ACIAD0946 / TrEMBL Alignments

BLASTP 2.2.28+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: 80cdd0d858af2a84cde50e1aeb24349d.TrEMBL.fasta
           14 sequences; 27,720 total letters



Query= ACIAD0946

Length=82
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  Q6FDL7 Uncharacterized protein [Acinetobacter baylyi (strain AT...   159    3e-54
  N9ADZ9 Uncharacterized protein [Acinetobacter soli NIPH 2899]        100    5e-31
  N8XEP2 Uncharacterized protein [Acinetobacter bereziniae NIPH 3]    98.2    4e-29
  N9D9T2 PT-VENN domain-containing protein [Acinetobacter berezin...  87.8    3e-24
  A0A1B8U9D7 PT-VENN domain-containing protein [Acinetobacter gyl...  86.3    1e-23
  A0A0Q5GAE4 Uncharacterized protein [Acinetobacter sp. Leaf130]      76.3    5e-22
  A0A014B339 Hemagluttinin repeat family protein [Acinetobacter s...  83.2    5e-22
  A0A062NF23 Hemagluttinin repeat family protein [Acinetobacter s...  83.2    5e-22
  A0A014D4P5 Hemagluttinin repeat family protein [Acinetobacter s...  83.2    5e-22
  A0A014BPL0 Hemagluttinin repeat family protein [Acinetobacter s...  83.2    5e-22
  A0A062SRX1 Hemagluttinin repeat family protein [Acinetobacter b...  83.2    5e-22
  A0A143G5C2 Uncharacterized protein [Acinetobacter sp. TGL-Y2]       71.6    3e-20
  B0VP70 Putative hemagglutinin/hemolysin-related protein [Acinet...  64.3    2e-15
  A0A105Z1L4 Cell surface protein [Burkholderia ubonensis]            49.7    1e-10


> Q6FDL7 Uncharacterized protein [Acinetobacter baylyi (strain 
ATCC 33305 / BD413 / ADP1)]
Length=81

 Score =  159 bits (402),  Expect = 3e-54
 Identities = 81/81 (100%), Positives = 81/81 (100%), Gaps = 0/81 (0%)

Query  1   MLLISGEITKFPSTGLDVQMTNQWIISRTNELVKTKKPNALKTATLINQAINQGKPINKI  60
           MLLISGEITKFPSTGLDVQMTNQWIISRTNELVKTKKPNALKTATLINQAINQGKPINKI
Sbjct  1   MLLISGEITKFPSTGLDVQMTNQWIISRTNELVKTKKPNALKTATLINQAINQGKPINKI  60

Query  61  VVGVNEGRAVTINLGNKVIVK  81
           VVGVNEGRAVTINLGNKVIVK
Sbjct  61  VVGVNEGRAVTINLGNKVIVK  81


> N9ADZ9 Uncharacterized protein [Acinetobacter soli NIPH 2899]
Length=102

 Score =  100 bits (249),  Expect = 5e-31
 Identities = 53/73 (73%), Positives = 62/73 (85%), Gaps = 4/73 (5%)

Query  13   STGLDVQMTNQWIISRTNELVKTKKPNALKTATLINQAINQGKPINKI----VVGVNEGR  68
            STGLDVQM+++WIISRT EL  +   NA+KT+TLI+QAI +GKPI+KI    VVGVNEGR
Sbjct  30   STGLDVQMSDEWIISRTGELRTSDNANAIKTSTLIDQAIQKGKPISKIVVGVVVGVNEGR  89

Query  69   AVTINLGNKVIVK  81
            AVTINLGNKVIVK
Sbjct  90   AVTINLGNKVIVK  102


> N8XEP2 Uncharacterized protein [Acinetobacter bereziniae NIPH 
3]
Length=196

 Score = 98.2 bits (243),  Expect = 4e-29
 Identities = 45/69 (65%), Positives = 59/69 (86%), Gaps = 0/69 (0%)

Query  10   KFPSTGLDVQMTNQWIISRTNELVKTKKPNALKTATLINQAINQGKPINKIVVGVNEGRA  69
            K  +  + VQM+++WI+SRT  LVKTK P+A+KTATLI +A+N+GKPINKIVVGVN+ RA
Sbjct  126  KKSTNDIGVQMSDKWIVSRTEALVKTKNPDAIKTATLITKAVNEGKPINKIVVGVNDSRA  185

Query  70   VTINLGNKV  78
            +T+NLGNKV
Sbjct  186  ITLNLGNKV  194


> N9D9T2 PT-VENN domain-containing protein [Acinetobacter bereziniae 
LMG 1003 = CIP 70.12]
Length=470

 Score = 87.8 bits (216),  Expect = 3e-24
 Identities = 41/63 (65%), Positives = 53/63 (84%), Gaps = 0/63 (0%)

Query  16   LDVQMTNQWIISRTNELVKTKKPNALKTATLINQAINQGKPINKIVVGVNEGRAVTINLG  75
            + VQM+++WI SRT+ L +T  P+A+KTA LI+ A+ Q KPINKIV+GVNEGRAVT+NLG
Sbjct  406  IGVQMSDKWIKSRTSVLARTNNPDAIKTAKLISDAVEQSKPINKIVLGVNEGRAVTLNLG  465

Query  76   NKV  78
            NKV
Sbjct  466  NKV  468


> A0A1B8U9D7 PT-VENN domain-containing protein [Acinetobacter gyllenbergii]
Length=465

 Score = 86.3 bits (212),  Expect = 1e-23
 Identities = 46/68 (68%), Positives = 51/68 (75%), Gaps = 1/68 (1%)

Query  12   PSTGLDVQMTNQWIISRTNELVKTKKPNALK-TATLINQAINQGKPINKIVVGVNEGRAV  70
            PSTGLDVQM++ WI SR NEL   K  +A K T   + QAI  GKPINKIVVGVNEGRAV
Sbjct  397  PSTGLDVQMSDAWIKSRANELSNQKNNSAAKATGDKLLQAIENGKPINKIVVGVNEGRAV  456

Query  71   TINLGNKV  78
            T+NLGN V
Sbjct  457  TLNLGNNV  464


> A0A0Q5GAE4 Uncharacterized protein [Acinetobacter sp. Leaf130]
Length=61

 Score = 76.3 bits (186),  Expect = 5e-22
 Identities = 38/60 (63%), Positives = 48/60 (80%), Gaps = 0/60 (0%)

Query  20  MTNQWIISRTNELVKTKKPNALKTATLINQAINQGKPINKIVVGVNEGRAVTINLGNKVI  79
           M++ W+ SR   L  T   +A+KTA LI++AI QGKPINKIVVGVN+GRAVT++LGNKVI
Sbjct  1   MSDGWVKSRVVALKDTGSSDAIKTAELIDKAIKQGKPINKIVVGVNDGRAVTLSLGNKVI  60


> A0A014B339 Hemagluttinin repeat family protein [Acinetobacter 
sp. 25977_8]
Length=3021

 Score = 83.2 bits (204),  Expect = 5e-22
 Identities = 44/67 (66%), Positives = 49/67 (73%), Gaps = 1/67 (1%)

Query  16    LDVQMTNQWIISRTNELVKTKK-PNALKTATLINQAINQGKPINKIVVGVNEGRAVTINL  74
             + VQMTN+WIISR NEL  +K  P A  T   I QA+  GKPINKIVVGVN+ RAVTINL
Sbjct  2955  IGVQMTNEWIISRANELANSKNSPTAKATGNKILQAVEGGKPINKIVVGVNDSRAVTINL  3014

Query  75    GNKVIVK  81
             GNKV  K
Sbjct  3015  GNKVSSK  3021


 Score = 21.2 bits (43),  Expect = 0.38
 Identities = 8/28 (29%), Positives = 20/28 (71%), Gaps = 2/28 (7%)

Query  37    KPNALKTATLINQAINQGKPINKIVVGV  64
             K N ++T+   ++ +++GK + ++V+GV
Sbjct  2696  KANDIRTSN--DKYVSKGKNVGQVVIGV  2721


 Score = 18.9 bits (37),  Expect = 2.4
 Identities = 13/49 (27%), Positives = 23/49 (47%), Gaps = 4/49 (8%)

Query  17   DVQMTNQWIISRTNELVKTKKPNALKTATLINQAINQGKPINKIVVGVN  65
            + Q  +Q  +S    L+  ++   +++A L NQA      I  +  GVN
Sbjct  556  NAQFNSQNTLSNQAGLIAAQQQLMIQSAALNNQA----GQIGSVDAGVN  600


> A0A062NF23 Hemagluttinin repeat family protein [Acinetobacter 
sp. 796380-1375]
Length=4002

 Score = 83.2 bits (204),  Expect = 5e-22
 Identities = 44/67 (66%), Positives = 49/67 (73%), Gaps = 1/67 (1%)

Query  16    LDVQMTNQWIISRTNELVKTKK-PNALKTATLINQAINQGKPINKIVVGVNEGRAVTINL  74
             + VQMTN+WIISR NEL  +K  P A  T   I QA+  GKPINKIVVGVN+ RAVTINL
Sbjct  3936  IGVQMTNEWIISRANELANSKNSPTAKATGNKILQAVEGGKPINKIVVGVNDSRAVTINL  3995

Query  75    GNKVIVK  81
             GNKV  K
Sbjct  3996  GNKVSSK  4002


 Score = 21.2 bits (43),  Expect = 0.38
 Identities = 8/28 (29%), Positives = 20/28 (71%), Gaps = 2/28 (7%)

Query  37    KPNALKTATLINQAINQGKPINKIVVGV  64
             K N ++T+   ++ +++GK + ++V+GV
Sbjct  3677  KANDIRTSN--DKYVSKGKNVGQVVIGV  3702


 Score = 18.9 bits (37),  Expect = 2.4
 Identities = 13/49 (27%), Positives = 23/49 (47%), Gaps = 4/49 (8%)

Query  17    DVQMTNQWIISRTNELVKTKKPNALKTATLINQAINQGKPINKIVVGVN  65
             + Q  +Q  +S    L+  ++   +++A L NQA      I  +  GVN
Sbjct  1537  NAQFNSQNTLSNQAGLIAAQQQLMIQSAALNNQA----GQIGSVDAGVN  1581


 Score = 17.3 bits (33),  Expect = 7.9
 Identities = 16/75 (21%), Positives = 30/75 (40%), Gaps = 1/75 (1%)

Query  4    ISGEITKFPSTGLDVQMTNQWIISRTNELVKTKKPNALKTATLINQAINQGKPINKIVVG  63
            IS E     ++GL +   ++  +++ N L  +   NA +         N G      + G
Sbjct  379  ISIESQSLDNSGL-ISSADELRLNQQNSLSNSGTLNAARLVIDAGSLKNSGSIEQTGLQG  437

Query  64   VNEGRAVTINLGNKV  78
            ++       NLG K+
Sbjct  438  LDLKSGSMTNLGGKI  452


> A0A014D4P5 Hemagluttinin repeat family protein [Acinetobacter 
sp. 25977_4]
Length=4002

 Score = 83.2 bits (204),  Expect = 5e-22
 Identities = 44/67 (66%), Positives = 49/67 (73%), Gaps = 1/67 (1%)

Query  16    LDVQMTNQWIISRTNELVKTKK-PNALKTATLINQAINQGKPINKIVVGVNEGRAVTINL  74
             + VQMTN+WIISR NEL  +K  P A  T   I QA+  GKPINKIVVGVN+ RAVTINL
Sbjct  3936  IGVQMTNEWIISRANELANSKNSPTAKATGNKILQAVEGGKPINKIVVGVNDSRAVTINL  3995

Query  75    GNKVIVK  81
             GNKV  K
Sbjct  3996  GNKVSSK  4002


 Score = 21.2 bits (43),  Expect = 0.38
 Identities = 8/28 (29%), Positives = 20/28 (71%), Gaps = 2/28 (7%)

Query  37    KPNALKTATLINQAINQGKPINKIVVGV  64
             K N ++T+   ++ +++GK + ++V+GV
Sbjct  3677  KANDIRTSN--DKYVSKGKNVGQVVIGV  3702


 Score = 18.9 bits (37),  Expect = 2.4
 Identities = 13/49 (27%), Positives = 23/49 (47%), Gaps = 4/49 (8%)

Query  17    DVQMTNQWIISRTNELVKTKKPNALKTATLINQAINQGKPINKIVVGVN  65
             + Q  +Q  +S    L+  ++   +++A L NQA      I  +  GVN
Sbjct  1537  NAQFNSQNTLSNQAGLIAAQQQLMIQSAALNNQA----GQIGSVDAGVN  1581


 Score = 17.3 bits (33),  Expect = 7.9
 Identities = 16/75 (21%), Positives = 30/75 (40%), Gaps = 1/75 (1%)

Query  4    ISGEITKFPSTGLDVQMTNQWIISRTNELVKTKKPNALKTATLINQAINQGKPINKIVVG  63
            IS E     ++GL +   ++  +++ N L  +   NA +         N G      + G
Sbjct  379  ISIESQSLDNSGL-ISSADELRLNQQNSLSNSGTLNAARLVIDAGSLKNSGSIEQTGLQG  437

Query  64   VNEGRAVTINLGNKV  78
            ++       NLG K+
Sbjct  438  LDLKSGSMTNLGGKI  452


> A0A014BPL0 Hemagluttinin repeat family protein [Acinetobacter 
sp. 25977_6]
Length=4002

 Score = 83.2 bits (204),  Expect = 5e-22
 Identities = 44/67 (66%), Positives = 49/67 (73%), Gaps = 1/67 (1%)

Query  16    LDVQMTNQWIISRTNELVKTKK-PNALKTATLINQAINQGKPINKIVVGVNEGRAVTINL  74
             + VQMTN+WIISR NEL  +K  P A  T   I QA+  GKPINKIVVGVN+ RAVTINL
Sbjct  3936  IGVQMTNEWIISRANELANSKNSPTAKATGNKILQAVEGGKPINKIVVGVNDSRAVTINL  3995

Query  75    GNKVIVK  81
             GNKV  K
Sbjct  3996  GNKVSSK  4002


 Score = 21.2 bits (43),  Expect = 0.38
 Identities = 8/28 (29%), Positives = 20/28 (71%), Gaps = 2/28 (7%)

Query  37    KPNALKTATLINQAINQGKPINKIVVGV  64
             K N ++T+   ++ +++GK + ++V+GV
Sbjct  3677  KANDIRTSN--DKYVSKGKNVGQVVIGV  3702


 Score = 18.9 bits (37),  Expect = 2.4
 Identities = 13/49 (27%), Positives = 23/49 (47%), Gaps = 4/49 (8%)

Query  17    DVQMTNQWIISRTNELVKTKKPNALKTATLINQAINQGKPINKIVVGVN  65
             + Q  +Q  +S    L+  ++   +++A L NQA      I  +  GVN
Sbjct  1537  NAQFNSQNTLSNQAGLIAAQQQLMIQSAALNNQA----GQIGSVDAGVN  1581


 Score = 17.3 bits (33),  Expect = 7.9
 Identities = 16/75 (21%), Positives = 30/75 (40%), Gaps = 1/75 (1%)

Query  4    ISGEITKFPSTGLDVQMTNQWIISRTNELVKTKKPNALKTATLINQAINQGKPINKIVVG  63
            IS E     ++GL +   ++  +++ N L  +   NA +         N G      + G
Sbjct  379  ISIESQSLDNSGL-ISSADELRLNQQNSLSNSGTLNAARLVIDAGSLKNSGSIEQTGLQG  437

Query  64   VNEGRAVTINLGNKV  78
            ++       NLG K+
Sbjct  438  LDLKSGSMTNLGGKI  452


> A0A062SRX1 Hemagluttinin repeat family protein [Acinetobacter 
baumannii 25977_9]
Length=4002

 Score = 83.2 bits (204),  Expect = 5e-22
 Identities = 44/67 (66%), Positives = 49/67 (73%), Gaps = 1/67 (1%)

Query  16    LDVQMTNQWIISRTNELVKTKK-PNALKTATLINQAINQGKPINKIVVGVNEGRAVTINL  74
             + VQMTN+WIISR NEL  +K  P A  T   I QA+  GKPINKIVVGVN+ RAVTINL
Sbjct  3936  IGVQMTNEWIISRANELANSKNSPTAKATGNKILQAVEGGKPINKIVVGVNDSRAVTINL  3995

Query  75    GNKVIVK  81
             GNKV  K
Sbjct  3996  GNKVSSK  4002


 Score = 21.2 bits (43),  Expect = 0.38
 Identities = 8/28 (29%), Positives = 20/28 (71%), Gaps = 2/28 (7%)

Query  37    KPNALKTATLINQAINQGKPINKIVVGV  64
             K N ++T+   ++ +++GK + ++V+GV
Sbjct  3677  KANDIRTSN--DKYVSKGKNVGQVVIGV  3702


 Score = 18.9 bits (37),  Expect = 2.4
 Identities = 13/49 (27%), Positives = 23/49 (47%), Gaps = 4/49 (8%)

Query  17    DVQMTNQWIISRTNELVKTKKPNALKTATLINQAINQGKPINKIVVGVN  65
             + Q  +Q  +S    L+  ++   +++A L NQA      I  +  GVN
Sbjct  1537  NAQFNSQNTLSNQAGLIAAQQQLMIQSAALNNQA----GQIGSVDAGVN  1581


 Score = 17.3 bits (33),  Expect = 7.9
 Identities = 16/75 (21%), Positives = 30/75 (40%), Gaps = 1/75 (1%)

Query  4    ISGEITKFPSTGLDVQMTNQWIISRTNELVKTKKPNALKTATLINQAINQGKPINKIVVG  63
            IS E     ++GL +   ++  +++ N L  +   NA +         N G      + G
Sbjct  379  ISIESQSLDNSGL-ISSADELRLNQQNSLSNSGTLNAARLVIDAGSLKNSGSIEQTGLQG  437

Query  64   VNEGRAVTINLGNKV  78
            ++       NLG K+
Sbjct  438  LDLKSGSMTNLGGKI  452


> A0A143G5C2 Uncharacterized protein [Acinetobacter sp. TGL-Y2]
Length=61

 Score = 71.6 bits (174),  Expect = 3e-20
 Identities = 35/59 (59%), Positives = 45/59 (76%), Gaps = 0/59 (0%)

Query  20  MTNQWIISRTNELVKTKKPNALKTATLINQAINQGKPINKIVVGVNEGRAVTINLGNKV  78
           M+++WI SR   L  T    A+ TA LI+QA+ QGKPINKIVVGV++ RA+T+NLGNKV
Sbjct  1   MSDKWIKSRVLALSDTGNIEAINTAKLIDQAVKQGKPINKIVVGVSDSRAITLNLGNKV  59


> B0VP70 Putative hemagglutinin/hemolysin-related protein [Acinetobacter 
baumannii (strain SDF)]
Length=4086

 Score = 64.3 bits (155),  Expect = 2e-15
 Identities = 30/60 (50%), Positives = 45/60 (75%), Gaps = 0/60 (0%)

Query  16    LDVQMTNQWIISRTNELVKTKKPNALKTATLINQAINQGKPINKIVVGVNEGRAVTINLG  75
             + VQM+++WI SR   L ++   +++KTAT++ +A    KPINKIVVGVN+ RA+T+NLG
Sbjct  4022  IGVQMSDKWIDSRITALKESNNVDSMKTATILQKARLDKKPINKIVVGVNDSRAITLNLG  4081


 Score = 19.2 bits (38),  Expect = 1.8
 Identities = 12/35 (34%), Positives = 15/35 (43%), Gaps = 0/35 (0%)

Query  19    QMTNQWIISRTNELVKTKKPNALKTATLINQAINQ  53
             Q  NQ      N+LV+ +  N   TA  I    NQ
Sbjct  1385  QFNNQSGTIAANQLVQIQAKNLNNTAGKIRSEQNQ  1419


> A0A105Z1L4 Cell surface protein [Burkholderia ubonensis]
Length=3169

 Score = 49.7 bits (117),  Expect = 1e-10
 Identities = 22/63 (35%), Positives = 39/63 (62%), Gaps = 1/63 (2%)

Query  12    PSTGLDVQMTNQWIISRTNELVKTKKPNALKTATLINQAINQGKPINKIVVGVNEGRAVT  71
             P+TGL  Q T++W+ +    L K+K P+ +KT +++ +A   GK + K+V GV+  R V 
Sbjct  3103  PATGLPTQQTDEWVKNSIQTLKKSKNPDLVKTGSIVEKAFEDGKLV-KLVSGVDSNRMVI  3161

Query  72    INL  74
             + +
Sbjct  3162  VKI  3164



Lambda      K        H        a         alpha
   0.322    0.137    0.384    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1002330


  Database: 80cdd0d858af2a84cde50e1aeb24349d.TrEMBL.fasta
    Posted date:  Sep 21, 2020  5:01 AM
  Number of letters in database: 27,720
  Number of sequences in database:  14



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40