ACIAD0956 / SwissProt Alignments

BLASTP 2.2.28+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: c23a11e599f0b764455e1153e136ac31.SwissProt.fasta
           1 sequences; 1,829 total letters



Query= ACIAD0956

Length=90
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  G5EBZ4 Protein let-418 [Caenorhabditis elegans]                     31.6    7e-06


> G5EBZ4 Protein let-418 [Caenorhabditis elegans]
Length=1829

 Score = 31.6 bits (70),  Expect = 7e-06
 Identities = 17/46 (37%), Positives = 28/46 (61%), Gaps = 0/46 (0%)

Query  12   YLTEQEQFFNNLEINIQKAKVKYAQMKEEAKAKAAAATQAAAKAAL  57
            ++ +QEQ  ++L  + + A++K A  +EE K  A  A +AA KA L
Sbjct  202  FIKQQEQLEDDLVKDKEDARIKRAAEREEKKKGALEAARAAKKAKL  247


 Score = 15.0 bits (27),  Expect = 3.6
 Identities = 5/25 (20%), Positives = 14/25 (56%), Gaps = 0/25 (0%)

Query  34    YAQMKEEAKAKAAAATQAAAKAALW  58
             +++  + A+ + +    AAA+  +W
Sbjct  1104  FSEDLDAAEGEGSEKKGAAAQEIVW  1128



Lambda      K        H        a         alpha
   0.329    0.137    0.372    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 109800


  Database: c23a11e599f0b764455e1153e136ac31.SwissProt.fasta
    Posted date:  Oct 1, 2020  5:43 AM
  Number of letters in database: 1,829
  Number of sequences in database:  1



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40