ACIAD0956 / TrEMBL Alignments

BLASTP 2.2.28+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: 41e32a3fe93a5be8345d49a58121dfc9.TrEMBL.fasta
           14 sequences; 4,515 total letters



Query= ACIAD0956

Length=90
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  Q6FDK9 Uncharacterized protein [Acinetobacter baylyi (strain AT...   169    1e-58
  A0A1C4GWS5 Uncharacterized protein [Acinetobacter albensis]          117    6e-36
  A0A031LUI6 Uncharacterized protein [Acinetobacter sp. Ver3]          103    3e-31
  A0A217EDD5 Uncharacterized protein [Acinetobacter apis]             79.0    3e-22
  A0A0M1I7Y9 Uncharacterized protein [Acinetobacter sp. C15]          77.0    2e-21
  A0A1P8EKS9 Uncharacterized protein [Acinetobacter soli]             77.0    2e-21
  N9C0G3 Uncharacterized protein [Acinetobacter soli NIPH 2899]       77.0    2e-21
  E3DHR2 Conserved uncharacterized protein [Erwinia sp. (strain E...  69.3    1e-18
  D2T9W7 CAP-Gly domain-containing linker protein 1 [Erwinia pyri...  69.3    1e-18
  E5B688 CAP-Gly domain-containing linker protein 1 [Erwinia amyl...  69.3    1e-18
  D4I447 CAP-Gly domain-containing linker protein 1 [Erwinia amyl...  69.3    1e-18
  V2TD48 Uncharacterized protein [Acinetobacter nectaris CIP 110549]  68.6    2e-18
  V5Z908 CAP-Gly domain-containing linker protein 1 [Erwinia piri...  68.2    4e-18
  B2VJ79 Uncharacterized protein [Erwinia tasmaniensis (strain DS...  67.8    6e-18


> Q6FDK9 Uncharacterized protein [Acinetobacter baylyi (strain 
ATCC 33305 / BD413 / ADP1)]
Length=89

 Score =  169 bits (427),  Expect = 1e-58
 Identities = 88/89 (99%), Positives = 89/89 (100%), Gaps = 0/89 (0%)

Query  1   LLSTILSRINNYLTEQEQFFNNLEINIQKAKVKYAQMKEEAKAKAAAATQAAAKAALWSF  60
           +LSTILSRINNYLTEQEQFFNNLEINIQKAKVKYAQMKEEAKAKAAAATQAAAKAALWSF
Sbjct  1   MLSTILSRINNYLTEQEQFFNNLEINIQKAKVKYAQMKEEAKAKAAAATQAAAKAALWSF  60

Query  61  IGLLIGLIVTMFTGKVGVDRILRTRTVVR  89
           IGLLIGLIVTMFTGKVGVDRILRTRTVVR
Sbjct  61  IGLLIGLIVTMFTGKVGVDRILRTRTVVR  89


> A0A1C4GWS5 Uncharacterized protein [Acinetobacter albensis]
Length=333

 Score =  117 bits (292),  Expect = 6e-36
 Identities = 55/81 (68%), Positives = 69/81 (85%), Gaps = 0/81 (0%)

Query  9    INNYLTEQEQFFNNLEINIQKAKVKYAQMKEEAKAKAAAATQAAAKAALWSFIGLLIGLI  68
            +NNY  +Q++FFN+LE N+QKAK++Y QMKEEAKAKAAAA+ AAAKAALWSFIGL IGL+
Sbjct  253  VNNYFIQQQEFFNSLETNVQKAKIQYIQMKEEAKAKAAAASNAAAKAALWSFIGLFIGLM  312

Query  69   VTMFTGKVGVDRILRTRTVVR  89
            VT+F GK GV  I R RT+++
Sbjct  313  VTVFAGKFGVTHISRHRTLIK  333


 Score = 16.5 bits (31),  Expect = 2.5
 Identities = 4/11 (36%), Positives = 8/11 (73%), Gaps = 0/11 (0%)

Query  57  LWSFIGLLIGL  67
           +W+ + LL+ L
Sbjct  61  IWTLLSLLVSL  71


 Score = 16.2 bits (30),  Expect = 3.4
 Identities = 6/19 (32%), Positives = 11/19 (58%), Gaps = 0/19 (0%)

Query  60  FIGLLIGLIVTMFTGKVGV  78
           F G++  L ++M    +GV
Sbjct  18  FAGVIAVLAISMLLSLLGV  36


> A0A031LUI6 Uncharacterized protein [Acinetobacter sp. Ver3]
Length=333

 Score =  103 bits (258),  Expect = 3e-31
 Identities = 48/71 (68%), Positives = 64/71 (90%), Gaps = 0/71 (0%)

Query  9    INNYLTEQEQFFNNLEINIQKAKVKYAQMKEEAKAKAAAATQAAAKAALWSFIGLLIGLI  68
            +NN+L +Q++FFN+LE NIQ AK+KYA++K++A+ KAA AT+AAAKAALWSFIGLLIGLI
Sbjct  253  VNNFLIQQDKFFNDLEANIQSAKLKYAELKDQAREKAANATKAAAKAALWSFIGLLIGLI  312

Query  69   VTMFTGKVGVD  79
            VT+F G+ GV+
Sbjct  313  VTIFAGRFGVN  323


 Score = 18.5 bits (36),  Expect = 0.56
 Identities = 6/17 (35%), Positives = 11/17 (65%), Gaps = 0/17 (0%)

Query  56  ALWSFIGLLIGLIVTMF  72
           ++W+ I LL+ L +  F
Sbjct  60  SVWTIISLLVSLAIGGF  76


 Score = 16.2 bits (30),  Expect = 3.4
 Identities = 5/19 (26%), Positives = 12/19 (63%), Gaps = 0/19 (0%)

Query  60  FIGLLIGLIVTMFTGKVGV  78
           F G+++ L +++    +GV
Sbjct  18  FAGVIVVLAISILLSLLGV  36


 Score = 16.2 bits (30),  Expect = 3.4
 Identities = 11/37 (30%), Positives = 18/37 (49%), Gaps = 3/37 (8%)

Query  21   NNLEINIQKAKVKYAQMKEEAKAKAAAATQAAAKAAL  57
            +N +  IQK      Q+K  A++  A+  +    AAL
Sbjct  205  DNSDAIIQKLS---EQLKTRAQSVTASINKNEVSAAL  238


> A0A217EDD5 Uncharacterized protein [Acinetobacter apis]
Length=333

 Score = 79.0 bits (193),  Expect = 3e-22
 Identities = 38/79 (48%), Positives = 57/79 (72%), Gaps = 7/79 (9%)

Query  9    INNYLTEQE-------QFFNNLEINIQKAKVKYAQMKEEAKAKAAAATQAAAKAALWSFI  61
            + N+L E+E       + F   E +I  AKVKY ++K++A+ KAA AT+AAAKAALW+FI
Sbjct  253  VENFLKEREVATQKVNEAFTQAEASINDAKVKYQELKQQAREKAAVATKAAAKAALWAFI  312

Query  62   GLLIGLIVTMFTGKVGVDR  80
            GL +G +V++F G+VGV++
Sbjct  313  GLFLGALVSIFAGRVGVNK  331


 Score = 17.3 bits (33),  Expect = 1.4
 Identities = 8/21 (38%), Positives = 14/21 (67%), Gaps = 1/21 (5%)

Query  57  LWSFIGLLIGL-IVTMFTGKV  76
           +W+ I LL+ L I +  +GK+
Sbjct  61  IWTGISLLVSLGIGSFISGKL  81


 Score = 16.2 bits (30),  Expect = 3.4
 Identities = 8/19 (42%), Positives = 10/19 (53%), Gaps = 0/19 (0%)

Query  60  FIGLLIGLIVTMFTGKVGV  78
           F G LI L V+     +GV
Sbjct  18  FAGTLIVLAVSFLLSILGV  36


> A0A0M1I7Y9 Uncharacterized protein [Acinetobacter sp. C15]
Length=337

 Score = 77.0 bits (188),  Expect = 2e-21
 Identities = 34/61 (56%), Positives = 48/61 (79%), Gaps = 0/61 (0%)

Query  17   EQFFNNLEINIQKAKVKYAQMKEEAKAKAAAATQAAAKAALWSFIGLLIGLIVTMFTGKV  76
            + FFN+L +NI  ++ KY Q+KE+ + +AAAA +AAAK ALWSFIGL IG++VT+F G+ 
Sbjct  271  QTFFNDLTVNINNSEKKYEQLKEQVREQAAAAAKAAAKTALWSFIGLFIGMLVTIFAGRF  330

Query  77   G  77
            G
Sbjct  331  G  331


 Score = 18.9 bits (37),  Expect = 0.42
 Identities = 8/17 (47%), Positives = 14/17 (82%), Gaps = 1/17 (6%)

Query  57   LWSFIGLLIGLIVTMFT  73
            +W+ + LLIGLI+++ T
Sbjct  94   VWA-LSLLIGLILSIMT  109


 Score = 17.3 bits (33),  Expect = 1.4
 Identities = 5/11 (45%), Positives = 8/11 (73%), Gaps = 0/11 (0%)

Query  57  LWSFIGLLIGL  67
           +W+ I LL+ L
Sbjct  62  IWTLISLLVSL  72


> A0A1P8EKS9 Uncharacterized protein [Acinetobacter soli]
Length=337

 Score = 77.0 bits (188),  Expect = 2e-21
 Identities = 34/61 (56%), Positives = 48/61 (79%), Gaps = 0/61 (0%)

Query  17   EQFFNNLEINIQKAKVKYAQMKEEAKAKAAAATQAAAKAALWSFIGLLIGLIVTMFTGKV  76
            + FFN+L +NI  ++ KY Q+KE+ + +AAAA +AAAK ALWSFIGL IG++VT+F G+ 
Sbjct  271  QTFFNDLTVNINNSEKKYEQLKEQVREQAAAAAKAAAKTALWSFIGLFIGMLVTIFAGRF  330

Query  77   G  77
            G
Sbjct  331  G  331


 Score = 18.9 bits (37),  Expect = 0.42
 Identities = 8/17 (47%), Positives = 14/17 (82%), Gaps = 1/17 (6%)

Query  57   LWSFIGLLIGLIVTMFT  73
            +W+ + LLIGLI+++ T
Sbjct  94   VWA-LSLLIGLILSIMT  109


 Score = 17.3 bits (33),  Expect = 1.4
 Identities = 5/11 (45%), Positives = 8/11 (73%), Gaps = 0/11 (0%)

Query  57  LWSFIGLLIGL  67
           +W+ I LL+ L
Sbjct  62  IWTLISLLVSL  72


> N9C0G3 Uncharacterized protein [Acinetobacter soli NIPH 2899]
Length=337

 Score = 77.0 bits (188),  Expect = 2e-21
 Identities = 34/61 (56%), Positives = 48/61 (79%), Gaps = 0/61 (0%)

Query  17   EQFFNNLEINIQKAKVKYAQMKEEAKAKAAAATQAAAKAALWSFIGLLIGLIVTMFTGKV  76
            + FFN+L +NI  ++ KY Q+KE+ + +AAAA +AAAK ALWSFIGL IG++VT+F G+ 
Sbjct  271  QTFFNDLTVNINNSEKKYEQLKEQVREQAAAAAKAAAKTALWSFIGLFIGMLVTIFAGRF  330

Query  77   G  77
            G
Sbjct  331  G  331


 Score = 18.9 bits (37),  Expect = 0.42
 Identities = 8/17 (47%), Positives = 14/17 (82%), Gaps = 1/17 (6%)

Query  57   LWSFIGLLIGLIVTMFT  73
            +W+ + LLIGLI+++ T
Sbjct  94   VWA-LSLLIGLILSIMT  109


 Score = 17.3 bits (33),  Expect = 1.4
 Identities = 5/11 (45%), Positives = 8/11 (73%), Gaps = 0/11 (0%)

Query  57  LWSFIGLLIGL  67
           +W+ I LL+ L
Sbjct  62  IWTLISLLVSL  72


> E3DHR2 Conserved uncharacterized protein [Erwinia sp. (strain 
Ejp617)]
Length=346

 Score = 69.3 bits (168),  Expect = 1e-18
 Identities = 35/71 (49%), Positives = 49/71 (69%), Gaps = 0/71 (0%)

Query  17   EQFFNNLEINIQKAKVKYAQMKEEAKAKAAAATQAAAKAALWSFIGLLIGLIVTMFTGKV  76
            +Q  + LE NI +AK +YA++K++AK KA AA +A AK ALWSF GLLIG IV+  +G  
Sbjct  274  DQRISQLEDNINQAKTQYAELKQQAKEKADAAAKAGAKVALWSFFGLLIGAIVSTLSGLW  333

Query  77   GVDRILRTRTV  87
            GV+ +   R +
Sbjct  334  GVNTLPGQRKI  344


 Score = 18.5 bits (36),  Expect = 0.56
 Identities = 9/20 (45%), Positives = 13/20 (65%), Gaps = 1/20 (5%)

Query  58  WSFIGLLIGLIVTMF-TGKV  76
           WS IG++I L    F TG++
Sbjct  62  WSVIGVIISLACGGFITGRL  81


> D2T9W7 CAP-Gly domain-containing linker protein 1 [Erwinia pyrifoliae 
(strain DSM 12163 / CIP 106111 / Ep16/96)]
Length=346

 Score = 69.3 bits (168),  Expect = 1e-18
 Identities = 35/71 (49%), Positives = 49/71 (69%), Gaps = 0/71 (0%)

Query  17   EQFFNNLEINIQKAKVKYAQMKEEAKAKAAAATQAAAKAALWSFIGLLIGLIVTMFTGKV  76
            +Q  + LE NI +AK +YA++K++AK KA AA +A AK ALWSF GLLIG IV+  +G  
Sbjct  274  DQRISQLEDNINQAKTQYAELKQQAKEKADAAAKAGAKVALWSFFGLLIGAIVSTLSGLW  333

Query  77   GVDRILRTRTV  87
            GV+ +   R +
Sbjct  334  GVNTLPGQRKI  344


 Score = 18.5 bits (36),  Expect = 0.56
 Identities = 9/20 (45%), Positives = 13/20 (65%), Gaps = 1/20 (5%)

Query  58  WSFIGLLIGLIVTMF-TGKV  76
           WS IG++I L    F TG++
Sbjct  62  WSVIGVIISLACGGFITGRL  81


> E5B688 CAP-Gly domain-containing linker protein 1 [Erwinia amylovora 
ATCC BAA-2158]
Length=346

 Score = 69.3 bits (168),  Expect = 1e-18
 Identities = 34/65 (52%), Positives = 47/65 (72%), Gaps = 0/65 (0%)

Query  17   EQFFNNLEINIQKAKVKYAQMKEEAKAKAAAATQAAAKAALWSFIGLLIGLIVTMFTGKV  76
            +Q  + LE NI +AK +YA++K++AK KA AA +A AK ALWSF GLLIG IV+  +G  
Sbjct  274  DQRLSQLEDNINQAKTQYAELKQQAKEKAEAAAKAGAKVALWSFFGLLIGAIVSTLSGLW  333

Query  77   GVDRI  81
            GV+ +
Sbjct  334  GVNTL  338


 Score = 18.5 bits (36),  Expect = 0.56
 Identities = 9/20 (45%), Positives = 13/20 (65%), Gaps = 1/20 (5%)

Query  58  WSFIGLLIGLIVTMF-TGKV  76
           WS IG++I L    F TG++
Sbjct  62  WSVIGVIISLACGGFITGRL  81


> D4I447 CAP-Gly domain-containing linker protein 1 [Erwinia amylovora 
(strain CFBP1430)]
Length=346

 Score = 69.3 bits (168),  Expect = 1e-18
 Identities = 34/65 (52%), Positives = 47/65 (72%), Gaps = 0/65 (0%)

Query  17   EQFFNNLEINIQKAKVKYAQMKEEAKAKAAAATQAAAKAALWSFIGLLIGLIVTMFTGKV  76
            +Q  + LE NI +AK +YA++K++AK KA AA +A AK ALWSF GLLIG IV+  +G  
Sbjct  274  DQRLSQLEDNINQAKTQYAELKQQAKEKAEAAAKAGAKVALWSFFGLLIGAIVSTLSGLW  333

Query  77   GVDRI  81
            GV+ +
Sbjct  334  GVNTL  338


 Score = 18.5 bits (36),  Expect = 0.56
 Identities = 9/20 (45%), Positives = 13/20 (65%), Gaps = 1/20 (5%)

Query  58  WSFIGLLIGLIVTMF-TGKV  76
           WS IG++I L    F TG++
Sbjct  62  WSVIGVIISLACGGFITGRL  81


> V2TD48 Uncharacterized protein [Acinetobacter nectaris CIP 110549]
Length=334

 Score = 68.6 bits (166),  Expect = 2e-18
 Identities = 33/76 (43%), Positives = 51/76 (67%), Gaps = 7/76 (9%)

Query  9    INNYLTEQE-------QFFNNLEINIQKAKVKYAQMKEEAKAKAAAATQAAAKAALWSFI  61
            + N+L E++         FN  +  I  AKVKY  +K++A+ KAA AT+ AAKAALW+F+
Sbjct  253  VENFLKERDTAVQKVNDAFNQAQATINDAKVKYQAIKQDAREKAAIATKLAAKAALWAFL  312

Query  62   GLLIGLIVTMFTGKVG  77
            GL +G +V++F+G +G
Sbjct  313  GLFLGALVSIFSGHLG  328


 Score = 19.6 bits (39),  Expect = 0.23
 Identities = 10/21 (48%), Positives = 14/21 (67%), Gaps = 1/21 (5%)

Query  57  LWSFIGLLIGLIVTMF-TGKV  76
           +W+ I LL+ L V  F TGK+
Sbjct  61  IWTGISLLVSLAVGGFITGKL  81


> V5Z908 CAP-Gly domain-containing linker protein 1 [Erwinia piriflorinigrans 
CFBP 5888]
Length=344

 Score = 68.2 bits (165),  Expect = 4e-18
 Identities = 32/65 (49%), Positives = 47/65 (72%), Gaps = 0/65 (0%)

Query  17   EQFFNNLEINIQKAKVKYAQMKEEAKAKAAAATQAAAKAALWSFIGLLIGLIVTMFTGKV  76
            +Q F+ LE N+ +AK +YA++K++AK KA AA +  AK ALWSF GLLIG +V+  +G  
Sbjct  274  KQRFSQLEDNLNQAKAQYAELKQQAKEKADAAAKVGAKVALWSFFGLLIGAVVSTLSGLW  333

Query  77   GVDRI  81
            GV+ +
Sbjct  334  GVNTL  338


 Score = 18.5 bits (36),  Expect = 0.56
 Identities = 9/20 (45%), Positives = 13/20 (65%), Gaps = 1/20 (5%)

Query  58  WSFIGLLIGLIVTMF-TGKV  76
           WS IG++I L    F TG++
Sbjct  62  WSVIGVIISLACGGFITGRL  81


> B2VJ79 Uncharacterized protein [Erwinia tasmaniensis (strain 
DSM 17950 / CIP 109463 / Et1/99)]
Length=354

 Score = 67.8 bits (164),  Expect = 6e-18
 Identities = 33/67 (49%), Positives = 47/67 (70%), Gaps = 0/67 (0%)

Query  15   EQEQFFNNLEINIQKAKVKYAQMKEEAKAKAAAATQAAAKAALWSFIGLLIGLIVTMFTG  74
            + +Q F  LE N+ +AK +YA++K++AK KA AA +  AK ALWSF GLLIG IV+  +G
Sbjct  280  QAKQRFAQLEDNLNQAKAQYAELKQQAKEKADAAAKVGAKVALWSFFGLLIGAIVSTLSG  339

Query  75   KVGVDRI  81
              GV+ +
Sbjct  340  LWGVNTL  346


 Score = 18.1 bits (35),  Expect = 0.76
 Identities = 8/20 (40%), Positives = 13/20 (65%), Gaps = 1/20 (5%)

Query  58  WSFIGLLIGLIVTMF-TGKV  76
           WS IG+++ L    F TG++
Sbjct  70  WSVIGVIVSLACGGFITGRL  89



Lambda      K        H        a         alpha
   0.329    0.137    0.372    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 226184


  Database: 41e32a3fe93a5be8345d49a58121dfc9.TrEMBL.fasta
    Posted date:  Oct 1, 2020  6:47 AM
  Number of letters in database: 4,515
  Number of sequences in database:  14



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40