ACIAD0982 / SwissProt Alignments

BLASTP 2.2.28+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: 9bc0f12e84c11e318236e5f7722d0915.SwissProt.fasta
           11 sequences; 4,853 total letters



Query= ACIAD0982

Length=449
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  E8ZB61 Gallate transporter [Pseudomonas putida]                      254    7e-82
  Q9I6Q3 4-hydroxybenzoate transporter PcaK [Pseudomonas aerugino...   231    3e-73
  Q5EXK5 3-hydroxybenzoate transporter MhbT [Klebsiella oxytoca]       223    3e-70
  Q43975 4-hydroxybenzoate transporter PcaK [Acinetobacter baylyi...   218    3e-68
  Q51955 4-hydroxybenzoate transporter PcaK [Pseudomonas putida]       218    4e-68
  O30513 Benzoate transport protein [Acinetobacter baylyi (strain...   203    1e-62
  P77589 3-(3-hydroxy-phenyl)propionate transporter [Escherichia ...   169    2e-50
  Q8NLB7 Gentisate transporter [Corynebacterium glutamicum (strai...   152    3e-44
  O34691 Putative niacin/nicotinamide transporter NaiP [Bacillus ...   137    4e-39
  O24723 Probable 1-hydroxy-2-naphthoate transporter [Nocardioide...   128    7e-36
  P94131 Cis,cis-muconate transport protein [Acinetobacter baylyi...   116    6e-32


> E8ZB61 Gallate transporter [Pseudomonas putida]
Length=449

 Score =  254 bits (648),  Expect = 7e-82
 Identities = 143/434 (33%), Positives = 230/434 (53%), Gaps = 5/434 (1%)

Query  4    DILSEINQNNMSRYQWFVIVVCVCLNIIDGFDVMVMAFTAPSVSAEWSLSGAQIGLLLSA  63
            D+   I+   ++ YQW ++V+C  + + DGFDV VM F APS+  +W LS A  G ++SA
Sbjct  11   DVKDWIDNRPIAAYQWLILVLCFLIVLFDGFDVAVMGFIAPSLMQDWGLSRAAFGPVMSA  70

Query  64   GLFGMAAGSIFLAPLADKIGRRLLILICLAIAGISMLACGLVHSHSMLAALRFVTGIGVG  123
            G+ G+A G++   P AD++GR+ ++LI ++   +  LAC    +   LA LR +TGI +G
Sbjct  71   GMVGLAIGALTAGPYADRLGRKKVLLIAVSGFSLLSLACAFARNPYELAVLRLLTGIALG  130

Query  124  GILASSNVLASEYANLRWRSLAVSLMSTGYGIGATLGGILSLLLIEHLGWRSIFLAGGVT  183
              + +   L +EY   R RSL +++M TG+ +G+ LGG LS  LI H GW+S+ LAGG+ 
Sbjct  131  AAMPNCTTLLAEYLPTRNRSLMITIMFTGFNMGSGLGGFLSAWLIPHHGWKSVLLAGGLL  190

Query  184  TVVMLLVSLWLLPESLDYLLAKKPKQALEKINLTVQRIGLVRLNALPQH--EKNTQQHSS  241
             + +L +  WLLPES  +L A++   +  +I   + ++G  R  A  +    + T QH +
Sbjct  191  PLALLPLLWWLLPESARFLAARQAPAS--QIAAALAKLG-GRFAAGTRFTVSEPTTQHKA  247

Query  242  DIAKLFQGKQGFQTLCLWFAFFLVMFGFYFVMSWTPKILIAMGMSPSQGVTTGILISIGG  301
               +LF  +  F TL LW  +F+ +   Y  M W P +L   G+S  +  T   L  IGG
Sbjct  248  PARQLFSERYRFGTLALWLTYFMGLLVIYLTMGWLPTLLRDGGLSIERAATITGLFQIGG  307

Query  302  VFGAAIIGLLASRIKIFHALSLFLGLTAVCVWLFVAVSSQVSIALMVGLLLGTLINGCVA  361
              GA ++G +  R      +++   L  +C+    A+S + S+ ++     G  ++G   
Sbjct  308  AVGAIVVGWIMDRRNPNRVIAIAYALGGLCIVSLGALSLESSLLVVGVAAAGFCMSGAQT  367

Query  362  GLYSISPTIYDADIRSRGVGYAIGFGRIGAILSPTVAGIFLDKGLAPSTLYAYYGIVFIL  421
             L + +P  Y  + R+ GV + +G GR GAI    + G  L  GL    L+   G+    
Sbjct  368  ALNAFAPGYYPTEFRATGVSWMLGIGRFGAIFGSLIGGAVLSLGLGLPLLFTLLGLPAFA  427

Query  422  AIFLILSLSKAFYR  435
            A   IL+   A  R
Sbjct  428  AALAILANGHARLR  441


> Q9I6Q3 4-hydroxybenzoate transporter PcaK [Pseudomonas aeruginosa 
(strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 
/ LMG 12228 / 1C / PRS 101 / PAO1)]
Length=448

 Score =  231 bits (589),  Expect = 3e-73
 Identities = 133/407 (33%), Positives = 208/407 (51%), Gaps = 9/407 (2%)

Query  4    DILSEINQNNMSRYQWFVIVVCVCLNIIDGFDVMVMAFTAPSVSAEWSLSGAQIGLLLSA  63
            D+ + IN   +S YQW ++++C  +  +DG D   M F AP+++ +W +  A +G ++SA
Sbjct  13   DVQAFINAQPLSPYQWRIVLLCFLIVFLDGLDTAAMGFIAPALTQDWGIDRASLGPVMSA  72

Query  64   GLFGMAAGSIFLAPLADKIGRRLLILICLAIAGISMLACGLVHSHSMLAALRFVTGIGVG  123
             L GM  G++   PLAD+ GR+L+++  + + G+  LA     +   L ALRF+TG+G+G
Sbjct  73   ALIGMVFGALGSGPLADRYGRKLVLVAAVFLFGLFSLASAYSTNVEQLLALRFLTGLGLG  132

Query  124  GILASSNVLASEYANLRWRSLAVSLMSTGYGIGATLGGILSLLLIEHLGWRSIFLAGGVT  183
              + ++  L SEY   R +SL V+ M  G+ +G   GG +S  LI   GW S+ L GG+ 
Sbjct  133  AAMPNATTLLSEYTPERLKSLLVTSMFCGFNLGMACGGFVSAKLIPLFGWHSLLLLGGLL  192

Query  184  TVVMLLVSLWLLPESLDYLL-----AKKPKQALEKINLTVQRIGLVRLNALPQHEKNTQQ  238
             +V+ +V L+ LPES  YL+     +++ +Q L  I     ++ L R   +P  E+ T Q
Sbjct  193  PLVLAVVLLFRLPESARYLVVRNRGSERVRQVLAPI--APAQVALARSFHVP--EQQTVQ  248

Query  239  HSSDIAKLFQGKQGFQTLCLWFAFFLVMFGFYFVMSWTPKILIAMGMSPSQGVTTGILIS  298
              +  A +F G     TL LW  +F+ +   Y + SW P ++   G S  Q    G L  
Sbjct  249  ARNVFAVIFSGTYSAGTLLLWLTYFMGLVIVYLLTSWLPTLMRDSGASLEQAAFIGALFQ  308

Query  299  IGGVFGAAIIGLLASRIKIFHALSLFLGLTAVCVWLFVAVSSQVSIALMVGLLLGTLING  358
             GGV  A  +G    R      + LF  L  V  W       QV++   + LL G  ING
Sbjct  309  FGGVLSAVAVGWAMDRFNPHKVIGLFYLLAGVFAWCVGQSLGQVTLLATLVLLAGMCING  368

Query  359  CVAGLYSISPTIYDADIRSRGVGYAIGFGRIGAILSPTVAGIFLDKG  405
              + + S++   Y    R+ GV + +G GR GAIL   +    L  G
Sbjct  369  AQSAMPSLAARFYPTQGRATGVSWMLGIGRFGAILGAWIGATLLGLG  415


> Q5EXK5 3-hydroxybenzoate transporter MhbT [Klebsiella oxytoca]
Length=452

 Score =  223 bits (569),  Expect = 3e-70
 Identities = 129/427 (30%), Positives = 217/427 (51%), Gaps = 7/427 (2%)

Query  9    INQNNMSRYQWFVIVVCVCLNIIDGFDVMVMAFTAPSVSAEWSLSGAQIGLLLSAGLFGM  68
            +N   +   QW VI+ C  + ++DGFD   + F AP + + W L+   +  L  AGL G+
Sbjct  11   LNAAPVGARQWRVIICCFLVVMLDGFDTAAIGFIAPDIRSHWQLTAGDLAPLFGAGLLGL  70

Query  69   AAGSIFLAPLADKIGRRLLILICLAIAGISMLACGLVHSHSMLAALRFVTGIGVGGILAS  128
             AG++   PL+D+ GR+ +I  C+A+ G+  L         ML  LRF+TG+G+GG + +
Sbjct  71   TAGALLCGPLSDRFGRKRVIEFCVALFGLFSLLSAFAPDLQMLVFLRFLTGLGLGGAMPN  130

Query  129  SNVLASEYANLRWRSLAVSLMSTGYGIGATLGGILSLLLIEHLGWRSIFLAGGVTTVVML  188
            +  + SEY   R R   V+LM  G+ +G+  GG++S  L+  +GW  I + GGV  +++ 
Sbjct  131  TITMTSEYLPARRRGALVTLMFCGFTLGSAFGGVVSAQLVPLIGWHGILVLGGVLPLILA  190

Query  189  LVSLWLLPESLDYLLAKKPKQALEKINLTVQRIGLVRLNALPQH---EKNTQQHSSDIAK  245
            +  + LLPES  + + ++  QA   I  TV  I   R N    H   ++        I++
Sbjct  191  VALVPLLPESPRWQIRRQLPQA--TIARTVGAITGERYN--DTHFWLDEPAAGAKGSISQ  246

Query  246  LFQGKQGFQTLCLWFAFFLVMFGFYFVMSWTPKILIAMGMSPSQGVTTGILISIGGVFGA  305
            LF G+Q   TL LW  FF+ +   Y + SW P +L   G+             IGG FGA
Sbjct  247  LFAGRQLAITLMLWVVFFMSLLIIYLLSSWMPTLLNHRGIDLQHASWVTAAFQIGGTFGA  306

Query  306  AIIGLLASRIKIFHALSLFLGLTAVCVWLFVAVSSQVSIALMVGLLLGTLINGCVAGLYS  365
             ++G+L  R   +  L+L  GL AVC+ +     + + +  +     G  I+G   GL +
Sbjct  307  LLLGVLMDRFNPYRVLALSYGLGAVCIVMIGLSENGLWLMALAIFGTGIGISGSQVGLNA  366

Query  366  ISPTIYDADIRSRGVGYAIGFGRIGAILSPTVAGIFLDKGLAPSTLYAYYGIVFILAIFL  425
            ++ T+Y    R+ GV ++   GR GAI+     G+ +    +  TL+    +  +++  +
Sbjct  367  LTATLYPTQSRATGVSWSNAVGRCGAIVGSLSGGVMMAMNFSFDTLFFVIAVPAVVSAVM  426

Query  426  ILSLSKA  432
            ++ L+ A
Sbjct  427  LILLTLA  433


> Q43975 4-hydroxybenzoate transporter PcaK [Acinetobacter baylyi 
(strain ATCC 33305 / BD413 / ADP1)]
Length=457

 Score =  218 bits (555),  Expect = 3e-68
 Identities = 128/407 (31%), Positives = 204/407 (50%), Gaps = 13/407 (3%)

Query  4    DILSEINQNNMSRYQWFVIVVCVCLNIIDGFDVMVMAFTAPSVSAEWSLSGAQIGLLLSA  63
            D  + IN   +SRYQW + +VC  +  +DG D   M F AP+++ +W +  +Q+G ++SA
Sbjct  20   DAQALINDAPLSRYQWLIAIVCFLIVFVDGIDTAAMGFIAPALAQDWGVDRSQLGPVMSA  79

Query  64   GLFGMAAGSIFLAPLADKIGRRLLILICLAIAGISMLACGLVHSHSMLAALRFVTGIGVG  123
             L GM  G++   P AD+ GR++++ + + + G   LAC    +   L   RF+TGIG+G
Sbjct  80   ALGGMIIGALVSGPTADRFGRKIVLSMSMLVFGGFTLACAYSTNLDSLVIFRFLTGIGLG  139

Query  124  GILASSNVLASEYANLRWRSLAVSLMSTGYGIGATLGGILSLLLIEHLGWRSIFLAGGVT  183
              + ++  L SEY   R RSL V+ M  GY +G  +GG +S  LI   GW S+FL GG  
Sbjct  140  AAMPNATTLFSEYCPARIRSLLVTCMFCGYNLGMAIGGFISSWLIPAFGWHSLFLLGGWA  199

Query  184  TVVMLLVSLWLLPESLDYLL-----AKKPKQALEKINLTVQRIGLVRLNALPQHEKNTQQ  238
             ++++L+ ++ LPES  +L+      KK +Q L +I    Q++  V    +P+ +     
Sbjct  200  PLILMLLVIFFLPESYRFLIVKGKNTKKVRQILSRI--APQKVQGVTEFHVPEEKVEAGT  257

Query  239  HSSDIAKLFQGKQGFQTLCLWFAFFLVMFGFYFVMSWTPKILIAMGMSPSQGVTTGILIS  298
                   LF  K    T+ LW  +F+ +   Y + SW P ++   G S  +    G L  
Sbjct  258  KKGVFGMLFSAKYVKGTVLLWVTYFMGLVMIYLLTSWLPTLMRETGASLERAAFLGGLFQ  317

Query  299  IGGVFGAAIIGLLASRI---KIFHALSLFLGLTAVCVWLFVAVSSQVSIALMVGLLLGTL  355
             GGV  A  IG    R    +I     L  G+ AV V    ++S+   +AL + L  G  
Sbjct  318  FGGVLSALFIGWAMDRFNPNRIIAGFYLAAGIFAVIVG--QSLSNPTLLALFI-LCAGIA  374

Query  356  INGCVAGLYSISPTIYDADIRSRGVGYAIGFGRIGAILSPTVAGIFL  402
            +NG  + +  +S   Y    R+ GV +  G GR GA+    +  + L
Sbjct  375  VNGAQSSMPVLSARFYPTQCRATGVAWMSGIGRFGAVFGAWIGAVLL  421


 Score = 18.9 bits (37),  Expect = 3.8
 Identities = 12/46 (26%), Positives = 20/46 (43%), Gaps = 0/46 (0%)

Query  385  GFGRIGAILSPTVAGIFLDKGLAPSTLYAYYGIVFILAIFLILSLS  430
            G  + G +LS    G  +D+      +  +Y    I A+ +  SLS
Sbjct  314  GLFQFGGVLSALFIGWAMDRFNPNRIIAGFYLAAGIFAVIVGQSLS  359


> Q51955 4-hydroxybenzoate transporter PcaK [Pseudomonas putida]
Length=448

 Score =  218 bits (554),  Expect = 4e-68
 Identities = 125/405 (31%), Positives = 200/405 (49%), Gaps = 5/405 (1%)

Query  4    DILSEINQNNMSRYQWFVIVVCVCLNIIDGFDVMVMAFTAPSVSAEWSLSGAQIGLLLSA  63
            D+ S INQ  +SRYQW V+++C  +  +DG D   M F AP++S EW +  A +G ++SA
Sbjct  13   DVQSFINQQPLSRYQWRVVLLCFLIVFLDGLDTAAMGFIAPALSQEWGIDRASLGPVMSA  72

Query  64   GLFGMAAGSIFLAPLADKIGRRLLILICLAIAGISMLACGLVHSHSMLAALRFVTGIGVG  123
             L GM  G++   PLAD+ GR+ +++  + + G   LA     +   L  LRF+TG+G+G
Sbjct  73   ALIGMVFGALGSGPLADRFGRKGVLVGAVLVFGGFSLASAYATNVDQLLVLRFLTGLGLG  132

Query  124  GILASSNVLASEYANLRWRSLAVSLMSTGYGIGATLGGILSLLLIEHLGWRSIFLAGGVT  183
              + ++  L SEY   R +SL V+ M  G+ +G   GG +S  +I   GW S+ + GGV 
Sbjct  133  AGMPNATTLLSEYTPERLKSLLVTSMFCGFNLGMAGGGFISAKMIPAYGWHSLLVIGGVL  192

Query  184  TVVMLLVSLWLLPESLDYLLAKKPKQALEKINLTVQRIG---LVRLNALPQHEKNTQQHS  240
             +++ LV +  LPES  +L+ +   +  +KI  T+  I    +    +    E+      
Sbjct  193  PLLLALVLMVWLPESARFLVVR--NRGTDKIRKTLSPIAPQVVAEAGSFSVPEQKAVAAR  250

Query  241  SDIAKLFQGKQGFQTLCLWFAFFLVMFGFYFVMSWTPKILIAMGMSPSQGVTTGILISIG  300
            S  A +F G  G  T+ LW  +F+ +   Y + SW P ++   G S  Q    G L   G
Sbjct  251  SVFAVIFSGTYGLGTMLLWLTYFMGLVIVYLLTSWLPTLMRDSGASMEQAAFIGALFQFG  310

Query  301  GVFGAAIIGLLASRIKIFHALSLFLGLTAVCVWLFVAVSSQVSIALMVGLLLGTLINGCV  360
            GV  A  +G    R      + +F  L  V  +        +++   + L+ G  +NG  
Sbjct  311  GVLSAVGVGWAMDRYNPHKVIGIFYLLAGVFAYAVGQSLGNITVLATLVLIAGMCVNGAQ  370

Query  361  AGLYSISPTIYDADIRSRGVGYAIGFGRIGAILSPTVAGIFLDKG  405
            + + S++   Y    R+ GV + +G GR GAIL        L  G
Sbjct  371  SAMPSLAARFYPTQGRATGVSWMLGIGRFGAILGAWSGATLLGLG  415


 Score = 18.5 bits (36),  Expect = 4.9
 Identities = 17/76 (22%), Positives = 32/76 (42%), Gaps = 2/76 (3%)

Query  237  QQHSSDIAKLFQGKQGFQTLCLWFAFFLVMFGFYFVMSWTPKILIAMGMSPSQGVTTGIL  296
            Q     +A  F   QG  T   W    +  FG   + +W+   L+ +G +  Q +T  ++
Sbjct  370  QSAMPSLAARFYPTQGRATGVSWM-LGIGRFGA-ILGAWSGATLLGLGWNFEQVLTALLV  427

Query  297  ISIGGVFGAAIIGLLA  312
             +     G  + GL++
Sbjct  428  PAALATVGVIVKGLVS  443


> O30513 Benzoate transport protein [Acinetobacter baylyi (strain 
ATCC 33305 / BD413 / ADP1)]
Length=466

 Score =  203 bits (517),  Expect = 1e-62
 Identities = 118/440 (27%), Positives = 217/440 (49%), Gaps = 16/440 (4%)

Query  9    INQNNMSRYQWFVIVVCVCLNIIDGFDVMVMAFTAPSVSAEWSLSGAQIGLLLSAGLFGM  68
            I+ + ++ + W VI++   + I DG+D+++     P +  EW++     G + S  LFGM
Sbjct  11   IDDSKLTPFHWRVIILSTLIIIFDGYDLVIYGVALPLLMKEWAIDPVTAGFIGSIALFGM  70

Query  69   AAGSIFLAPLADK-----IGRRLLILICLAIAGISMLACGLVHSHSMLAALRFVTGIGVG  123
              G++    +ADK     + R+ +I +C+ +  +  + CG   + +  +  RF+ G+G+G
Sbjct  71   MFGALIFGTIADKLEHLGVSRKKVIAVCIILFSLCTVLCGFSETTTQFSIFRFLAGVGIG  130

Query  124  GILASSNVLASEYANLRWRSLAVSLMSTGYGIGATLGGILSLLLIEHLGWRSIFLAGGVT  183
            G++ +   L SEYA  +++S  V+LM +GY IG      L  +L+   GW+ +F+  G+ 
Sbjct  131  GVMPNVIALVSEYAPKKFKSFFVTLMFSGYAIGGMTAAFLGSILVPLYGWKIMFMIAGI-  189

Query  184  TVVMLLVSLWLLPESLDYLLAKKPKQALEKINLTVQRIGLVRLNALPQH-----EKNTQQ  238
             +V+LL  + +LPES+DYL+ KK  + +  I   +    +      P H       N  Q
Sbjct  190  PLVLLLPLMKVLPESIDYLVRKKKDETVRFIMTKM----VPSYQYQPDHVFVLNSSNQNQ  245

Query  239  HSSDIAKLFQGKQGFQTLCLWFAFFLVMFGFYFVMSWTPKILIAMGMSPSQGVTTGILIS  298
              + +  +FQ ++ F T+  W + F+ +   Y + +W PK++I  G + S+ +     ++
Sbjct  246  AQAPVKMIFQEQRAFSTMMFWCSIFMTLIMVYALGNWLPKLMIEAGYNLSKSLIFLFSLN  305

Query  299  IGGVFGAAIIGLLASRIKIFHALSLFLGLTAVCVWLFVAVSSQVSIALMVGLLLGTLING  358
            +GG+ G+ + G LA R  +       L L A+ + L     S V + +++    G    G
Sbjct  306  VGGMIGSILGGYLADRYNVKFVTMGLLLLGAISLSLLSFQFSSVILYILIA-CAGAASIG  364

Query  359  CVAGLYSISPTIYDADIRSRGVGYAIGFGRIGAILSPTVAGIFLDKGLAPSTLYAYYGIV  418
                L +     Y  ++RS G+G+ +G GR+GAIL P + G  L   L     +    I 
Sbjct  365  AQIMLLAYMAKFYAPNVRSTGIGWGLGMGRVGAILGPILTGWLLSLQLPHFYNFLALSIP  424

Query  419  FILAIFLILSLSKAFYRQKE  438
             +L I  +  ++     Q E
Sbjct  425  AVLGIVTVFLINDRRMYQPE  444


> P77589 3-(3-hydroxy-phenyl)propionate transporter [Escherichia 
coli (strain K12)]
Length=403

 Score =  169 bits (427),  Expect = 2e-50
 Identities = 110/411 (27%), Positives = 194/411 (47%), Gaps = 39/411 (9%)

Query  22   IVVCVCLNIIDGFDVMVMAFTAPSVSAEWSLSGAQIGLLLSAGLFGMAAGSIFLAPLADK  81
            I +C  + +++G D+      A  ++  ++L   Q+G + SAG+ G+  G++    LAD+
Sbjct  17   IGLCFLVALMEGLDLQAAGIAAGGIAQAFALDKMQMGWIFSAGILGLLPGALVGGMLADR  76

Query  82   IGRRLLILICLAIAGISMLACGLVHSHSMLAALRFVTGIGVGGILASSNVLASEYANLRW  141
             GR+ +++  +A+ G+  LA  +      L   R +TG+G+G  L +   L SE A  R+
Sbjct  77   YGRKRILIGSVALFGLFSLATAIAWDFPSLVFARLMTGVGLGAALPNLIALTSEAAGPRF  136

Query  142  RSLAVSLMSTGYGIGATLGGILSLLLIEHLGWRSIFLAGGVTTVVMLLVSLWLLPESLDY  201
            R  AVSLM  G  IGA L   L      +L W+++F  GGV  ++++ + +  LPES  +
Sbjct  137  RGTAVSLMYCGVPIGAALAATLG-FAGANLAWQTVFWVGGVVPLILVPLLMRWLPESAVF  195

Query  202  LLAKKPKQALEKINLTVQRIGLVRLNALPQHEKNTQQHSSDIAKLFQGKQGFQTLCLWFA  261
                                               +Q +  +  LF  +    TL LW  
Sbjct  196  --------------------------------AGEKQSAPPLRALFAPETATATLLLWLC  223

Query  262  FFLVMFGFYFVMSWTPKILIAMGMSPSQGVTTGILISIGGVFGAAIIGLLASRIK-IFHA  320
            +F  +   Y +++W P +L+  G  PSQ       + +G   G  ++G L  +++ +  +
Sbjct  224  YFFTLLVVYMLINWLPLLLVEQGFQPSQAAGVMFALQMGAASGTLMLGALMDKLRPVTMS  283

Query  321  LSLFLGLTAVCVWLFVAVSSQVSIALMVGLLLGTLINGCVAGLYSISPTIYDADIRSRGV  380
            L ++ G+ A    L +   S  +  L+ G + G    G  + LY+++P  Y + IR+ GV
Sbjct  284  LLIYSGMLASL--LALGTVSSFNGMLLAGFVAGLFATGGQSVLYALAPLFYSSQIRATGV  341

Query  381  GYAIGFGRIGAILSPTVAGIFLDKGLAPSTLYAYYG---IVFILAIFLILS  428
            G A+  GR+GA+  P +AG  L  G     + A      +V  LA+F+++S
Sbjct  342  GTAVAVGRLGAMSGPLLAGKMLALGTGTVGVMAASAPGILVAGLAVFILMS  392


> Q8NLB7 Gentisate transporter [Corynebacterium glutamicum (strain 
ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025)]
Length=444

 Score =  152 bits (385),  Expect = 3e-44
 Identities = 94/423 (22%), Positives = 198/423 (47%), Gaps = 44/423 (10%)

Query  19   WFVIVVCVCLNIIDGFDVMVMAFTAPSVSAEWSLSGAQIGLLLSAGLFGMAAGSIFLAPL  78
            WF +       I DG+D++V      +++ EW+LS A +G + S   FGMA G++F+  L
Sbjct  48   WFFV-------IFDGYDLIVYGTVQSALAKEWNLSSATLGTIGSTAFFGMAIGAVFIGRL  100

Query  79   ADKIGRRLLILICLAIAGISMLACGLVHSHSMLAALRFVTGIGVGGILASSNVLASEYAN  138
            +D++GR+  ++  + I  +  + C    +  +  A RF+ G+G+GG++ S N + S+   
Sbjct  101  SDRVGRKAAVIGSVLILSVFTMLCAFAPNPWVFGAFRFIAGLGLGGLVPSVNAMTSDLVP  160

Query  139  LRWRSLAVSLMSTGYGIGATLGGILSLLLI---EHLGWRSIFLAGGVTTVVMLLVSLWLL  195
             +  S   ++M +G  IG ++  +L+L+++   E  GWR +FL   +  VV L +++ ++
Sbjct  161  RKTMSAWATVMMSGVPIGGSIAAVLALVVVPSSEEWGWRFMFLIALIPLVVGLPIAMKVI  220

Query  196  PESLDYLLAKKPKQALEKINLTVQRIGLVRLNALPQHEKNTQQHSSDIAKLFQGKQGFQT  255
            P                               A+       + H             ++ 
Sbjct  221  PSD----------------------------KAIKADHDIREGHDEPAGFKDLLVDRYRW  252

Query  256  LCLWFAF--FLVMFGFYFVMSWTPKILIAMGMSPSQGVTTGILISIGGVFGAAIIGLLAS  313
            + +WFA   F+ +  +Y + +W P+++   G      +   + +++G V G+ +      
Sbjct  253  ISIWFALATFVTLLAWYGLGTWLPRLMETAGYEFGHALMFTLALNLGAVIGSVVTAWAGD  312

Query  314  RIKIFHALSLFLGLTAVCVWLFVAVSSQVSIALMVGLLLGTLINGCVAGLYSISPTIYDA  373
            R     +  +  G+  + + L +     V+   ++ +L G   +G    + +     Y +
Sbjct  313  RFGPIRSGVIAAGIAGIAL-LLLLTYPPVTAVYVILILAGVGTHGTQILIIAAVANFYPS  371

Query  374  DIRSRGVGYAIGFGRIGAILSPTVAGIFLDKGLAPSTLYAYYG---IVFILAIFLILSLS  430
            ++R   +G+A+G GRIGA+++P +AG+ L   L  ++ +  +G   ++  LA+ ++L L 
Sbjct  372  NLRGTALGWALGVGRIGAVVAPQLAGLLLAWNLGVNSNFIMFGTAALLSALALSVLLRLQ  431

Query  431  KAF  433
            K +
Sbjct  432  KTY  434


 Score = 33.9 bits (76),  Expect = 8e-05
 Identities = 42/144 (29%), Positives = 63/144 (44%), Gaps = 7/144 (5%)

Query  67   GMAAGSIFLAPLADKIGRRLLILICLAIAGISMLACGLVHSHSMLAALRFVTGIGVGG--  124
            G   GS+  A   D+ G     +I   IAGI++L        + +  +  + G+G  G  
Sbjct  299  GAVIGSVVTAWAGDRFGPIRSGVIAAGIAGIALLLLLTYPPVTAVYVILILAGVGTHGTQ  358

Query  125  ILASSNVLASEYANLRWRSLAVSLMSTGYG-IGATLGGILS-LLLIEHLGWRSIFLAGGV  182
            IL  + V     +NLR  +L  +L   G G IGA +   L+ LLL  +LG  S F+  G 
Sbjct  359  ILIIAAVANFYPSNLRGTALGWAL---GVGRIGAVVAPQLAGLLLAWNLGVNSNFIMFGT  415

Query  183  TTVVMLLVSLWLLPESLDYLLAKK  206
              ++  L    LL     Y +  K
Sbjct  416  AALLSALALSVLLRLQKTYSVTHK  439


> O34691 Putative niacin/nicotinamide transporter NaiP [Bacillus 
subtilis (strain 168)]
Length=400

 Score =  137 bits (345),  Expect = 4e-39
 Identities = 108/405 (27%), Positives = 180/405 (44%), Gaps = 36/405 (9%)

Query  30   IIDGFDVMVMAFTAPSVSAEWSLSGAQIGLLLSAGLFGMAAGSIFLAPLADKIGRRLLIL  89
            + D  DV +++F   ++  EW+LS  ++  + S    GMAAG+     LAD+IGR+ + +
Sbjct  21   LFDAMDVGILSFIIAALHVEWNLSPEEMKWIGSVNSIGMAAGAFLFGLLADRIGRKKVFI  80

Query  90   ICLAIAGISMLACGLVHSHSMLAALRFVTGIGVGGILASSNVLASEYANLRWRSLAVSLM  149
            I L    I       V S S    LRFV G+G+GG L  ++ L SE      R   + L+
Sbjct  81   ITLLCFSIGSGISAFVTSLSAFLILRFVIGMGLGGELPVASTLVSEAVVPEKRGRVIVLL  140

Query  150  STGYGIGATLGGILSLLLIEHLGWRSIFLAGGVTTVVMLLVSLWLLPESLDYLLAKKPKQ  209
             + + +G     ++S  +I   GW++  L   +T    L +    LP+S  Y      K+
Sbjct  141  ESFWAVGWLAAALISYFVIPSFGWQAALLLTALTAFYALYLRT-SLPDSPKYESLSAKKR  199

Query  210  ALEKINLTVQRIGLVRLNALPQHEKNTQQHSSDIAKLFQGKQGFQTLCLWFAFFLVMFGF  269
            ++ +   +V     +R                             T+ L   +F V+F +
Sbjct  200  SMWENVKSVWARQYIR----------------------------PTVMLSIVWFCVVFSY  231

Query  270  YFVMSWTPKILIAMGMSPSQGVTTGILISIG---GVFGAAIIGLLASRIKIFHALSLFLG  326
            Y +  W P +++  G S  Q     +L+++    G F AA +   A R  I   L ++L 
Sbjct  232  YGMFLWLPSVMLLKGFSMIQSFEYVLLMTLAQLPGYFSAAWLIEKAGRKWI---LVVYLI  288

Query  327  LTAVCVWLFVAVSSQVSIALMVGLLLGTLINGCVAGLYSISPTIYDADIRSRGVGYAIGF  386
             TA   + F   +  +S+ L  G+LL     G    LY+ +P  Y   IR+ G G    F
Sbjct  289  GTAGSAYFF-GTADSLSLLLTAGVLLSFFNLGAWGVLYAYTPEQYPTAIRATGSGTTAAF  347

Query  387  GRIGAILSPTVAGIFLDKGLAPSTLYAYYGIVFILAIFLILSLSK  431
            GRIG I  P + G    + ++ S +++ + I  +LA+  IL + K
Sbjct  348  GRIGGIFGPLLVGTLAARHISFSVIFSIFCIAILLAVACILIMGK  392


 Score = 22.3 bits (46),  Expect = 0.31
 Identities = 33/145 (23%), Positives = 55/145 (38%), Gaps = 20/145 (14%)

Query  71   GSIFLAPLADKIGRRLLILICLAIAGISMLACGLVHSHSML---AALRFVTGIGVGGILA  127
            G    A L +K GR+ ++++ L     S    G   S S+L     L     +G  G+L 
Sbjct  266  GYFSAAWLIEKAGRKWILVVYLIGTAGSAYFFGTADSLSLLLTAGVLLSFFNLGAWGVLY  325

Query  128  SSNVLASEYANLRWRSLAVSLMSTGYGIGAT---LGGILSLLLIEHLGWRSIFLAGGVTT  184
            +                  ++ +TG G  A    +GGI   LL+  L  R I      + 
Sbjct  326  AYTP----------EQYPTAIRATGSGTTAAFGRIGGIFGPLLVGTLAARHI----SFSV  371

Query  185  VVMLLVSLWLLPESLDYLLAKKPKQ  209
            +  +     LL  +   ++ K+ KQ
Sbjct  372  IFSIFCIAILLAVACILIMGKETKQ  396


 Score = 17.7 bits (34),  Expect = 8.5
 Identities = 16/55 (29%), Positives = 22/55 (40%), Gaps = 2/55 (4%)

Query  15   SRYQWFVIVVCVCLNIIDGFDVMVMAFTAPSVSAEWSLSGAQIGLLLSAGLFGMA  69
            S  Q F  V+ + L  + G+     A+       +W L    IG   SA  FG A
Sbjct  248  SMIQSFEYVLLMTLAQLPGY--FSAAWLIEKAGRKWILVVYLIGTAGSAYFFGTA  300


> O24723 Probable 1-hydroxy-2-naphthoate transporter [Nocardioides 
sp. (strain KP7)]
Length=473

 Score =  128 bits (322),  Expect = 7e-36
 Identities = 107/448 (24%), Positives = 209/448 (47%), Gaps = 45/448 (10%)

Query  9    INQNNMSRYQWFVIVVCVCLNIIDGFDVMVMAFTAPSVSAEWSLSGAQIGLLLSAGLFGM  68
            ++   + R Q  ++++   + + DG D+ + +   P V  +W +  + + L++S G+  M
Sbjct  15   VDSQPIGRRQRIIVLMVFLIMVADGMDITLASHLFPPVIRDWGVPVSAVTLVVSLGVVAM  74

Query  69   AAGSIFLAPLADKIGRRLL-----ILICLAIAGISMLACGLVHSHSMLAALRFVTGIGVG  123
            A G++   P+AD+ GR+ +     +L CLA AG+ +   G +HS    AALR ++  G+G
Sbjct  75   AIGALVSGPVADRWGRKGVTVVGFVLFCLATAGLGLT--GDIHS---FAALRIISCFGLG  129

Query  124  GILASSNVLASEYANLRWRSLAVSLMSTGYGIGATLGGILSLLLIEHLGWRSIFLAGGVT  183
             ++  +  + +++     R+  VS+   G G+G+ +G  L+  +I  LGW+ + L  G+ 
Sbjct  130  AVMPVALTIVADWMPKARRAQMVSIAFAGVGVGSIIGAYLAAAVIPTLGWQVMVLIAGLA  189

Query  184  TVVMLLVSLWLLPESL--------------DYLLAKKPKQALEKINLTVQRIGLVRLNAL  229
             +++L   + L+PE                  L    P + +  ++LT  R GL     L
Sbjct  190  PLIILPFFVALVPEPAIISVRRGIPEARIRSALALVAPDRDIAGVDLT--RAGL----TL  243

Query  230  PQHEKNTQQHSSDIAKLFQGKQGFQTLCLWFAFFLVMFGFYFVMSWTPKILIAMGMSPSQ  289
               E   +   ++I  L +   G  TL +W  FF+V      V+ + P +L     +P+ 
Sbjct  244  GAGEVRAKALFAEI--LCRPLLGV-TLLIWGVFFVVQGSGLLVLQYMPMLL----QAPAP  296

Query  290  GVTT---GILISI---GGVFGAAIIGLLASRIKIFHALSLFLGLTAVCVWLFVAVSSQVS  343
            G++T   G+++++   G + G   I  +  R   F AL+ F+  + V + +  A  +   
Sbjct  297  GLSTVESGLIVAMYGWGALIGQLTIAFILKRFDRFIALAAFIFWSVVGLLIVAAFGTGFG  356

Query  344  IALMVGLL--LGTLINGCVAGLYSISPTIYDADIRSRGVGYAIGFGRIGAILSPTVAGIF  401
                  LL  +G  +    A + S++   Y+ + R+ G+G A   GR+G +    + G  
Sbjct  357  FFGYFTLLFAIGLSLPATAAAMQSVTTLAYEEEFRATGMGSAGFAGRLGTLTYGALGGTL  416

Query  402  LDKGLAPSTLYAYYGIVFILAIFLILSL  429
            +  G   +T+         ++I L+ SL
Sbjct  417  IGAGFGITTVSLVLAAPLAVSIGLVFSL  444


> P94131 Cis,cis-muconate transport protein [Acinetobacter baylyi 
(strain ATCC 33305 / BD413 / ADP1)]
Length=413

 Score =  116 bits (290),  Expect = 6e-32
 Identities = 94/383 (25%), Positives = 171/383 (45%), Gaps = 37/383 (10%)

Query  30   IIDGFDVMVMAFTAPSVSAEWSLSGAQIGLLLSAGLFGMAAGSIFLAPLADKIGRRLLIL  89
            ++DG D+M+++++  S+ AE++LS  + G+L S  L GMA G IF     D+ GR  +++
Sbjct  27   LVDGADLMLLSYSLNSIKAEFNLSTVEAGMLGSFTLAGMAIGGIFGGWACDRFGRVRIVV  86

Query  90   ICLAIAGISMLACGLVHSHSMLAALRFVTGIGVGGILASSNVLASEYANLRWRSLAVSLM  149
            I +    I     GL  S      LRF   +G+G +  + N L +EY   ++R+  +  +
Sbjct  87   ISILTFSILTCGLGLTQSFIQFGVLRFFASLGLGSLYIACNTLMAEYVPTKYRTTVLGTL  146

Query  150  STGYGIGATLGGILSLLLIEHLGWRSIFLAGGVTTVVMLLVSLWLLPESLDYLLAKKPKQ  209
              G+ +G  +  +L+  LI   GWR +F    +  V+M ++  + +PE   +   ++ + 
Sbjct  147  QAGWTVGYIVATLLAGWLIPDHGWRVLFYV-AIIPVLMAVLMHFFVPEPAAW---QQSRL  202

Query  210  ALEKINLTVQRIGLVRLNALPQHEKNTQQHSSDIAKLFQGKQGFQTLCLW-FAFFLVMFG  268
            A  K   TV+                    +S    +FQ K+      LW      + FG
Sbjct  203  APSKQTETVK--------------------TSAFKLIFQDKRNRNMFILWALTAGFLQFG  242

Query  269  FYFVMSWTPKILIA-MGMSPSQGVTTGILISIGGVFGAAIIGLLASRIKIFHALSLFLGL  327
            +Y V +W P  L + +GM   +     +      + G  + G +A ++      +     
Sbjct  243  YYGVNNWMPSYLESELGMKFKEMTAYMVGTYTAMILGKILAGFMADKLGRRFTYAFGAIG  302

Query  328  TAVCVWLFVAVSSQVSIALMVGLLLGTLINGCVAGL-YSISPTI----YDADIRSRGVGY  382
            TA+ + L V  +S  +I  ++      +I G + G+ Y ++ T     +   IR   +G 
Sbjct  303  TAIFLPLIVFYNSPDNILYLL------VIFGFLYGIPYGVNATYMTESFPTAIRGTAIGG  356

Query  383  AIGFGRIGAILSPTVAGIFLDKG  405
            A   GR+GA ++P   G     G
Sbjct  357  AYNVGRLGAAIAPATIGFLASGG  379


 Score = 17.7 bits (34),  Expect = 8.5
 Identities = 7/19 (37%), Positives = 10/19 (53%), Gaps = 0/19 (0%)

Query  263  FLVMFGFYFVMSWTPKILI  281
            F+VM   YF+    P + I
Sbjct  385  FVVMGAAYFICGVIPALFI  403



Lambda      K        H        a         alpha
   0.329    0.143    0.428    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1725600


  Database: 9bc0f12e84c11e318236e5f7722d0915.SwissProt.fasta
    Posted date:  Oct 1, 2020  6:12 AM
  Number of letters in database: 4,853
  Number of sequences in database:  11



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40