFVTGI  120
            LS+GLFGMAAGSIFLAPLADKIGRRLLIL+CL IAG+SML C LV SH MLAALRF+TGI
Sbjct  61   LSSGLFGMAAGSIFLAPLADKIGRRLLILVCLVIAGLSMLGCALVQSHGMLAALRFITGI  120

Query  121  GVGGILASSNVLASEYANLRWRSLAVSLMSTGYGIGATLGGILSLLLIEHLGWRSIFLAG  180
            GVGGILASSNVLASEYAN RWRSLAVSLMSTGYGIGATLGG+LSL LIEHLGWRSIFLAG
Sbjct  121  GVGGILASSNVLASEYANARWRSLAVSLMSTGYGIGATLGGVLSLALIEHLGWRSIFLAG  180

Query  181  GVTTVVMLLVSLWLLPESLDYLLAKKPKQALEKINLTVQRIGLVRLNALPQHEKNTQQHS  240
            G+TT+VMLL+S WLLPESLDYLLAK+PKQALE+IN TV R+GL  L ALP + +N Q+++
Sbjct  181  GITTIVMLLISAWLLPESLDYLLAKRPKQALERINTTVNRMGLTALKALPYYGQNNQKNT  240

Query  241  SDIAKLFQGKQGFQTLCLWFAFFLVMFGFYFVMSWTPKILIAMGMSPSQGVTTGILISIG  300
             DI KLF G+QGFQTLCLWFAFFLVMFGFYFVMSWTPKILI+MGMSP QGV+TGILISIG
Sbjct  241  GDIGKLFSGQQGFQTLCLWFAFFLVMFGFYFVMSWTPKILISMGMSPEQGVSTGILISIG  300

Query  301  GVFGAAIIGLLASRIKIFHALSLFLGLTAVCVWLFVAVSSQVSIALMVGLLLGTLINGCV  360
            G+FGAAIIGLLASR+KIF+ALSLFLGLT+VCV+LFVAVSSQVSIAL+VGLLLGTLINGCV
Sbjct  301  GIFGAAIIGLLASRMKIFYALSLFLGLTSVCVFLFVAVSSQVSIALIVGLLLGTLINGCV  360

Query  361  AGLYSISPTIYDADIRSRGVGYAIGFGRIGAILSPTVAGIFLDKGLAPSTLYAYYGIVFI  420
            AGLYSISPTIYDA+IRSRGVGYAIGFGRIGAILSPTVAGIFLDKG+AP+TLYAYYG+VFI
Sbjct  361  AGLYSISPTIYDAEIRSRGVGYAIGFGRIGAILSPTVAGIFLDKGIAPATLYAYYGVVFI  420

Query  421  LAIFLILSLSKAFYRQKEGLGSSIKT  446
            LAIFLILSL  AFYR K+    S+KT
Sbjct  421  LAIFLILSLGSAFYRSKKEQNFSLKT  446


> N9J9A4 MFS domain-containing protein [Acinetobacter baumannii 
NIPH 80]
Length=448

 Score =  764 bits (1974),  Expect = 0.0
 Identities = 381/446 (85%), Positives = 418/446 (94%), Gaps = 0/446 (0%)

Query  1    MQRDILSEINQNNMSRYQWFVIVVCVCLNIIDGFDVMVMAFTAPSVSAEWSLSGAQIGLL  60
            M+RD+LSEIN NNMSRYQWF+I++C+CLNIIDGFDVMVMAFTAPSVSAEWSLSGAQIGLL
Sbjct  1    MERDVLSEINHNNMSRYQWFIILICICLNIIDGFDVMVMAFTAPSVSAEWSLSGAQIGLL  60

Query  61   LSAGLFGMAAGSIFLAPLADKIGRRLLILICLAIAGISMLACGLVHSHSMLAALRFVTGI  120
            LS+GLFGMAAGSIFLAPLADKIGRRLLIL+CL IAG+SML C LV SH MLAALRF+TGI
Sbjct  61   LSSGLFGMAAGSIFLAPLADKIGRRLLILVCLVIAGLSMLGCALVQSHGMLAALRFITGI  120

Query  121  GVGGILASSNVLASEYANLRWRSLAVSLMSTGYGIGATLGGILSLLLIEHLGWRSIFLAG  180
            GVGGILASSNVLASEYAN RWRSLAVSLMSTGYGIGATLGG+LSL LIEHLGWRSIFLAG
Sbjct  121  GVGGILASSNVLASEYANARWRSLAVSLMSTGYGIGATLGGVLSLALIEHLGWRSIFLAG  180

Query  181  GVTTVVMLLVSLWLLPESLDYLLAKKPKQALEKINLTVQRIGLVRLNALPQHEKNTQQHS  240
            G+TT+VMLL+S WLLPESLDYLLAK+PKQALE+IN TV R+GL  L ALP + +N Q+++
Sbjct  181  GITTIVMLLISAWLLPESLDYLLAKRPKQALERINTTVNRMGLTALKALPYYGQNNQKNT  240

Query  241  SDIAKLFQGKQGFQTLCLWFAFFLVMFGFYFVMSWTPKILIAMGMSPSQGVTTGILISIG  300
             DI KLF G+QGFQTLCLWFAFFLVMFGFYFVMSWTPKILI+MGMSP QGV+TGILISIG
Sbjct  241  GDIGKLFSGQQGFQTLCLWFAFFLVMFGFYFVMSWTPKILISMGMSPEQGVSTGILISIG  300

Query  301  GVFGAAIIGLLASRIKIFHALSLFLGLTAVCVWLFVAVSSQVSIALMVGLLLGTLINGCV  360
            G+FGAAIIGLLASR+KIF+ALSLFLGLT+VCV+LFVAVSSQVSIAL+VGLLLGTLINGCV
Sbjct  301  GIFGAAIIGLLASRMKIFYALSLFLGLTSVCVFLFVAVSSQVSIALIVGLLLGTLINGCV  360

Query  361  AGLYSISPTIYDADIRSRGVGYAIGFGRIGAILSPTVAGIFLDKGLAPSTLYAYYGIVFI  420
            AGLYSISPTIYDA+IRSRGVGYAIGFGRIGAILSPTVAGIFLDKG+AP+TLYAYYG+VFI
Sbjct  361  AGLYSISPTIYDAEIRSRGVGYAIGFGRIGAILSPTVAGIFLDKGIAPATLYAYYGVVFI  420

Query  421  LAIFLILSLSKAFYRQKEGLGSSIKT  446
            LAIFLILSL  AFYR K+    S+KT
Sbjct  421  LAIFLILSLGSAFYRSKKEQNFSLKT  446


> A0A158LS67 MFS domain-containing protein [Acinetobacter baumannii 
NIPH 190]
Length=448

 Score =  764 bits (1974),  Expect = 0.0
 Identities = 383/446 (86%), Positives = 418/446 (94%), Gaps = 0/446 (0%)

Query  1    MQRDILSEINQNNMSRYQWFVIVVCVCLNIIDGFDVMVMAFTAPSVSAEWSLSGAQIGLL  60
            M+RD+LSEINQNNMSRYQWFVI++C+CLNIIDGFDVMVMAFTAPSVSAEWSLSGAQIGLL
Sbjct  1    MERDVLSEINQNNMSRYQWFVILICICLNIIDGFDVMVMAFTAPSVSAEWSLSGAQIGLL  60

Query  61   LSAGLFGMAAGSIFLAPLADKIGRRLLILICLAIAGISMLACGLVHSHSMLAALRFVTGI  120
            LSAGLFGMAAGSIFLAPLADKIGRRLLIL+CL IAG+SML C LV SH MLAALRF+TGI
Sbjct  61   LSAGLFGMAAGSIFLAPLADKIGRRLLILVCLVIAGLSMLGCALVQSHGMLAALRFITGI  120

Query  121  GVGGILASSNVLASEYANLRWRSLAVSLMSTGYGIGATLGGILSLLLIEHLGWRSIFLAG  180
            GVGGILASSNVLASEYAN RWRSLAVSLMSTGYGIGATLGG+LSL LIEHLGWRSIFLAG
Sbjct  121  GVGGILASSNVLASEYANARWRSLAVSLMSTGYGIGATLGGVLSLALIEHLGWRSIFLAG  180

Query  181  GVTTVVMLLVSLWLLPESLDYLLAKKPKQALEKINLTVQRIGLVRLNALPQHEKNTQQHS  240
            G+TT+VMLL+S WLLPESLDYLLAK+PKQALE+IN+TV R+GL  L ALP + +N Q+++
Sbjct  181  GITTIVMLLISAWLLPESLDYLLAKRPKQALERINVTVNRMGLTALKALPYYGQNNQKNT  240

Query  241  SDIAKLFQGKQGFQTLCLWFAFFLVMFGFYFVMSWTPKILIAMGMSPSQGVTTGILISIG  300
             DI KLF G+Q FQTLCLWFAFFLVMFGFYFVMSWTPKILI+MGMSP QGV+TGILISIG
Sbjct  241  GDIGKLFSGQQRFQTLCLWFAFFLVMFGFYFVMSWTPKILISMGMSPEQGVSTGILISIG  300

Query  301  GVFGAAIIGLLASRIKIFHALSLFLGLTAVCVWLFVAVSSQVSIALMVGLLLGTLINGCV  360
            G+FGAAIIGLLASR+KIF+ALSLFLGLTAVCV+LFVAVSSQVSIAL+VGLLLGTLINGCV
Sbjct  301  GIFGAAIIGLLASRMKIFYALSLFLGLTAVCVFLFVAVSSQVSIALIVGLLLGTLINGCV  360

Query  361  AGLYSISPTIYDADIRSRGVGYAIGFGRIGAILSPTVAGIFLDKGLAPSTLYAYYGIVFI  420
            AGLYSISPTIYDA+IRSRGVGYAIGFGRIGAILSPTVAGIFLDKG+AP+TLYAYYG+VFI
Sbjct  361  AGLYSISPTIYDAEIRSRGVGYAIGFGRIGAILSPTVAGIFLDKGIAPATLYAYYGVVFI  420

Query  421  LAIFLILSLSKAFYRQKEGLGSSIKT  446
            LAI LILSL  AFYR K+    S+KT
Sbjct  421  LAILLILSLGSAFYRSKKEQNYSLKT  446


> A0A171EV13 Transporter, major facilitator family protein [Acinetobacter 
baumannii Naval-82]
Length=448

 Score =  764 bits (1974),  Expect = 0.0
 Identities = 383/446 (86%), Positives = 418/446 (94%), Gaps = 0/446 (0%)

Query  1    MQRDILSEINQNNMSRYQWFVIVVCVCLNIIDGFDVMVMAFTAPSVSAEWSLSGAQIGLL  60
            M+RD+LSEINQNNMSRYQWFVI++C+CLNIIDGFDVMVMAFTAPSVSAEWSLSGAQIGLL
Sbjct  1    MERDVLSEINQNNMSRYQWFVILICICLNIIDGFDVMVMAFTAPSVSAEWSLSGAQIGLL  60

Query  61   LSAGLFGMAAGSIFLAPLADKIGRRLLILICLAIAGISMLACGLVHSHSMLAALRFVTGI  120
            LSAGLFGMAAGSIFLAPLADKIGRRLLIL+CL IAG+SML C LV SH MLAALRF+TGI
Sbjct  61   LSAGLFGMAAGSIFLAPLADKIGRRLLILVCLVIAGLSMLGCALVQSHGMLAALRFITGI  120

Query  121  GVGGILASSNVLASEYANLRWRSLAVSLMSTGYGIGATLGGILSLLLIEHLGWRSIFLAG  180
            GVGGILASSNVLASEYAN RWRSLAVSLMSTGYGIGATLGG+LSL LIEHLGWRSIFLAG
Sbjct  121  GVGGILASSNVLASEYANARWRSLAVSLMSTGYGIGATLGGVLSLALIEHLGWRSIFLAG  180

Query  181  GVTTVVMLLVSLWLLPESLDYLLAKKPKQALEKINLTVQRIGLVRLNALPQHEKNTQQHS  240
            G+TT+VMLL+S WLLPESLDYLLAK+PKQALE+IN+TV R+GL  L ALP + +N Q+++
Sbjct  181  GITTIVMLLISAWLLPESLDYLLAKRPKQALERINVTVNRMGLTALKALPYYGQNNQKNT  240

Query  241  SDIAKLFQGKQGFQTLCLWFAFFLVMFGFYFVMSWTPKILIAMGMSPSQGVTTGILISIG  300
             DI KLF G+Q FQTLCLWFAFFLVMFGFYFVMSWTPKILI+MGMSP QGV+TGILISIG
Sbjct  241  GDIGKLFSGQQRFQTLCLWFAFFLVMFGFYFVMSWTPKILISMGMSPEQGVSTGILISIG  300

Query  301  GVFGAAIIGLLASRIKIFHALSLFLGLTAVCVWLFVAVSSQVSIALMVGLLLGTLINGCV  360
            G+FGAAIIGLLASR+KIF+ALSLFLGLTAVCV+LFVAVSSQVSIAL+VGLLLGTLINGCV
Sbjct  301  GIFGAAIIGLLASRMKIFYALSLFLGLTAVCVFLFVAVSSQVSIALIVGLLLGTLINGCV  360

Query  361  AGLYSISPTIYDADIRSRGVGYAIGFGRIGAILSPTVAGIFLDKGLAPSTLYAYYGIVFI  420
            AGLYSISPTIYDA+IRSRGVGYAIGFGRIGAILSPTVAGIFLDKG+AP+TLYAYYG+VFI
Sbjct  361  AGLYSISPTIYDAEIRSRGVGYAIGFGRIGAILSPTVAGIFLDKGIAPATLYAYYGVVFI  420

Query  421  LAIFLILSLSKAFYRQKEGLGSSIKT  446
            LAI LILSL  AFYR K+    S+KT
Sbjct  421  LAILLILSLGSAFYRSKKEQNYSLKT  446


> A0A0M3FUR4 4-hydroxybenzoate transporter PcaK [Acinetobacter 
baumannii]
Length=448

 Score =  764 bits (1972),  Expect = 0.0
 Identities = 380/446 (85%), Positives = 418/446 (94%), Gaps = 0/446 (0%)

Query  1    MQRDILSEINQNNMSRYQWFVIVVCVCLNIIDGFDVMVMAFTAPSVSAEWSLSGAQIGLL  60
            M+RD+LSEIN NNMSRYQWF+I++C+CLNIIDGFDVMVMAFTAPSVSAEWSLSGAQIGLL
Sbjct  1    MERDVLSEINHNNMSRYQWFIILICICLNIIDGFDVMVMAFTAPSVSAEWSLSGAQIGLL  60

Query  61   LSAGLFGMAAGSIFLAPLADKIGRRLLILICLAIAGISMLACGLVHSHSMLAALRFVTGI  120
            LS+GLFGMAAGSIFLAPLADKIGRRLLIL+CL IAG+SML C LV SH MLAALRF+TGI
Sbjct  61   LSSGLFGMAAGSIFLAPLADKIGRRLLILVCLVIAGLSMLGCALVQSHGMLAALRFITGI  120

Query  121  GVGGILASSNVLASEYANLRWRSLAVSLMSTGYGIGATLGGILSLLLIEHLGWRSIFLAG  180
            GVGGILASSNVLASEYAN RWRSLAVSLMSTGYGIGATLGG+LSL LIEHLGWRSIF AG
Sbjct  121  GVGGILASSNVLASEYANARWRSLAVSLMSTGYGIGATLGGVLSLALIEHLGWRSIFFAG  180

Query  181  GVTTVVMLLVSLWLLPESLDYLLAKKPKQALEKINLTVQRIGLVRLNALPQHEKNTQQHS  240
            G+TT+VMLL+S+WLLPESLDYLLAK+PKQALE+IN TV R+GL  L ALP + +N Q+++
Sbjct  181  GITTIVMLLISVWLLPESLDYLLAKRPKQALERINTTVNRMGLTALKALPYYGQNNQKNT  240

Query  241  SDIAKLFQGKQGFQTLCLWFAFFLVMFGFYFVMSWTPKILIAMGMSPSQGVTTGILISIG  300
             DI KLF G+QGFQTLCLWFAFFLVMFGFYFVMSWTPKILI+MGMSP QGV+TGILISIG
Sbjct  241  GDIGKLFSGQQGFQTLCLWFAFFLVMFGFYFVMSWTPKILISMGMSPEQGVSTGILISIG  300

Query  301  GVFGAAIIGLLASRIKIFHALSLFLGLTAVCVWLFVAVSSQVSIALMVGLLLGTLINGCV  360
            G+FGAAIIGLLASR+KIF+ALSLFLGLT+VCV+LFVAVSSQVSIAL+VGLLLGTLINGCV
Sbjct  301  GIFGAAIIGLLASRMKIFYALSLFLGLTSVCVFLFVAVSSQVSIALIVGLLLGTLINGCV  360

Query  361  AGLYSISPTIYDADIRSRGVGYAIGFGRIGAILSPTVAGIFLDKGLAPSTLYAYYGIVFI  420
            AGLYSISPTIYDA+IRSRGVGYAIGFGRIGAILSPTVAGIFLDKG+AP+TLYAYYG+VFI
Sbjct  361  AGLYSISPTIYDAEIRSRGVGYAIGFGRIGAILSPTVAGIFLDKGIAPATLYAYYGVVFI  420

Query  421  LAIFLILSLSKAFYRQKEGLGSSIKT  446
            LAIFLILSL  AFYR K+    S+KT
Sbjct  421  LAIFLILSLGSAFYRSKKEQNYSLKT  446


> A0A1Y5NSF8 MFS superfamily vanillate transporter [Acinetobacter 
nosocomialis P020]
Length=448

 Score =  763 bits (1971),  Expect = 0.0
 Identities = 380/446 (85%), Positives = 417/446 (93%), Gaps = 0/446 (0%)

Query  1    MQRDILSEINQNNMSRYQWFVIVVCVCLNIIDGFDVMVMAFTAPSVSAEWSLSGAQIGLL  60
            M+RD+LSEINQNNMSRYQWF+I++C+CLNIIDGFDVMVMAFTAPSVSAEWSLSGAQIGLL
Sbjct  1    MERDVLSEINQNNMSRYQWFIILICICLNIIDGFDVMVMAFTAPSVSAEWSLSGAQIGLL  60

Query  61   LSAGLFGMAAGSIFLAPLADKIGRRLLILICLAIAGISMLACGLVHSHSMLAALRFVTGI  120
            LS+GLFGMAAGSIFLAPLADKIGRRLLIL+CL IAG+SML C LV SH MLAALRF+TGI
Sbjct  61   LSSGLFGMAAGSIFLAPLADKIGRRLLILVCLVIAGLSMLGCALVQSHGMLAALRFITGI  120

Query  121  GVGGILASSNVLASEYANLRWRSLAVSLMSTGYGIGATLGGILSLLLIEHLGWRSIFLAG  180
            GVGGILASSNVLASEYAN RWRSLAVSLMSTGYGIGATLGG+LSL LIEHLGWRSIFLAG
Sbjct  121  GVGGILASSNVLASEYANARWRSLAVSLMSTGYGIGATLGGVLSLALIEHLGWRSIFLAG  180

Query  181  GVTTVVMLLVSLWLLPESLDYLLAKKPKQALEKINLTVQRIGLVRLNALPQHEKNTQQHS  240
            G+TT+VMLL+S WLLPESLDYLLAK+PKQALE+IN TV RIGL  L ALP + +N Q+++
Sbjct  181  GITTIVMLLISAWLLPESLDYLLAKRPKQALERINATVNRIGLTALKALPYYGQNNQKNT  240

Query  241  SDIAKLFQGKQGFQTLCLWFAFFLVMFGFYFVMSWTPKILIAMGMSPSQGVTTGILISIG  300
             DI KLF G+QGFQTLCLWFAFFLVMFGFYFVMSWTPKILI+MGMSP QGV+ GILISIG
Sbjct  241  GDIGKLFSGQQGFQTLCLWFAFFLVMFGFYFVMSWTPKILISMGMSPEQGVSIGILISIG  300

Query  301  GVFGAAIIGLLASRIKIFHALSLFLGLTAVCVWLFVAVSSQVSIALMVGLLLGTLINGCV  360
            G+FGAAIIGLLASR+KIF+ALSLFLGLT+ CV+LFVAVSSQVS+ALMVGLLLGTLINGCV
Sbjct  301  GIFGAAIIGLLASRMKIFYALSLFLGLTSACVFLFVAVSSQVSVALMVGLLLGTLINGCV  360

Query  361  AGLYSISPTIYDADIRSRGVGYAIGFGRIGAILSPTVAGIFLDKGLAPSTLYAYYGIVFI  420
            AGLYSISPTIYDA+IRSRGVGYAIGFGRIGAILSPTVAGIFLDKG+AP+TLYAYYG+VFI
Sbjct  361  AGLYSISPTIYDAEIRSRGVGYAIGFGRIGAILSPTVAGIFLDKGIAPATLYAYYGVVFI  420

Query  421  LAIFLILSLSKAFYRQKEGLGSSIKT  446
            LAIFLILSL  AFYR ++    S+KT
Sbjct  421  LAIFLILSLGSAFYRSQKEQNFSLKT  446


> A0A2L1VI88 MFS transporter [Acinetobacter nosocomialis]
Length=448

 Score =  763 bits (1970),  Expect = 0.0
 Identities = 379/446 (85%), Positives = 418/446 (94%), Gaps = 0/446 (0%)

Query  1    MQRDILSEINQNNMSRYQWFVIVVCVCLNIIDGFDVMVMAFTAPSVSAEWSLSGAQIGLL  60
            M+RD+LSEINQNNMSRYQWF+I++C+CLNIIDGFDVMVMAFTAPSVSAEWSLSGAQIGLL
Sbjct  1    MERDVLSEINQNNMSRYQWFIILICICLNIIDGFDVMVMAFTAPSVSAEWSLSGAQIGLL  60

Query  61   LSAGLFGMAAGSIFLAPLADKIGRRLLILICLAIAGISMLACGLVHSHSMLAALRFVTGI  120
            LS+GLFGMAAGSIFLAPLADKIGRRLLIL+CL IAG+SML C LV SH MLAALRF+TGI
Sbjct  61   LSSGLFGMAAGSIFLAPLADKIGRRLLILVCLVIAGLSMLGCALVQSHGMLAALRFITGI  120

Query  121  GVGGILASSNVLASEYANLRWRSLAVSLMSTGYGIGATLGGILSLLLIEHLGWRSIFLAG  180
            GVGGILASSNVLASEYAN RWRSLAVSLMSTGYGIGATLGG+LSL LIEHLGWRSIFLAG
Sbjct  121  GVGGILASSNVLASEYANARWRSLAVSLMSTGYGIGATLGGVLSLALIEHLGWRSIFLAG  180

Query  181  GVTTVVMLLVSLWLLPESLDYLLAKKPKQALEKINLTVQRIGLVRLNALPQHEKNTQQHS  240
            G+TT+VMLL+S WLLPESLDYLLAK+PKQALE+IN TV R+GL  L ALP + +N Q+++
Sbjct  181  GITTIVMLLISAWLLPESLDYLLAKRPKQALERINATVNRMGLTALKALPYYGQNNQKNT  240

Query  241  SDIAKLFQGKQGFQTLCLWFAFFLVMFGFYFVMSWTPKILIAMGMSPSQGVTTGILISIG  300
             DI KLF G+QGFQTLCLWFAFFLVMFGFYFVMSWTPKILI+MGMSP QGV+TGILISIG
Sbjct  241  GDIGKLFSGQQGFQTLCLWFAFFLVMFGFYFVMSWTPKILISMGMSPEQGVSTGILISIG  300

Query  301  GVFGAAIIGLLASRIKIFHALSLFLGLTAVCVWLFVAVSSQVSIALMVGLLLGTLINGCV  360
            G+FGAAIIGLLASR+K+F+ALSLFLGLT+ CV+LFVAVSSQVSIAL+VGLLLGTLINGCV
Sbjct  301  GIFGAAIIGLLASRMKVFYALSLFLGLTSACVFLFVAVSSQVSIALIVGLLLGTLINGCV  360

Query  361  AGLYSISPTIYDADIRSRGVGYAIGFGRIGAILSPTVAGIFLDKGLAPSTLYAYYGIVFI  420
            AGLYSISPTIYDA+IRSRGVGYAIGFGRIGAILSPTVAGIFLDKG+AP+TLYAYYG+VFI
Sbjct  361  AGLYSISPTIYDAEIRSRGVGYAIGFGRIGAILSPTVAGIFLDKGIAPATLYAYYGVVFI  420

Query  421  LAIFLILSLSKAFYRQKEGLGSSIKT  446
            LAIFLILSL  AFYR ++    S+KT
Sbjct  421  LAIFLILSLGSAFYRSQKEQNFSLKT  446


> A0A204EYG5 MFS transporter [Acinetobacter baumannii]
Length=448

 Score =  763 bits (1970),  Expect = 0.0
 Identities = 380/446 (85%), Positives = 418/446 (94%), Gaps = 0/446 (0%)

Query  1    MQRDILSEINQNNMSRYQWFVIVVCVCLNIIDGFDVMVMAFTAPSVSAEWSLSGAQIGLL  60
            M+RD+LSEIN NNMSRYQWF+I++C+CLNIIDGFDVMVMAFTAPSVSAEWSLSGAQIGLL
Sbjct  1    MERDVLSEINHNNMSRYQWFIILICICLNIIDGFDVMVMAFTAPSVSAEWSLSGAQIGLL  60

Query  61   LSAGLFGMAAGSIFLAPLADKIGRRLLILICLAIAGISMLACGLVHSHSMLAALRFVTGI  120
            LS+GLFGMAAGSIFLAPLADKIGRRLLIL+CL IAG+SML C  V SH MLAALRF+TGI
Sbjct  61   LSSGLFGMAAGSIFLAPLADKIGRRLLILVCLVIAGLSMLGCAFVQSHGMLAALRFITGI  120

Query  121  GVGGILASSNVLASEYANLRWRSLAVSLMSTGYGIGATLGGILSLLLIEHLGWRSIFLAG  180
            GVGGILASSNVLASEYAN RWRSLAVSLMSTGYGIGATLGG+LSL LIEHLGWRSIFLAG
Sbjct  121  GVGGILASSNVLASEYANTRWRSLAVSLMSTGYGIGATLGGVLSLALIEHLGWRSIFLAG  180

Query  181  GVTTVVMLLVSLWLLPESLDYLLAKKPKQALEKINLTVQRIGLVRLNALPQHEKNTQQHS  240
            G+TT++MLL+S WLLPESLDYLLAK+PKQALE+IN+TV R+GL  L ALP + +N Q+++
Sbjct  181  GITTIMMLLISAWLLPESLDYLLAKRPKQALERINVTVNRMGLTALKALPYYGQNNQKNT  240

Query  241  SDIAKLFQGKQGFQTLCLWFAFFLVMFGFYFVMSWTPKILIAMGMSPSQGVTTGILISIG  300
             DI KLF G+QGFQTLCLWFAFFLVMFGFYFVMSWTPKILI+MGMSP QGV+TGILISIG
Sbjct  241  GDIGKLFSGQQGFQTLCLWFAFFLVMFGFYFVMSWTPKILISMGMSPEQGVSTGILISIG  300

Query  301  GVFGAAIIGLLASRIKIFHALSLFLGLTAVCVWLFVAVSSQVSIALMVGLLLGTLINGCV  360
            G+FGAAIIGLLASR+KIF+ALSLFLGLTAVCV+LFVAVSSQVSIAL+VGLLLGTLINGCV
Sbjct  301  GIFGAAIIGLLASRMKIFYALSLFLGLTAVCVFLFVAVSSQVSIALIVGLLLGTLINGCV  360

Query  361  AGLYSISPTIYDADIRSRGVGYAIGFGRIGAILSPTVAGIFLDKGLAPSTLYAYYGIVFI  420
            AGLYSISPTIYDA+IRSRGVGYAIGFGRIGAILSPTVAGIFLDKG+AP+TLYAYYG+VFI
Sbjct  361  AGLYSISPTIYDAEIRSRGVGYAIGFGRIGAILSPTVAGIFLDKGIAPATLYAYYGVVFI  420

Query  421  LAIFLILSLSKAFYRQKEGLGSSIKT  446
            LAIFLILSL  AFYR K+    S+KT
Sbjct  421  LAIFLILSLGSAFYRSKKEQKFSLKT  446


> Q2KQ80 IvaK [Comamonas testosteroni]
Length=451

 Score =  462 bits (1189),  Expect = 2e-162
 Identities = 223/428 (52%), Positives = 316/428 (74%), Gaps = 2/428 (0%)

Query  1    MQRDILSEINQNNMSRYQWFVIVVCVCLNIIDGFDVMVMAFTAPSVSAEWSLSGAQIGLL  60
            M++D+ + ++Q  M+ +QW VI VC+ LN+IDGFDV+VMAFTA +VS  W LSG+++G L
Sbjct  1    MEQDLRAHLDQRPMTTFQWSVIAVCMALNMIDGFDVLVMAFTASAVSGHWKLSGSELGFL  60

Query  61   LSAGLFGMAAGSIFLAPLADKIGRRLLILICLAIAGISMLACGLVHSHSMLAALRFVTGI  120
            LSAGLFGMAAGS+ LAPLADK+GRR LIL+CLA++G+ MLA     + + LA LR +TG+
Sbjct  61   LSAGLFGMAAGSLLLAPLADKLGRRPLILLCLAVSGLGMLASAWSQTPAQLAVLRVITGL  120

Query  121  GVGGILASSNVLASEYANLRWRSLAVSLMSTGYGIGATLGGILSLLLIEHLGWRSIFLAG  180
            GVGGILA SNV+ASEYA+LRWRSLAV+L STGY +GAT+GG +++ L+ H GWRS+F+ G
Sbjct  121  GVGGILACSNVIASEYASLRWRSLAVTLQSTGYALGATIGGSIAVWLLAHHGWRSVFMFG  180

Query  181  GVTTVVMLLVSLWLLPESLDYLLAKKPKQALEKINLTVQRIGLVRLNALPQHEKNTQQHS  240
            G +T+ +L+++ + LPES+D+LL K+P  AL+++N  ++++GL  L +LPQ        S
Sbjct  181  GFSTLAVLVLAWFALPESMDFLLVKRPANALQRLNALIRKMGLPALGSLPQAVVAGSGES  240

Query  241  SDIA--KLFQGKQGFQTLCLWFAFFLVMFGFYFVMSWTPKILIAMGMSPSQGVTTGILIS  298
              +   +L   K    T+ +W +FF VMFGFYFVMSWTPK+L A G++P QGVTTG+L+S
Sbjct  241  KRMGPLQLLSPKLLRPTVLVWLSFFSVMFGFYFVMSWTPKLLAASGLTPEQGVTTGVLLS  300

Query  299  IGGVFGAAIIGLLASRIKIFHALSLFLGLTAVCVWLFVAVSSQVSIALMVGLLLGTLING  358
            +GG+ GA ++GLLA+R  I  AL++F+ +TAV +   V  S  + ++  +  L+G  +N 
Sbjct  301  LGGILGATLLGLLAARFAIHRALAVFMLVTAVLLCFLVGSSGALWMSYTLAFLIGVFVNA  360

Query  359  CVAGLYSISPTIYDADIRSRGVGYAIGFGRIGAILSPTVAGIFLDKGLAPSTLYAYYGIV  418
            CVAGLY+I+P +Y +D+R+ GVG+ IG GRIGAI+SP VAG  LD   +P  LY  YG+ 
Sbjct  361  CVAGLYAIAPVVYGSDVRATGVGWGIGIGRIGAIVSPLVAGGLLDAAWSPDQLYLGYGMA  420

Query  419  FILAIFLI  426
            F+LA  ++
Sbjct  421  FVLAAVIV  428


> O05147 Putative 3-(3-hydroxyphenyl) propionate transport protein 
[Rhodococcus globerulus]
Length=453

 Score =  297 bits (761),  Expect = 4e-98
 Identities = 167/442 (38%), Positives = 260/442 (59%), Gaps = 16/442 (4%)

Query  4    DILSEINQNNMSRYQWFVIVVCVCLNIIDGFDVMVMAFTAPSVSAEWSLSGAQIGLLLSA  63
            D+   I    M RYQ   I +C+ L++IDGF+++VMAF AP +   W +S  +IG LLSA
Sbjct  2    DVREAIRTQPMRRYQISTIAICLILSMIDGFEILVMAFVAPHLGKSWDISSVEIGYLLSA  61

Query  64   GLFGMAAGSIFLAPLADKIGRRLLILICLA--IAGISMLACGLVHSHSMLAALRFVTGIG  121
            G+ G A G+IF++PLADKIGRR L + CL     G+++ AC +  +   L A R   G+G
Sbjct  62   GIIGTALGAIFISPLADKIGRRRLAIWCLVGITVGMALSACAV--NVPQLIAFRAFAGLG  119

Query  122  VGGILASSNVLASEYANLRWRSLAVSLMSTGYGIGATLGGILSLLLIEHLGWRSIFLAGG  181
            +GG++A+ NVL SE+++ + R  A+ +   GY +G  +GG +S +LI    WRS F+ G 
Sbjct  120  IGGLVANLNVLVSEFSSDKRRGTALGIYGVGYPLGGAVGGAISGVLISVFDWRSAFIFGT  179

Query  182  VTTVVMLLVSLWLLPESLDYLLAKKPKQALEKINLTVQRIGLVRLNALPQHEKNTQQHSS  241
            + T +ML+V +  LPES+++L+ K+P  ALE+ N    R+G  + + LP   + T++   
Sbjct  180  IITAIMLVVVIKTLPESIEFLIEKRPVGALERYNEIADRLGYEQSSELPVPIRKTERVVR  239

Query  242  DIAKLFQGKQGFQTLCLWFAFFLVMFGFYFVMSWTPKILIAMGMSPSQGVTTGILISIGG  301
            D   LF+G    +T+ LW  +  ++  FYF  +WTPK+L       + GVT G+L+++GG
Sbjct  240  D--GLFKGIMLRRTVFLWLGYSCLIASFYFANTWTPKLLSDATGDSNMGVTAGVLVNVGG  297

Query  302  VFGAAII-GL-LASRIKIFHALSLFLGLTAVCVWLFVAVSSQ---VSIALMVGLLLGTLI  356
            V G+ I  GL +  R ++   L +F G     V+ F+  +S    V++AL + +L+G   
Sbjct  298  VIGSIIFAGLSIVLRPRVVTVLLMFGG-----VFAFIGYASGFHIVALALTLAVLVGIFA  352

Query  357  NGCVAGLYSISPTIYDADIRSRGVGYAIGFGRIGAILSPTVAGIFLDKGLAPSTLYAYYG  416
            NG + G Y+ISP IY A  R  GVG+ IG GR  +I++P + G  LD G  P ++Y  +G
Sbjct  353  NGGITGFYAISPPIYPAAARGTGVGWMIGCGRTVSIIAPILTGYLLDGGWTPKSVYMMFG  412

Query  417  IVFILAIFLILSLSKAFYRQKE  438
             V ++A    L L   +  + E
Sbjct  413  GVLVIAGIATLLLDATYRGRSE  434


> A0A2H4ZC34 DsmF [Rhizorhabdus dicambivorans]
Length=448

 Score =  228 bits (580),  Expect = 2e-71
 Identities = 132/435 (30%), Positives = 228/435 (52%), Gaps = 11/435 (3%)

Query  9    INQNNMSRYQWFVIVVCVCLNIIDGFDVMVMAFTAPSVSAEWSLSGAQIGLLLSAGLFGM  68
            I++  +S  QW  I  C  + ++DGFD   +AF AP+++ +W ++ A  G   +AGL G+
Sbjct  10   IDERKVSGLQWRAIGFCGLVALLDGFDTQSVAFAAPAIAKDWGINVASFGPGFAAGLAGL  69

Query  69   AAGSIFLAPLADKIGRRLLILICLAIAGISMLACGLVHSHSMLAALRFVTGIGVGGILAS  128
               ++ L  + D++GR+ +I++ LA+ GI  L C    S   LA  RF  G+G+GG + +
Sbjct  70   TVAALSLGVVGDRVGRKRIIIVSLAMMGIFSLLCARAGSLPQLAIARFFVGLGLGGAMPN  129

Query  129  SNVLASEYANLRWRSLAVSLMSTGYGIGATLGGILSLLLIEHLGWRSIFLAGGVTTVVML  188
               L +EY+  R RS  ++ M  G  +GA +GG  S  LI   GW+S+F+ GG+  + ++
Sbjct  130  IIALTAEYSPARIRSTLITCMCIGIPMGAVIGGAASSPLISAFGWQSLFIVGGILPLALI  189

Query  189  LVSLWLLPESLDYLLAKKPKQALEKINLTVQRIGLVRLNALPQHEKNTQQHS-----SDI  243
             + +  +PES+ YL++ +  +A  K+   + RI       LP     T+Q++       I
Sbjct  190  PLIMIGMPESVRYLVSVERHKA--KVRSIIARIA----PDLPSDVIVTRQNADVAARGSI  243

Query  244  AKLFQGKQGFQTLCLWFAFFLVMFGFYFVMSWTPKILIAMGMSPSQGVTTGILISIGGVF  303
            A+LF  ++   TL LWF FF  +   Y +++W P +L   G+  +Q +   +L ++GG  
Sbjct  244  AQLFSDRRAATTLTLWFVFFCNLLVMYLLINWLPIVLTTAGIPHTQAIFGTVLFNLGGAI  303

Query  304  GAAIIGLLASRIKIFHALSLFLGLTAVCVWLFVAVSSQVSIALMVGLLLGTLINGCVAGL  363
            G   I     + +  +AL       AV + L     + V +AL +  L G    G + G+
Sbjct  304  GGYFIARSLDKRQSDNALRFAFFGAAVFIALLGFAMTDVRLALALTFLSGFCGMGALFGM  363

Query  364  YSISPTIYDADIRSRGVGYAIGFGRIGAILSPTVAGIFLDKGLAPSTLYAYYGIVFILAI  423
             +++ + Y+ +IRS GVG+A G GRIG+I+ P V G  +  G    T+     +  +  +
Sbjct  364  NALTASYYETEIRSTGVGWAHGIGRIGSIIGPVVGGALIGMGAETQTILLIAAVPMLACV  423

Query  424  FLILSLSKAFYRQKE  438
              +L L++   RQ +
Sbjct  424  AGLLMLTRIGARQAD  438


> A0A291HHA7 4-hydroxybenzoate transporter [Acidovorax sp]
Length=458

 Score =  216 bits (549),  Expect = 6e-67
 Identities = 118/416 (28%), Positives = 216/416 (52%), Gaps = 3/416 (1%)

Query  9    INQNNMSRYQWFVIVVCVCLNIIDGFDVMVMAFTAPSVSAEWSLSGAQIGLLLSAGLFGM  68
            +N++  S +QW +  +C  + ++DGFD   + + AP +  EW +S   +  +LSA LFG+
Sbjct  19   LNEHPFSGFQWRIFALCFFIVLLDGFDTSAIGYIAPHLMTEWGVSKPDLAPVLSAALFGL  78

Query  69   AAGSIFLAPLADKIGRRLLILICLAIAGISMLACGLVHSHSMLAALRFVTGIGVGGILAS  128
            AAG++   PLADK+GR+++++  +A+  ++ L      +   L ALRFVTG+G+G  + +
Sbjct  79   AAGALSAGPLADKLGRKVVLVGSVALFALACLGSAFSPNLWTLTALRFVTGVGLGAAMPN  138

Query  129  SNVLASEYANLRWRSLAVSLMSTGYGIGATLGGILSLLLIEHLGWRSIFLAGGVTTVVML  188
            +  L SEY     R+   + M  G+ +GA  GG L+  +I  LGWRS+ + GGV  +V++
Sbjct  139  AVTLMSEYCPDSRRATLTNAMFCGFPLGAAFGGFLAAWMIPLLGWRSVLILGGVLPLVLV  198

Query  189  LVSLWLLPESLDYLLAK-KPKQALEKINLTVQRIGLVRLNALPQHEKNTQQHS-SDIAKL  246
             + LW LPES+ Y++AK  P + + ++ L +    +  +      E   +  + S I  +
Sbjct  199  ALLLWQLPESVRYMVAKGYPMERVRRVLLRIAGDSVKSVQRFVLTETAPESDAKSGIGVV  258

Query  247  FQGKQGFQTLCLWFAFFLVMFGFYFVMSWTPKILIAMGMSPSQGVTTGILISIGGVFGAA  306
               +    ++ +W A+F+ +  FY +++W P +    G+ P  G     L  +GGV GA 
Sbjct  259  LSAQYRVGSVMMWLAYFMGLVIFYALINWMPILFRDAGLDPKTGALVAALFPLGGV-GAV  317

Query  307  IIGLLASRIKIFHALSLFLGLTAVCVWLFVAVSSQVSIALMVGLLLGTLINGCVAGLYSI  366
              G L  R      +++   LTAV +W     +  +   ++   L GT++N   + + ++
Sbjct  318  FFGWLMDRFNATRIIAVGYALTAVSIWWIGQTAGNLGWLVVSVFLAGTIMNTAQSSMPAL  377

Query  367  SPTIYDADIRSRGVGYAIGFGRIGAILSPTVAGIFLDKGLAPSTLYAYYGIVFILA  422
            +   Y    R+ GV + +G GR G I    +      + L  S +++   +  ++A
Sbjct  378  AAAFYPTRGRATGVAWMLGIGRFGGIAGSFLVAELSARHLGFSEIFSVVAVAGLVA  433


> D1MW95 4-hydroxybenzoate transporter [Comamonas sp. E6]
Length=465

 Score =  212 bits (540),  Expect = 1e-65
 Identities = 119/406 (29%), Positives = 211/406 (52%), Gaps = 14/406 (3%)

Query  4    DILSEINQNNMSRYQWFVIVVCVCLNIIDGFDVMVMAFTAPSVSAEWSLSGAQIGLLLSA  63
            ++ + +N++  SR+QW +  +C  + ++DGFD   + F APS+  EW +  + +G +LSA
Sbjct  16   NVQTVLNESPFSRFQWGIFFLCFLIVLLDGFDTAAIGFIAPSLLGEWGIDKSHLGPVLSA  75

Query  64   GLFGMAAGSIFLAPLADKIGRRLLILICLAIAGISMLACGLVHSHSMLAALRFVTGIGVG  123
             LFG+A G++   PLAD++GR+ +++I   + G + +A GLVH    L   RF+TG+G+G
Sbjct  76   ALFGLAFGALGAGPLADRVGRKTVLIIASVVMGGASIASGLVHDLQGLTIWRFITGLGLG  135

Query  124  GILASSNVLASEYANLRWRSLAVSLMSTGYGIGATLGGILSLLLIEHLGWRSIFLAGGVT  183
              + ++  L +EY     RS   + M  G+ IG+  GG ++  +I H GWRS+ + GGV 
Sbjct  136  AAMPNAITLMNEYCPDSKRSFITNCMFCGFPIGSAFGGFIAAWMIPHFGWRSLLIVGGVV  195

Query  184  TVVMLLVSLWLLPESLDYLLAK-----KPKQALEKINLTVQRIGLVRLNALPQHEKNTQQ  238
             +++ ++ + +LPES+ +++ K     + ++ + +I    +      LN   +     QQ
Sbjct  196  PLILAVLMIVMLPESVRFMVLKNYSADRVRKVMVRIAAGTRNAARFVLNDGGEAAAQAQQ  255

Query  239  HSSDIAKLFQGKQGFQTLCLWFAFFLVMFGFYFVMSWTPKILIAMGMSPSQGVTTGILIS  298
                +  +F  K    TL LW  +F+ +   Y +++W P +    G+  SQ      L  
Sbjct  256  GPQGLRLVFSQKYLVGTLALWVTYFMGLVIVYGLVNWMPVLFKEAGVPASQAAVIAALFQ  315

Query  299  IGGVFGAAIIGLLASR--IKIFHALSLFLGLTAVCVWLFVAVSSQVSIALMVGLLLGTLI  356
            +GGV GA  +GLL  R    +  A   FL    V  ++   +   V + +    + G L+
Sbjct  316  LGGV-GAIFVGLLMDRWNANLIIATGYFLTSLGV-AFIGQVLGGGVGMLVASVFIAGLLM  373

Query  357  NGCVAGLYSISPTIYDADIRSRGVGYAIGFGRIGAILSPTVAGIFL  402
            N   + + +++   Y  + R+ GV + +G GR G I     AG FL
Sbjct  374  NAAQSSMQALAAEYYPTECRASGVSWMLGIGRFGGI-----AGSFL  414


> Q93PT0 4-hydroxybenzoate transporter [Comamonas testosteroni]
Length=465

 Score =  210 bits (534),  Expect = 1e-64
 Identities = 118/406 (29%), Positives = 210/406 (52%), Gaps = 14/406 (3%)

Query  4    DILSEINQNNMSRYQWFVIVVCVCLNIIDGFDVMVMAFTAPSVSAEWSLSGAQIGLLLSA  63
            ++ + +N++  S +QW +  +C  + ++DGFD   + F APS+  EW +  + +G +LSA
Sbjct  16   NVQTVLNESPFSGFQWGIFFLCFLIVLLDGFDTAAIGFIAPSLLGEWGIDKSHLGPVLSA  75

Query  64   GLFGMAAGSIFLAPLADKIGRRLLILICLAIAGISMLACGLVHSHSMLAALRFVTGIGVG  123
             LFG+A G++   PLAD++GR+ +++I   + G + +A GLVH    L   RF+TG+G+G
Sbjct  76   ALFGLAFGALGAGPLADRVGRKTVLIIAAVVMGGASIASGLVHDLQGLTIWRFITGLGLG  135

Query  124  GILASSNVLASEYANLRWRSLAVSLMSTGYGIGATLGGILSLLLIEHLGWRSIFLAGGVT  183
              + ++  L +EY     RS   + M  G+ IG+  GG ++  +I H GWRS+ + GGV 
Sbjct  136  AAMPNAITLMNEYCPDSKRSFITNCMFCGFPIGSAFGGFIAAWMIPHFGWRSLLIVGGVV  195

Query  184  TVVMLLVSLWLLPESLDYLLAK-----KPKQALEKINLTVQRIGLVRLNALPQHEKNTQQ  238
             +++ ++ + +LPES+ +++ K     + ++ + +I    +      LN   +     QQ
Sbjct  196  PLILAVLMIVMLPESVRFMVLKNYSADRVRKVMVRIAAGTRNAARFVLNDGGEAAAQAQQ  255

Query  239  HSSDIAKLFQGKQGFQTLCLWFAFFLVMFGFYFVMSWTPKILIAMGMSPSQGVTTGILIS  298
                +  +F  K    TL LW  +F+ +   Y +++W P +    G+  SQ      L  
Sbjct  256  GPQGLRLVFSQKYLVGTLALWVTYFMGLVIVYGLVNWMPVLFKEAGVPASQAAVIAALFQ  315

Query  299  IGGVFGAAIIGLLASR--IKIFHALSLFLGLTAVCVWLFVAVSSQVSIALMVGLLLGTLI  356
            +GGV GA  +GLL  R    +  A   FL    V  ++   +   V + +    + G L+
Sbjct  316  LGGV-GAIFVGLLMDRWNANLIIATGYFLTSLGV-AFIGQVLGGGVGMLVASVFIAGLLM  373

Query  357  NGCVAGLYSISPTIYDADIRSRGVGYAIGFGRIGAILSPTVAGIFL  402
            N   + + +++   Y  + R+ GV + +G GR G I     AG FL
Sbjct  374  NAAQSSMQALAAEYYPTECRASGVSWMLGIGRFGGI-----AGSFL  414


> Q9AQI2 Putative transporter [Pseudomonas straminea]
Length=465

 Score =  209 bits (531),  Expect = 3e-64
 Identities = 118/406 (29%), Positives = 209/406 (51%), Gaps = 14/406 (3%)

Query  4    DILSEINQNNMSRYQWFVIVVCVCLNIIDGFDVMVMAFTAPSVSAEWSLSGAQIGLLLSA  63
            ++ + +N++  S +QW +  +C  + ++DGFD   + F APS+  EW +  + +G +LSA
Sbjct  16   NVQTVLNESPFSGFQWGIFFLCFLIVLLDGFDTAAIGFIAPSLLGEWGIDKSHLGPVLSA  75

Query  64   GLFGMAAGSIFLAPLADKIGRRLLILICLAIAGISMLACGLVHSHSMLAALRFVTGIGVG  123
             LFG+A G++   PLAD++GR+ +++I   + G + +A GLVH    L   RF+TG+G+G
Sbjct  76   ALFGLAFGALGAGPLADRVGRKTVLIIAAVVMGGASIASGLVHDLQGLTIWRFITGLGLG  135

Query  124  GILASSNVLASEYANLRWRSLAVSLMSTGYGIGATLGGILSLLLIEHLGWRSIFLAGGVT  183
              + ++  L +EY     RS   + M  G+ IG+  GG ++  +I H GWRS+ + GGV 
Sbjct  136  AAMPNAITLMNEYCPDSKRSFITNCMFCGFPIGSAFGGFIAAWMIPHFGWRSLLIVGGVV  195

Query  184  TVVMLLVSLWLLPESLDYLLAK-----KPKQALEKINLTVQRIGLVRLNALPQHEKNTQQ  238
             +++ ++ + +LPES+ +++ K     + ++ + +I    +      LN         QQ
Sbjct  196  PLILAVLMIVMLPESVRFMVLKNYSADRVRKVMVRIAAGTRNAARFVLNDGGAAAAQAQQ  255

Query  239  HSSDIAKLFQGKQGFQTLCLWFAFFLVMFGFYFVMSWTPKILIAMGMSPSQGVTTGILIS  298
                +  +F  K    TL LW  +F+ +   Y +++W P +    G+  SQ      L  
Sbjct  256  GPQGLRLVFSQKYLVGTLALWVTYFMGLVIVYGLVNWMPVLFKEAGVPASQAAVIAALFQ  315

Query  299  IGGVFGAAIIGLLASR--IKIFHALSLFLGLTAVCVWLFVAVSSQVSIALMVGLLLGTLI  356
            +GGV GA  +GLL  R    +  A   FL    V  ++   +   V + +    + G L+
Sbjct  316  LGGV-GAIFVGLLMDRWNANLIIAAGYFLTSLGV-AFIGQVLGGGVGMLVASVFIAGLLM  373

Query  357  NGCVAGLYSISPTIYDADIRSRGVGYAIGFGRIGAILSPTVAGIFL  402
            N   + + +++   Y  + R+ GV + +G GR G I     AG FL
Sbjct  374  NAAQSSMQALAAEYYPTECRASGVSWMLGIGRFGGI-----AGSFL  414


> B2BEM2 Benzoate transport protein [Acinetobacter calcoaceticus]
Length=461

 Score =  206 bits (525),  Expect = 2e-63
 Identities = 126/422 (30%), Positives = 212/422 (50%), Gaps = 8/422 (2%)

Query  9    INQNNMSRYQWFVIVVCVCLNIIDGFDVMVMAFTAPSVSAEWSLSGAQIGLLLSAGLFGM  68
            I++ + + + W V++ C+ + I DG+D+++     P +  + SL+  + GLL SA LFGM
Sbjct  21   IDKASFTSFHWKVLIWCLLIIIFDGYDLVIYGVALPLLMQQSSLTAVEAGLLASAALFGM  80

Query  69   AAGSIFLAPLADKIGRRLLILICLAIAGISMLACGLVHSHSMLAALRFVTGIGVGGILAS  128
              G++    L+DK+GR+  ILIC+ +              +  A LRF+ G+G+GG++ +
Sbjct  81   MFGAMIFGTLSDKLGRKKTILICVTLFSGFTFIGAFAKGPTEFAILRFIAGLGIGGVMPN  140

Query  129  SNVLASEYANLRWRSLAVSLMSTGYGIGATLGGILSLLLIEHLGWRSIFLAGGVTTVVML  188
               L +EYA  + RS  V++M +GY IG     +L   L++ +GW+ +FL  G  T ++L
Sbjct  141  VVALMTEYAPKKIRSTLVAIMFSGYAIGGMTSALLGAWLVKDMGWQIMFLIAG--TPLLL  198

Query  189  LVSLW-LLPESLDYLLAKKPKQALEKINLTVQRIGLVRLNALPQHEKNTQQHSSDIAKLF  247
            L  +W  LPESL +L+     +  + I   +     V  N      +NT    + +  LF
Sbjct  199  LPLIWKFLPESLAFLVKSNHSEQAKSIVSKIAPQTQVNANTQLVLNENTTT-DAPVRALF  257

Query  248  QGKQGFQTLCLWFAFFLVMFGFYFVMSWTPKILIAMGMSPSQGVTTGILISIGGVFGAAI  307
            Q  + F T   W AFF+ +   Y + SW PK+++  G S    +     ++IGG+ GA  
Sbjct  258  QQGRTFSTFMFWIAFFMCLLMVYALGSWLPKLMLQAGYSLGASMLFLFALNIGGMVGAIG  317

Query  308  IGLLASRIKIFHALSLFLGLTAVCVWLFVAVSSQVSIALMVGLLLGTLINGCVAGLYSIS  367
             G LA R  +   +++   +      + + ++S   I   +  + G    G    LY+  
Sbjct  318  GGALADRFHLKPVITIMF-IVGSAALILLGINSPQFILYSLIAIAGAATIGSQILLYTFV  376

Query  368  PTIYDADIRSRGVGYAIGFGRIGAILSPTVAGIFLDKGLAPSTLY---AYYGIVFILAIF  424
               Y   +RS G+G+A G GRIGAI+ P + G  L   L     +   A  G++  LAIF
Sbjct  377  AQFYPTALRSTGMGWASGIGRIGAIIGPVLTGALLTLELPHQMNFLAIAIPGVIAALAIF  436

Query  425  LI  426
            ++
Sbjct  437  MV  438


> Q9L7Y1 Benzoate transport protein [Pseudomonas putida]
Length=443

 Score =  202 bits (513),  Expect = 7e-62
 Identities = 118/399 (30%), Positives = 200/399 (50%), Gaps = 2/399 (1%)

Query  4    DILSEINQNNMSRYQWFVIVVCVCLNIIDGFDVMVMAFTAPSVSAEWSLSGAQIGLLLSA  63
            D+   I+    + + W V+  C  L I DG+D+ +     P +  EW L+  Q G L S 
Sbjct  5    DVHPIIDNARFTPFHWMVMAWCGLLLIFDGYDLFIYGVVLPVIMKEWGLTPLQAGALGSY  64

Query  64   GLFGMAAGSIFLAPLADKIGRRLLILICLAIAGISMLACGLVHSHSMLAALRFVTGIGVG  123
             LFGM  G++    LAD+IGR+  I IC A+  ++ +  G   S S     RF+ G+G G
Sbjct  65   ALFGMMFGALAFGSLADRIGRKKGIAICFALFSVATILNGFASSPSEFGIYRFIAGLGCG  124

Query  124  GILASSNVLASEYANLRWRSLAVSLMSTGYGIGATLGGILSLLLIEHLGWRSIFLAGGVT  183
            G++ ++  L +EYA  R RS  V++M +GY +G  L   + + ++   GW S+F A  V 
Sbjct  125  GLMPNAVALMNEYAPKRLRSTLVAIMFSGYSLGGMLSAGVGIFMLPRFGWESMFFAAAV-  183

Query  184  TVVMLLVSLWLLPESLDYLLAKKPKQALEKINLTVQRIGLVRLNALPQHEKNTQQHSSDI  243
             +++L V L+ LPES+ +L+ K   +    +   +     V+ + + Q         + +
Sbjct  184  PLLLLPVILYYLPESIGFLVRKGRTEEARALLKRLDPQCDVQADDVLQAADRKAGGGASV  243

Query  244  AKLFQGKQGFQTLCLWFAFFLVMFGFYFVMSWTPKILIAMGMSPSQGVTTGILISIGGVF  303
             +LF+     +TL LW AFF  +   Y + SW PK++   G S    ++  + ++ GG+ 
Sbjct  244  LELFRNGLAIRTLALWLAFFCCLLMVYALSSWLPKLMANAGYSLGSSLSFLLALNFGGMA  303

Query  304  GAAIIGLLASRIKIFHALSLFLGLTAVCVWLFVAVSSQVSIALMVGLLLGTLINGCVAGL  363
            GA + G L  R  +      F    A+ + L + V+S + +  ++  + G    G    L
Sbjct  304  GAILGGWLGDRYNLVKVKVAFFIAAALSISL-LGVNSPMPVLYLLIFIAGATTIGTQILL  362

Query  364  YSISPTIYDADIRSRGVGYAIGFGRIGAILSPTVAGIFL  402
            Y+ +  +Y   +RS G+G+A G GR GAI+ P + G  +
Sbjct  363  YAGAAQMYGLSVRSTGLGWASGIGRNGAIVGPLLGGALM  401



Lambda      K        H        a         alpha
   0.329    0.143    0.428    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4056230


  Database: 7a2dfc78e4ab9fc56ef11203d64e9d63.TrEMBL.fasta
    Posted date:  Oct 1, 2020  7:00 AM
  Number of letters in database: 11,725
  Number of sequences in database:  26



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40