ACIAD0871 / TrEMBL Alignments

BLASTP 2.2.28+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: 6f12b3f814be77523cc6d31d2bfe8114.TrEMBL.fasta
           21 sequences; 5,181 total letters



Query= ACIAD0871

Length=245
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  Q6FDT8 3-oxoacyl-[acyl-carrier-protein] reductase [Acinetobacte...   468    2e-171
  N9S381 3-oxoacyl-[acyl-carrier-protein] reductase [Acinetobacte...   450    2e-164
  A0A009Z2N1 3-oxoacyl-[acyl-carrier-protein] reductase [Acinetob...   450    2e-164
  A0A0M1I2Y9 3-oxoacyl-[acyl-carrier-protein] reductase [Acinetob...   449    3e-164
  N9DGR3 3-oxoacyl-[acyl-carrier-protein] reductase [Acinetobacte...   449    6e-164
  A0A1P8EJ05 3-oxoacyl-[acyl-carrier-protein] reductase [Acinetob...   448    9e-164
  N9AI09 3-oxoacyl-[acyl-carrier-protein] reductase [Acinetobacte...   446    5e-163
  A0A010IQ71 3-oxoacyl-[acyl-carrier-protein] reductase [Acinetob...   440    1e-160
  A0A2T5QA32 3-oxoacyl-[acyl-carrier-protein] reductase [Acinetob...   439    4e-160
  N9QJ62 3-oxoacyl-[acyl-carrier-protein] reductase [Acinetobacte...   439    4e-160
  A0A009N3W3 3-oxoacyl-[acyl-carrier-protein] reductase [Acinetob...   439    5e-160
  A0A151YT84 3-oxoacyl-[acyl-carrier-protein] reductase [Acinetob...   439    5e-160
  A0A022J6W2 3-oxoacyl-[acyl-carrier-protein] reductase [Acinetob...   439    5e-160
  A5HIF6 3-oxoacyl-[acyl-carrier-protein] reductase [Pseudomonas ...   277    3e-96 
  Q4AE87 3-oxoacyl-[acyl-carrier-protein] reductase [Pseudomonas ...   275    2e-95 
  Q2FZ53 3-oxoacyl-[acyl-carrier-protein] reductase [Staphylococc...   234    1e-79 
  Q8I2S7 3-oxoacyl-[acyl-carrier-protein] reductase [Plasmodium f...   215    2e-71 
  Q86RB1 Oxoacyl-ACP reductase [Plasmodium falciparum (isolate 3D7)]   215    2e-71 
  Q9EZI2 Ketoacyl reductase [Xanthomonas albilineans]                  209    1e-70 
  Q6VAN4 3-oxoacyl-[acyl-carrier-protein] reductase [Brachyspira ...   211    2e-70 
  Q6LC18 3-oxoacyl-[acyl-carrier-protein] reductase [Brachyspira ...   205    3e-68 


> Q6FDT8 3-oxoacyl-[acyl-carrier-protein] reductase [Acinetobacter 
baylyi (strain ATCC 33305 / BD413 / ADP1)]
Length=244

 Score =  468 bits (1203),  Expect = 2e-171
 Identities = 244/244 (100%), Positives = 244/244 (100%), Gaps = 0/244 (0%)

Query  1    MTQQRKVALVTGASRGIGAAIAEQLIQDGFFVVGTATSESGAEKLAAQYGEQGTGLVLDV  60
            MTQQRKVALVTGASRGIGAAIAEQLIQDGFFVVGTATSESGAEKLAAQYGEQGTGLVLDV
Sbjct  1    MTQQRKVALVTGASRGIGAAIAEQLIQDGFFVVGTATSESGAEKLAAQYGEQGTGLVLDV  60

Query  61   RHLDEIEAVVTTIEQNYGPVLVLVNNAGITRDNLLLRMSEDDWDDILNIHLKAVYRLSKR  120
            RHLDEIEAVVTTIEQNYGPVLVLVNNAGITRDNLLLRMSEDDWDDILNIHLKAVYRLSKR
Sbjct  61   RHLDEIEAVVTTIEQNYGPVLVLVNNAGITRDNLLLRMSEDDWDDILNIHLKAVYRLSKR  120

Query  121  VLKGMTKARFGRIINISSVVAHFANPGQANYSAAKAGIEAFSRSLAKEMGSRQITVNSVA  180
            VLKGMTKARFGRIINISSVVAHFANPGQANYSAAKAGIEAFSRSLAKEMGSRQITVNSVA
Sbjct  121  VLKGMTKARFGRIINISSVVAHFANPGQANYSAAKAGIEAFSRSLAKEMGSRQITVNSVA  180

Query  181  PGFIATEMTDALSEDLRKKMSDQVALGRLGEPQDIANAVSFLASEKASYITGTVLHVNGG  240
            PGFIATEMTDALSEDLRKKMSDQVALGRLGEPQDIANAVSFLASEKASYITGTVLHVNGG
Sbjct  181  PGFIATEMTDALSEDLRKKMSDQVALGRLGEPQDIANAVSFLASEKASYITGTVLHVNGG  240

Query  241  LYMA  244
            LYMA
Sbjct  241  LYMA  244


> N9S381 3-oxoacyl-[acyl-carrier-protein] reductase [Acinetobacter 
ursingii NIPH 706]
Length=244

 Score =  450 bits (1157),  Expect = 2e-164
 Identities = 231/244 (95%), Positives = 240/244 (98%), Gaps = 0/244 (0%)

Query  1    MTQQRKVALVTGASRGIGAAIAEQLIQDGFFVVGTATSESGAEKLAAQYGEQGTGLVLDV  60
            MTQQRKVALVTGASRGIGAAIA+QL+QDGFFVVGTATSESGA+KL  Q+GEQG GLVLDV
Sbjct  1    MTQQRKVALVTGASRGIGAAIAQQLLQDGFFVVGTATSESGAQKLTEQFGEQGLGLVLDV  60

Query  61   RHLDEIEAVVTTIEQNYGPVLVLVNNAGITRDNLLLRMSEDDWDDILNIHLKAVYRLSKR  120
            RHLD+IEAVV+ IEQNYGPVLVLVNNAGITRDNLLLRMSEDDWDDILNIHLKAVYRLSKR
Sbjct  61   RHLDQIEAVVSNIEQNYGPVLVLVNNAGITRDNLLLRMSEDDWDDILNIHLKAVYRLSKR  120

Query  121  VLKGMTKARFGRIINISSVVAHFANPGQANYSAAKAGIEAFSRSLAKEMGSRQITVNSVA  180
            VLKGMTKARFGRIIN+SSVVAHFANPGQANYSAAKAGIEAFSRSLAKEMGSRQITVNSVA
Sbjct  121  VLKGMTKARFGRIINVSSVVAHFANPGQANYSAAKAGIEAFSRSLAKEMGSRQITVNSVA  180

Query  181  PGFIATEMTDALSEDLRKKMSDQVALGRLGEPQDIANAVSFLASEKASYITGTVLHVNGG  240
            PGFIATEMTD+LSEDLRKKMSDQVALGRLGEPQDIANAVSFLAS+KASYITGTVLHVNGG
Sbjct  181  PGFIATEMTDSLSEDLRKKMSDQVALGRLGEPQDIANAVSFLASDKASYITGTVLHVNGG  240

Query  241  LYMA  244
            LYMA
Sbjct  241  LYMA  244


> A0A009Z2N1 3-oxoacyl-[acyl-carrier-protein] reductase [Acinetobacter 
sp. 479375]
Length=244

 Score =  450 bits (1157),  Expect = 2e-164
 Identities = 231/244 (95%), Positives = 240/244 (98%), Gaps = 0/244 (0%)

Query  1    MTQQRKVALVTGASRGIGAAIAEQLIQDGFFVVGTATSESGAEKLAAQYGEQGTGLVLDV  60
            MTQQRKVALVTGASRGIGAAIA+QL+QDGFFVVGTATSESGA+KL  Q+GEQG GLVLDV
Sbjct  1    MTQQRKVALVTGASRGIGAAIAQQLLQDGFFVVGTATSESGAQKLTEQFGEQGLGLVLDV  60

Query  61   RHLDEIEAVVTTIEQNYGPVLVLVNNAGITRDNLLLRMSEDDWDDILNIHLKAVYRLSKR  120
            RHLD+IEAVV+ IEQNYGPVLVLVNNAGITRDNLLLRMSEDDWDDILNIHLKAVYRLSKR
Sbjct  61   RHLDQIEAVVSNIEQNYGPVLVLVNNAGITRDNLLLRMSEDDWDDILNIHLKAVYRLSKR  120

Query  121  VLKGMTKARFGRIINISSVVAHFANPGQANYSAAKAGIEAFSRSLAKEMGSRQITVNSVA  180
            VLKGMTKARFGRIIN+SSVVAHFANPGQANYSAAKAGIEAFSRSLAKEMGSRQITVNSVA
Sbjct  121  VLKGMTKARFGRIINVSSVVAHFANPGQANYSAAKAGIEAFSRSLAKEMGSRQITVNSVA  180

Query  181  PGFIATEMTDALSEDLRKKMSDQVALGRLGEPQDIANAVSFLASEKASYITGTVLHVNGG  240
            PGFIATEMTD+LSEDLRKKMSDQVALGRLGEPQDIANAVSFLAS+KASYITGTVLHVNGG
Sbjct  181  PGFIATEMTDSLSEDLRKKMSDQVALGRLGEPQDIANAVSFLASDKASYITGTVLHVNGG  240

Query  241  LYMA  244
            LYMA
Sbjct  241  LYMA  244


> A0A0M1I2Y9 3-oxoacyl-[acyl-carrier-protein] reductase [Acinetobacter 
sp. C15]
Length=244

 Score =  449 bits (1156),  Expect = 3e-164
 Identities = 232/244 (95%), Positives = 240/244 (98%), Gaps = 0/244 (0%)

Query  1    MTQQRKVALVTGASRGIGAAIAEQLIQDGFFVVGTATSESGAEKLAAQYGEQGTGLVLDV  60
            MTQQRKVALVTGASRGIGAAIA+QLIQDGFFVVGTATSESGAEKL+  +GEQGTGL LDV
Sbjct  1    MTQQRKVALVTGASRGIGAAIAQQLIQDGFFVVGTATSESGAEKLSESFGEQGTGLTLDV  60

Query  61   RHLDEIEAVVTTIEQNYGPVLVLVNNAGITRDNLLLRMSEDDWDDILNIHLKAVYRLSKR  120
            R+LDEIEAVV+ IEQNYGPVLVLVNNAGITRDNLLLRMSEDDWDDILNIHLKAVYRLSKR
Sbjct  61   RNLDEIEAVVSNIEQNYGPVLVLVNNAGITRDNLLLRMSEDDWDDILNIHLKAVYRLSKR  120

Query  121  VLKGMTKARFGRIINISSVVAHFANPGQANYSAAKAGIEAFSRSLAKEMGSRQITVNSVA  180
            VLKGMTKARFGRIINISSVVAHFANPGQANYSAAKAGIEAFSRSLAKEMGSRQITVNS+A
Sbjct  121  VLKGMTKARFGRIINISSVVAHFANPGQANYSAAKAGIEAFSRSLAKEMGSRQITVNSIA  180

Query  181  PGFIATEMTDALSEDLRKKMSDQVALGRLGEPQDIANAVSFLASEKASYITGTVLHVNGG  240
            PGFIATEMTDALSEDLRKKMSDQVALGRLGEPQDIANAVS+LAS+KASYITGTVLHVNGG
Sbjct  181  PGFIATEMTDALSEDLRKKMSDQVALGRLGEPQDIANAVSYLASDKASYITGTVLHVNGG  240

Query  241  LYMA  244
            LYMA
Sbjct  241  LYMA  244


> N9DGR3 3-oxoacyl-[acyl-carrier-protein] reductase [Acinetobacter 
ursingii ANC 3649]
Length=244

 Score =  449 bits (1154),  Expect = 6e-164
 Identities = 230/244 (94%), Positives = 239/244 (98%), Gaps = 0/244 (0%)

Query  1    MTQQRKVALVTGASRGIGAAIAEQLIQDGFFVVGTATSESGAEKLAAQYGEQGTGLVLDV  60
            MTQQRKVALVTGASRGIGAAIA+QL+QDGFFVVGTATSESGA+KL  Q+GEQG GL LDV
Sbjct  1    MTQQRKVALVTGASRGIGAAIAQQLLQDGFFVVGTATSESGAQKLTEQFGEQGVGLALDV  60

Query  61   RHLDEIEAVVTTIEQNYGPVLVLVNNAGITRDNLLLRMSEDDWDDILNIHLKAVYRLSKR  120
            RHLD+IEAVV+ IEQNYGPVLVLVNNAGITRDNLLLRMSEDDWDDILNIHLKAVYRLSKR
Sbjct  61   RHLDQIEAVVSNIEQNYGPVLVLVNNAGITRDNLLLRMSEDDWDDILNIHLKAVYRLSKR  120

Query  121  VLKGMTKARFGRIINISSVVAHFANPGQANYSAAKAGIEAFSRSLAKEMGSRQITVNSVA  180
            VLKGMTKARFGRIIN+SSVVAHFANPGQANYSAAKAGIEAFSRSLAKEMGSRQITVNSVA
Sbjct  121  VLKGMTKARFGRIINVSSVVAHFANPGQANYSAAKAGIEAFSRSLAKEMGSRQITVNSVA  180

Query  181  PGFIATEMTDALSEDLRKKMSDQVALGRLGEPQDIANAVSFLASEKASYITGTVLHVNGG  240
            PGFIATEMTD+LSEDLRKKMSDQVALGRLGEPQDIANAVSFLAS+KASYITGTVLHVNGG
Sbjct  181  PGFIATEMTDSLSEDLRKKMSDQVALGRLGEPQDIANAVSFLASDKASYITGTVLHVNGG  240

Query  241  LYMA  244
            LYMA
Sbjct  241  LYMA  244


> A0A1P8EJ05 3-oxoacyl-[acyl-carrier-protein] reductase [Acinetobacter 
soli]
Length=244

 Score =  448 bits (1153),  Expect = 9e-164
 Identities = 231/244 (95%), Positives = 240/244 (98%), Gaps = 0/244 (0%)

Query  1    MTQQRKVALVTGASRGIGAAIAEQLIQDGFFVVGTATSESGAEKLAAQYGEQGTGLVLDV  60
            MTQQRKVALVTGASRGIGAAIA+QLIQDGFFVVGTATSESGA+KL+  +GEQGTGL LDV
Sbjct  1    MTQQRKVALVTGASRGIGAAIAQQLIQDGFFVVGTATSESGAQKLSESFGEQGTGLTLDV  60

Query  61   RHLDEIEAVVTTIEQNYGPVLVLVNNAGITRDNLLLRMSEDDWDDILNIHLKAVYRLSKR  120
            R+LDEIEAVV+ IEQNYGPVLVLVNNAGITRDNLLLRMSEDDWDDILNIHLKAVYRLSKR
Sbjct  61   RNLDEIEAVVSNIEQNYGPVLVLVNNAGITRDNLLLRMSEDDWDDILNIHLKAVYRLSKR  120

Query  121  VLKGMTKARFGRIINISSVVAHFANPGQANYSAAKAGIEAFSRSLAKEMGSRQITVNSVA  180
            VLKGMTKARFGRIINISSVVAHFANPGQANYSAAKAGIEAFSRSLAKEMGSRQITVNS+A
Sbjct  121  VLKGMTKARFGRIINISSVVAHFANPGQANYSAAKAGIEAFSRSLAKEMGSRQITVNSIA  180

Query  181  PGFIATEMTDALSEDLRKKMSDQVALGRLGEPQDIANAVSFLASEKASYITGTVLHVNGG  240
            PGFIATEMTDALSEDLRKKMSDQVALGRLGEPQDIANAVS+LAS+KASYITGTVLHVNGG
Sbjct  181  PGFIATEMTDALSEDLRKKMSDQVALGRLGEPQDIANAVSYLASDKASYITGTVLHVNGG  240

Query  241  LYMA  244
            LYMA
Sbjct  241  LYMA  244


> N9AI09 3-oxoacyl-[acyl-carrier-protein] reductase [Acinetobacter 
soli NIPH 2899]
Length=244

 Score =  446 bits (1148),  Expect = 5e-163
 Identities = 231/244 (95%), Positives = 239/244 (98%), Gaps = 0/244 (0%)

Query  1    MTQQRKVALVTGASRGIGAAIAEQLIQDGFFVVGTATSESGAEKLAAQYGEQGTGLVLDV  60
            MTQQRKVALVTGASRGIGAAIA+QLIQDGFFVVGTATSESGAEKL+  +GEQGTGL LDV
Sbjct  1    MTQQRKVALVTGASRGIGAAIAQQLIQDGFFVVGTATSESGAEKLSESFGEQGTGLTLDV  60

Query  61   RHLDEIEAVVTTIEQNYGPVLVLVNNAGITRDNLLLRMSEDDWDDILNIHLKAVYRLSKR  120
            R+LDEIEAVV+ IEQNYG VLVLVNNAGITRDNLLLRMSEDDWDDILNIHLKAVYRLSKR
Sbjct  61   RNLDEIEAVVSNIEQNYGSVLVLVNNAGITRDNLLLRMSEDDWDDILNIHLKAVYRLSKR  120

Query  121  VLKGMTKARFGRIINISSVVAHFANPGQANYSAAKAGIEAFSRSLAKEMGSRQITVNSVA  180
            VLKGMTKARFGRIINISSVVAHFANPGQANYSAAKAGIEAFSRSLAKEMGSRQITVNS+A
Sbjct  121  VLKGMTKARFGRIINISSVVAHFANPGQANYSAAKAGIEAFSRSLAKEMGSRQITVNSIA  180

Query  181  PGFIATEMTDALSEDLRKKMSDQVALGRLGEPQDIANAVSFLASEKASYITGTVLHVNGG  240
            PGFIATEMTDALSEDLRKKMSDQVALGRLGEPQDIANAVS+LAS+KASYITGTVLHVNGG
Sbjct  181  PGFIATEMTDALSEDLRKKMSDQVALGRLGEPQDIANAVSYLASDKASYITGTVLHVNGG  240

Query  241  LYMA  244
            LYMA
Sbjct  241  LYMA  244


> A0A010IQ71 3-oxoacyl-[acyl-carrier-protein] reductase [Acinetobacter 
sp. 1542444]
Length=244

 Score =  440 bits (1132),  Expect = 1e-160
 Identities = 227/244 (93%), Positives = 238/244 (98%), Gaps = 0/244 (0%)

Query  1    MTQQRKVALVTGASRGIGAAIAEQLIQDGFFVVGTATSESGAEKLAAQYGEQGTGLVLDV  60
            MTQ+RKVALVTGASRGIGAAIA+QLIQDG+FVVGTATSESGA+KL+  +GEQG GLVLDV
Sbjct  1    MTQERKVALVTGASRGIGAAIAQQLIQDGYFVVGTATSESGAQKLSDSFGEQGAGLVLDV  60

Query  61   RHLDEIEAVVTTIEQNYGPVLVLVNNAGITRDNLLLRMSEDDWDDILNIHLKAVYRLSKR  120
            R+LDEIEAVV+ IEQNYGPVLVLVNNAGIT+DNLLLRMSEDDWDDILNIHLKAVYRLSKR
Sbjct  61   RNLDEIEAVVSHIEQNYGPVLVLVNNAGITKDNLLLRMSEDDWDDILNIHLKAVYRLSKR  120

Query  121  VLKGMTKARFGRIINISSVVAHFANPGQANYSAAKAGIEAFSRSLAKEMGSRQITVNSVA  180
            VLKGMTKARFGRIINISSVVAHFANPGQANYSAAKAGIEAFSRSLAKEMGSRQITVNSVA
Sbjct  121  VLKGMTKARFGRIINISSVVAHFANPGQANYSAAKAGIEAFSRSLAKEMGSRQITVNSVA  180

Query  181  PGFIATEMTDALSEDLRKKMSDQVALGRLGEPQDIANAVSFLASEKASYITGTVLHVNGG  240
            PGFIATEMTDALSED+RKKMSDQVAL RLGEPQDIANAVSFLAS+KA YITGTVLHVNGG
Sbjct  181  PGFIATEMTDALSEDIRKKMSDQVALNRLGEPQDIANAVSFLASDKAGYITGTVLHVNGG  240

Query  241  LYMA  244
            LYMA
Sbjct  241  LYMA  244


> A0A2T5QA32 3-oxoacyl-[acyl-carrier-protein] reductase [Acinetobacter 
oleivorans]
Length=244

 Score =  439 bits (1129),  Expect = 4e-160
 Identities = 226/244 (93%), Positives = 237/244 (97%), Gaps = 0/244 (0%)

Query  1    MTQQRKVALVTGASRGIGAAIAEQLIQDGFFVVGTATSESGAEKLAAQYGEQGTGLVLDV  60
            MTQ+RKVALVTGASRGIGAAIA+QLIQDG+FVVGTATSESGA+KL+  +GEQG GL LDV
Sbjct  1    MTQERKVALVTGASRGIGAAIAQQLIQDGYFVVGTATSESGAQKLSESFGEQGAGLALDV  60

Query  61   RHLDEIEAVVTTIEQNYGPVLVLVNNAGITRDNLLLRMSEDDWDDILNIHLKAVYRLSKR  120
            R+LDEIEAVV+ IEQNYGPVLVLVNNAGIT+DNLLLRMSEDDWDDILNIHLKAVYRLSKR
Sbjct  61   RNLDEIEAVVSHIEQNYGPVLVLVNNAGITKDNLLLRMSEDDWDDILNIHLKAVYRLSKR  120

Query  121  VLKGMTKARFGRIINISSVVAHFANPGQANYSAAKAGIEAFSRSLAKEMGSRQITVNSVA  180
            VLKGMTKARFGRIINISSVVAHFANPGQANYSAAKAGIEAFSRSLAKEMGSRQITVNSVA
Sbjct  121  VLKGMTKARFGRIINISSVVAHFANPGQANYSAAKAGIEAFSRSLAKEMGSRQITVNSVA  180

Query  181  PGFIATEMTDALSEDLRKKMSDQVALGRLGEPQDIANAVSFLASEKASYITGTVLHVNGG  240
            PGFIATEMTDALSED+RKKMSDQVAL RLGEPQDIANAVSFLAS+KA YITGTVLHVNGG
Sbjct  181  PGFIATEMTDALSEDIRKKMSDQVALNRLGEPQDIANAVSFLASDKAGYITGTVLHVNGG  240

Query  241  LYMA  244
            LYMA
Sbjct  241  LYMA  244


> N9QJ62 3-oxoacyl-[acyl-carrier-protein] reductase [Acinetobacter 
sp. NIPH 542]
Length=244

 Score =  439 bits (1129),  Expect = 4e-160
 Identities = 226/244 (93%), Positives = 237/244 (97%), Gaps = 0/244 (0%)

Query  1    MTQQRKVALVTGASRGIGAAIAEQLIQDGFFVVGTATSESGAEKLAAQYGEQGTGLVLDV  60
            MTQ+RKVALVTGASRGIGAAIA+QLIQDG+FVVGTATSESGA+KL+  +GEQG GL LDV
Sbjct  1    MTQERKVALVTGASRGIGAAIAQQLIQDGYFVVGTATSESGAQKLSESFGEQGAGLALDV  60

Query  61   RHLDEIEAVVTTIEQNYGPVLVLVNNAGITRDNLLLRMSEDDWDDILNIHLKAVYRLSKR  120
            R+LDEIEAVV+ IEQNYGPVLVLVNNAGIT+DNLLLRMSEDDWDDILNIHLKAVYRLSKR
Sbjct  61   RNLDEIEAVVSHIEQNYGPVLVLVNNAGITKDNLLLRMSEDDWDDILNIHLKAVYRLSKR  120

Query  121  VLKGMTKARFGRIINISSVVAHFANPGQANYSAAKAGIEAFSRSLAKEMGSRQITVNSVA  180
            VLKGMTKARFGRIINISSVVAHFANPGQANYSAAKAGIEAFSRSLAKEMGSRQITVNSVA
Sbjct  121  VLKGMTKARFGRIINISSVVAHFANPGQANYSAAKAGIEAFSRSLAKEMGSRQITVNSVA  180

Query  181  PGFIATEMTDALSEDLRKKMSDQVALGRLGEPQDIANAVSFLASEKASYITGTVLHVNGG  240
            PGFIATEMTDALSED+RKKMSDQVAL RLGEPQDIANAVSFLAS+KA YITGTVLHVNGG
Sbjct  181  PGFIATEMTDALSEDIRKKMSDQVALNRLGEPQDIANAVSFLASDKAGYITGTVLHVNGG  240

Query  241  LYMA  244
            LYMA
Sbjct  241  LYMA  244


> A0A009N3W3 3-oxoacyl-[acyl-carrier-protein] reductase [Acinetobacter 
sp. 1475718]
Length=244

 Score =  439 bits (1128),  Expect = 5e-160
 Identities = 226/244 (93%), Positives = 237/244 (97%), Gaps = 0/244 (0%)

Query  1    MTQQRKVALVTGASRGIGAAIAEQLIQDGFFVVGTATSESGAEKLAAQYGEQGTGLVLDV  60
            MTQ+RKVALVTGASRGIGAAIA+QLIQDG+FVVGTATSESGA+KL+  +GEQG GL LDV
Sbjct  1    MTQERKVALVTGASRGIGAAIAQQLIQDGYFVVGTATSESGAQKLSDSFGEQGAGLALDV  60

Query  61   RHLDEIEAVVTTIEQNYGPVLVLVNNAGITRDNLLLRMSEDDWDDILNIHLKAVYRLSKR  120
            R+LDEIEAVV+ IEQNYGPVLVLVNNAGIT+DNLLLRMSEDDWDDILNIHLKAVYRLSKR
Sbjct  61   RNLDEIEAVVSHIEQNYGPVLVLVNNAGITKDNLLLRMSEDDWDDILNIHLKAVYRLSKR  120

Query  121  VLKGMTKARFGRIINISSVVAHFANPGQANYSAAKAGIEAFSRSLAKEMGSRQITVNSVA  180
            VLKGMTKARFGRIINISSVVAHFANPGQANYSAAKAGIEAFSRSLAKEMGSRQITVNSVA
Sbjct  121  VLKGMTKARFGRIINISSVVAHFANPGQANYSAAKAGIEAFSRSLAKEMGSRQITVNSVA  180

Query  181  PGFIATEMTDALSEDLRKKMSDQVALGRLGEPQDIANAVSFLASEKASYITGTVLHVNGG  240
            PGFIATEMTDALSED+RKKMSDQVAL RLGEPQDIANAVSFLAS+KA YITGTVLHVNGG
Sbjct  181  PGFIATEMTDALSEDIRKKMSDQVALNRLGEPQDIANAVSFLASDKAGYITGTVLHVNGG  240

Query  241  LYMA  244
            LYMA
Sbjct  241  LYMA  244


> A0A151YT84 3-oxoacyl-[acyl-carrier-protein] reductase [Acinetobacter 
lactucae]
Length=244

 Score =  439 bits (1128),  Expect = 5e-160
 Identities = 226/244 (93%), Positives = 237/244 (97%), Gaps = 0/244 (0%)

Query  1    MTQQRKVALVTGASRGIGAAIAEQLIQDGFFVVGTATSESGAEKLAAQYGEQGTGLVLDV  60
            MTQ+RKVALVTGASRGIGAAIA+QLIQDG+FVVGTATSESGA+KL+  +GEQG GL LDV
Sbjct  1    MTQERKVALVTGASRGIGAAIAQQLIQDGYFVVGTATSESGAQKLSDSFGEQGAGLALDV  60

Query  61   RHLDEIEAVVTTIEQNYGPVLVLVNNAGITRDNLLLRMSEDDWDDILNIHLKAVYRLSKR  120
            R+LDEIEAVV+ IEQNYGPVLVLVNNAGIT+DNLLLRMSEDDWDDILNIHLKAVYRLSKR
Sbjct  61   RNLDEIEAVVSHIEQNYGPVLVLVNNAGITKDNLLLRMSEDDWDDILNIHLKAVYRLSKR  120

Query  121  VLKGMTKARFGRIINISSVVAHFANPGQANYSAAKAGIEAFSRSLAKEMGSRQITVNSVA  180
            VLKGMTKARFGRIINISSVVAHFANPGQANYSAAKAGIEAFSRSLAKEMGSRQITVNSVA
Sbjct  121  VLKGMTKARFGRIINISSVVAHFANPGQANYSAAKAGIEAFSRSLAKEMGSRQITVNSVA  180

Query  181  PGFIATEMTDALSEDLRKKMSDQVALGRLGEPQDIANAVSFLASEKASYITGTVLHVNGG  240
            PGFIATEMTDALSED+RKKMSDQVAL RLGEPQDIANAVSFLAS+KA YITGTVLHVNGG
Sbjct  181  PGFIATEMTDALSEDIRKKMSDQVALNRLGEPQDIANAVSFLASDKAGYITGTVLHVNGG  240

Query  241  LYMA  244
            LYMA
Sbjct  241  LYMA  244


> A0A022J6W2 3-oxoacyl-[acyl-carrier-protein] reductase [Acinetobacter 
sp. 1564232]
Length=244

 Score =  439 bits (1128),  Expect = 5e-160
 Identities = 226/244 (93%), Positives = 237/244 (97%), Gaps = 0/244 (0%)

Query  1    MTQQRKVALVTGASRGIGAAIAEQLIQDGFFVVGTATSESGAEKLAAQYGEQGTGLVLDV  60
            MTQ+RKVALVTGASRGIGAAIA+QLIQDG+FVVGTATSESGA+KL+  +GEQG GL LDV
Sbjct  1    MTQERKVALVTGASRGIGAAIAQQLIQDGYFVVGTATSESGAQKLSDSFGEQGAGLALDV  60

Query  61   RHLDEIEAVVTTIEQNYGPVLVLVNNAGITRDNLLLRMSEDDWDDILNIHLKAVYRLSKR  120
            R+LDEIEAVV+ IEQNYGPVLVLVNNAGIT+DNLLLRMSEDDWDDILNIHLKAVYRLSKR
Sbjct  61   RNLDEIEAVVSHIEQNYGPVLVLVNNAGITKDNLLLRMSEDDWDDILNIHLKAVYRLSKR  120

Query  121  VLKGMTKARFGRIINISSVVAHFANPGQANYSAAKAGIEAFSRSLAKEMGSRQITVNSVA  180
            VLKGMTKARFGRIINISSVVAHFANPGQANYSAAKAGIEAFSRSLAKEMGSRQITVNSVA
Sbjct  121  VLKGMTKARFGRIINISSVVAHFANPGQANYSAAKAGIEAFSRSLAKEMGSRQITVNSVA  180

Query  181  PGFIATEMTDALSEDLRKKMSDQVALGRLGEPQDIANAVSFLASEKASYITGTVLHVNGG  240
            PGFIATEMTDALSED+RKKMSDQVAL RLGEPQDIANAVSFLAS+KA YITGTVLHVNGG
Sbjct  181  PGFIATEMTDALSEDIRKKMSDQVALNRLGEPQDIANAVSFLASDKAGYITGTVLHVNGG  240

Query  241  LYMA  244
            LYMA
Sbjct  241  LYMA  244


> A5HIF6 3-oxoacyl-[acyl-carrier-protein] reductase [Pseudomonas 
putida]
Length=246

 Score =  277 bits (708),  Expect = 3e-96
 Identities = 144/246 (59%), Positives = 187/246 (76%), Gaps = 3/246 (1%)

Query  1    MTQQRKVALVTGASRGIGAAIAEQLIQDGFFVVGTATSESGAEKLAA---QYGEQGTGLV  57
            M+ Q KVALVTGASRGIG AIA +L + G  V+GTATS SGAE++AA   ++G  GTG+ 
Sbjct  1    MSLQGKVALVTGASRGIGQAIALELGRQGATVIGTATSASGAERIAATLKEHGITGTGME  60

Query  58   LDVRHLDEIEAVVTTIEQNYGPVLVLVNNAGITRDNLLLRMSEDDWDDILNIHLKAVYRL  117
            L+V   + +EAV+  I + +G   +LVNNAGITRDNL+LRM +D+W D+++ +L ++YRL
Sbjct  61   LNVTSAESVEAVLAAIGEQFGAPAILVNNAGITRDNLMLRMKDDEWFDVIDTNLNSLYRL  120

Query  118  SKRVLKGMTKARFGRIINISSVVAHFANPGQANYSAAKAGIEAFSRSLAKEMGSRQITVN  177
            SK VL+GMTKAR+GRII+I SVV    N GQANY+AAKAG+E FSR+LA+E+GSR ITVN
Sbjct  121  SKGVLRGMTKARWGRIISIGSVVGAMGNAGQANYAAAKAGLEGFSRALAREVGSRGITVN  180

Query  178  SVAPGFIATEMTDALSEDLRKKMSDQVALGRLGEPQDIANAVSFLASEKASYITGTVLHV  237
            SV PGFI T+MT  L E  R+ +  Q+ LGRLG+  +IA  VSFLAS+ A Y+TG  + V
Sbjct  181  SVTPGFIDTDMTRELPEAQREALQTQIPLGRLGQADEIAKVVSFLASDGAGYVTGATVPV  240

Query  238  NGGLYM  243
            NGG+YM
Sbjct  241  NGGMYM  246


> Q4AE87 3-oxoacyl-[acyl-carrier-protein] reductase [Pseudomonas 
sp. 61-3]
Length=247

 Score =  275 bits (703),  Expect = 2e-95
 Identities = 143/247 (58%), Positives = 190/247 (77%), Gaps = 3/247 (1%)

Query  1    MTQQRKVALVTGASRGIGAAIAEQLIQDGFFVVGTATSESGAEKLAA---QYGEQGTGLV  57
            M+ Q KVALVTGASRGIG AIA +L + G  V+GTATS SGAE++AA   + G QGTGL 
Sbjct  1    MSLQGKVALVTGASRGIGQAIALELGRQGAVVIGTATSASGAERIAATLKENGIQGTGLE  60

Query  58   LDVRHLDEIEAVVTTIEQNYGPVLVLVNNAGITRDNLLLRMSEDDWDDILNIHLKAVYRL  117
            L+V   + + AV+ +I+   G   +LVNNAGITRDNL++RM +D+W D+++ +L +++RL
Sbjct  61   LNVTSDESVAAVLASIQGTVGAPAILVNNAGITRDNLMMRMKDDEWHDVVDTNLNSLFRL  120

Query  118  SKRVLKGMTKARFGRIINISSVVAHFANPGQANYSAAKAGIEAFSRSLAKEMGSRQITVN  177
            SK VL+GMTKAR+GRII+I SVV    N GQ NY+AAKAG+E FSR+LA+E+GSR ITVN
Sbjct  121  SKGVLRGMTKARWGRIISIGSVVGAMGNAGQVNYAAAKAGLEGFSRALAREVGSRSITVN  180

Query  178  SVAPGFIATEMTDALSEDLRKKMSDQVALGRLGEPQDIANAVSFLASEKASYITGTVLHV  237
            SVAPGFI T+MT  L E  R+ +  Q+ LGRLG+ Q+IA+ V+FLAS+ A+Y+TG  + V
Sbjct  181  SVAPGFIDTDMTRELPEAQRESLVTQIPLGRLGQAQEIAHVVAFLASDGAAYVTGATIPV  240

Query  238  NGGLYMA  244
            NGG+YM+
Sbjct  241  NGGMYMS  247


> Q2FZ53 3-oxoacyl-[acyl-carrier-protein] reductase [Staphylococcus 
aureus (strain NCTC 8325)]
Length=244

 Score =  234 bits (597),  Expect = 1e-79
 Identities = 122/242 (50%), Positives = 169/242 (70%), Gaps = 4/242 (2%)

Query  6    KVALVTGASRGIGAAIAEQLIQDGFFV-VGTATSESGAEKLAAQYGEQGT---GLVLDVR  61
            K ALVTGASRGIG +IA QL ++G+ V V  A S+  AE +  +   +G     +  +V 
Sbjct  3    KSALVTGASRGIGRSIALQLAEEGYNVAVNYAGSKEKAEAVVEEIKAKGVDSFAIQANVA  62

Query  62   HLDEIEAVVTTIEQNYGPVLVLVNNAGITRDNLLLRMSEDDWDDILNIHLKAVYRLSKRV  121
              DE++A++  +   +G + VLVNNAGITRDNLL+RM E +WDD+++ +LK V+   ++ 
Sbjct  63   DADEVKAMIKEVVSQFGSLDVLVNNAGITRDNLLMRMKEQEWDDVIDTNLKGVFNCIQKA  122

Query  122  LKGMTKARFGRIINISSVVAHFANPGQANYSAAKAGIEAFSRSLAKEMGSRQITVNSVAP  181
               M + R G IIN+SSVV    NPGQANY A KAG+   ++S A+E+ SR ITVN+VAP
Sbjct  123  TPQMLRQRSGAIINLSSVVGAVGNPGQANYVATKAGVIGLTKSAARELASRGITVNAVAP  182

Query  182  GFIATEMTDALSEDLRKKMSDQVALGRLGEPQDIANAVSFLASEKASYITGTVLHVNGGL  241
            GFI ++MTDALS++L+++M  Q+ L R G+  DIAN V+FLAS+KA YITG  +HVNGG+
Sbjct  183  GFIVSDMTDALSDELKEQMLTQIPLARFGQDTDIANTVAFLASDKAKYITGQTIHVNGGM  242

Query  242  YM  243
            YM
Sbjct  243  YM  244


> Q8I2S7 3-oxoacyl-[acyl-carrier-protein] reductase [Plasmodium 
falciparum (isolate 3D7)]
Length=301

 Score =  215 bits (547),  Expect = 2e-71
 Identities = 107/241 (44%), Positives = 162/241 (67%), Gaps = 3/241 (1%)

Query  4    QRKVALVTGASRGIGAAIAEQLIQDGFFVVGTATSESGAEKLAAQ---YGEQGTGLVLDV  60
            + KVALVTGA RGIG  IA+ L +    V+  + ++   + +  +   +G + +G   DV
Sbjct  59   ENKVALVTGAGRGIGREIAKMLAKSVSHVICISRTQKSCDSVVDEIKSFGYESSGYAGDV  118

Query  61   RHLDEIEAVVTTIEQNYGPVLVLVNNAGITRDNLLLRMSEDDWDDILNIHLKAVYRLSKR  120
               +EI  V+  I   +  V +LVNNAGITRDNL LRM  D+W+D+L  +L +++ +++ 
Sbjct  119  SKKEEISEVINKILTEHKNVDILVNNAGITRDNLFLRMKNDEWEDVLRTNLNSLFYITQP  178

Query  121  VLKGMTKARFGRIINISSVVAHFANPGQANYSAAKAGIEAFSRSLAKEMGSRQITVNSVA  180
            + K M   R+GRIINISS+V    N GQANYS++KAG+  F++SLAKE+ SR ITVN++A
Sbjct  179  ISKRMINNRYGRIINISSIVGLTGNVGQANYSSSKAGVIGFTKSLAKELASRNITVNAIA  238

Query  181  PGFIATEMTDALSEDLRKKMSDQVALGRLGEPQDIANAVSFLASEKASYITGTVLHVNGG  240
            PGFI+++MTD +SE ++K +   +  GR+G P+++AN   FL+S+K+ YI G V  ++GG
Sbjct  239  PGFISSDMTDKISEQIKKNIISNIPAGRMGTPEEVANLACFLSSDKSGYINGRVFVIDGG  298

Query  241  L  241
            L
Sbjct  299  L  299


> Q86RB1 Oxoacyl-ACP reductase [Plasmodium falciparum (isolate 
3D7)]
Length=304

 Score =  215 bits (547),  Expect = 2e-71
 Identities = 107/241 (44%), Positives = 162/241 (67%), Gaps = 3/241 (1%)

Query  4    QRKVALVTGASRGIGAAIAEQLIQDGFFVVGTATSESGAEKLAAQ---YGEQGTGLVLDV  60
            + KVALVTGA RGIG  IA+ L +    V+  + ++   + +  +   +G + +G   DV
Sbjct  62   ENKVALVTGAGRGIGREIAKMLAKSVSHVICISRTQKSCDSVVDEIKSFGYESSGYAGDV  121

Query  61   RHLDEIEAVVTTIEQNYGPVLVLVNNAGITRDNLLLRMSEDDWDDILNIHLKAVYRLSKR  120
               +EI  V+  I   +  V +LVNNAGITRDNL LRM  D+W+D+L  +L +++ +++ 
Sbjct  122  SKKEEISEVINKILTEHKNVDILVNNAGITRDNLFLRMKNDEWEDVLRTNLNSLFYITQP  181

Query  121  VLKGMTKARFGRIINISSVVAHFANPGQANYSAAKAGIEAFSRSLAKEMGSRQITVNSVA  180
            + K M   R+GRIINISS+V    N GQANYS++KAG+  F++SLAKE+ SR ITVN++A
Sbjct  182  ISKRMINNRYGRIINISSIVGLTGNVGQANYSSSKAGVIGFTKSLAKELASRNITVNAIA  241

Query  181  PGFIATEMTDALSEDLRKKMSDQVALGRLGEPQDIANAVSFLASEKASYITGTVLHVNGG  240
            PGFI+++MTD +SE ++K +   +  GR+G P+++AN   FL+S+K+ YI G V  ++GG
Sbjct  242  PGFISSDMTDKISEQIKKNIISNIPAGRMGTPEEVANLACFLSSDKSGYINGRVFVIDGG  301

Query  241  L  241
            L
Sbjct  302  L  302


> Q9EZI2 Ketoacyl reductase [Xanthomonas albilineans]
Length=169

 Score =  209 bits (531),  Expect = 1e-70
 Identities = 106/167 (63%), Positives = 131/167 (78%), Gaps = 0/167 (0%)

Query  77   YGPVLVLVNNAGITRDNLLLRMSEDDWDDILNIHLKAVYRLSKRVLKGMTKARFGRIINI  136
            +GPV +LVNNAGITRD LL+RM ++DW  I++ +L +V+R SK VL+GM KAR GRI+NI
Sbjct  2    FGPVSILVNNAGITRDTLLMRMRDEDWQAIIDTNLTSVFRTSKAVLRGMMKARKGRIVNI  61

Query  137  SSVVAHFANPGQANYSAAKAGIEAFSRSLAKEMGSRQITVNSVAPGFIATEMTDALSEDL  196
            +SVV    NPGQANY+AAKAGI AFS+S+AKE+GSR ITVN VAPGFI T+MT AL E  
Sbjct  62   ASVVGVTGNPGQANYAAAKAGIIAFSKSMAKEIGSRGITVNVVAPGFIDTDMTKALPEAQ  121

Query  197  RKKMSDQVALGRLGEPQDIANAVSFLASEKASYITGTVLHVNGGLYM  243
            R  +  Q+ALG+LG+  DIA+AV+FL    A YITG  LHVNGG+YM
Sbjct  122  RTALLQQIALGQLGQTADIAHAVAFLVGPCAGYITGETLHVNGGMYM  168


> Q6VAN4 3-oxoacyl-[acyl-carrier-protein] reductase [Brachyspira 
pilosicoli]
Length=249

 Score =  211 bits (537),  Expect = 2e-70
 Identities = 112/244 (46%), Positives = 161/244 (66%), Gaps = 4/244 (2%)

Query  4    QRKVALVTGASRGIGAAIAEQLIQDGFFVVGTATS----ESGAEKLAAQYGEQGTGLVLD  59
            + K+ALVTG SRGIG  IAE L  +G  VV TAT+    +  A++L ++Y  +   LV D
Sbjct  6    KNKIALVTGGSRGIGKKIAEALANEGANVVVTATNINKAQEVADELKSKYNVETLALVHD  65

Query  60   VRHLDEIEAVVTTIEQNYGPVLVLVNNAGITRDNLLLRMSEDDWDDILNIHLKAVYRLSK  119
            V+  +  + VV    + +G + +LVNNAGITRD L+++M +  W+D+++ +L   +  S+
Sbjct  66   VKSSESCKDVVAKTIEKFGSIDILVNNAGITRDMLVIQMDDSAWNDVIDTNLSGAFYTSR  125

Query  120  RVLKGMTKARFGRIINISSVVAHFANPGQANYSAAKAGIEAFSRSLAKEMGSRQITVNSV  179
               K M +AR G+IINISSV+    N GQ NY+AAKAGI   ++S+AKE   R I VN++
Sbjct  126  EAAKSMLRARKGKIINISSVIGKMGNAGQVNYAAAKAGIIGITKSMAKEFAPRGICVNAI  185

Query  180  APGFIATEMTDALSEDLRKKMSDQVALGRLGEPQDIANAVSFLASEKASYITGTVLHVNG  239
            APGFI T+MT  L+ED  KK+ D   L +LG  +D+AN V FLAS+ ++YITG V+ V+G
Sbjct  186  APGFIQTDMTGVLAEDAVKKIMDITPLKKLGNAEDVANIVVFLASDLSNYITGEVIAVDG  245

Query  240  GLYM  243
            G+ M
Sbjct  246  GMSM  249


> Q6LC18 3-oxoacyl-[acyl-carrier-protein] reductase [Brachyspira 
hyodysenteriae]
Length=249

 Score =  205 bits (522),  Expect = 3e-68
 Identities = 108/244 (44%), Positives = 158/244 (65%), Gaps = 4/244 (2%)

Query  4    QRKVALVTGASRGIGAAIAEQLIQDGFFVVGTATS----ESGAEKLAAQYGEQGTGLVLD  59
            + K A+VTG+SRGIG  IAE L ++G  VV TAT+       AE++ + +  +   L  D
Sbjct  6    KNKTAIVTGSSRGIGKKIAETLAKEGVNVVITATNFEKASQVAEEIKSSFNVETLALQHD  65

Query  60   VRHLDEIEAVVTTIEQNYGPVLVLVNNAGITRDNLLLRMSEDDWDDILNIHLKAVYRLSK  119
             +  +  + V+    + +G + +LVNNAGIT+D L+L+M ++ W+D+++ +L   + +S+
Sbjct  66   AKSSESCKEVIAKTIEKFGSIDILVNNAGITKDMLVLQMEDNAWNDVISTNLSGTFYMSR  125

Query  120  RVLKGMTKARFGRIINISSVVAHFANPGQANYSAAKAGIEAFSRSLAKEMGSRQITVNSV  179
               K M +AR G+IINISSV+    N GQ NYSAAKAGI   ++S+AKE   R I VN++
Sbjct  126  EAAKSMLRARKGKIINISSVIGKMGNAGQVNYSAAKAGIIGMTKSMAKEFAPRNICVNAI  185

Query  180  APGFIATEMTDALSEDLRKKMSDQVALGRLGEPQDIANAVSFLASEKASYITGTVLHVNG  239
            APGFI T+MT  L ED  K +     L RLG P+D++N V FLAS+ +SYITG V+ V+G
Sbjct  186  APGFIQTDMTGVLPEDTVKGIMSITPLKRLGTPEDVSNLVLFLASDMSSYITGEVIAVDG  245

Query  240  GLYM  243
            G+ M
Sbjct  246  GMSM  249



Lambda      K        H        a         alpha
   0.319    0.133    0.366    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 855657


  Database: 6f12b3f814be77523cc6d31d2bfe8114.TrEMBL.fasta
    Posted date:  Sep 19, 2020  10:48 AM
  Number of letters in database: 5,181
  Number of sequences in database:  21



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40