ACIAD0871 / SwissProt Alignments

BLASTP 2.2.28+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: abd9c5aab9412d7a36a22aaafe7ca3d1.SwissProt.fasta
           21 sequences; 5,222 total letters



Query= ACIAD0871

Length=245
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  P43713 3-oxoacyl-[acyl-carrier-protein] reductase FabG [Haemoph...   281    7e-98
  P55336 3-oxoacyl-[acyl-carrier-protein] reductase FabG [Vibrio ...   278    1e-96
  Q9KQH7 3-oxoacyl-[acyl-carrier-protein] reductase FabG [Vibrio ...   276    7e-96
  O54438 3-oxoacyl-[acyl-carrier-protein] reductase FabG [Pseudom...   274    3e-95
  P0A2D0 3-oxoacyl-[acyl-carrier-protein] reductase FabG [Salmone...   271    3e-94
  P0A2C9 3-oxoacyl-[acyl-carrier-protein] reductase FabG [Salmone...   271    3e-94
  P0AEK3 3-oxoacyl-[acyl-carrier-protein] reductase FabG [Shigell...   268    5e-93
  P0AEK2 3-oxoacyl-[acyl-carrier-protein] reductase FabG [Escheri...   268    5e-93
  P0A0H9 3-oxoacyl-[acyl-carrier-protein] reductase FabG [Staphyl...   234    1e-79
  Q6GHK4 3-oxoacyl-[acyl-carrier-protein] reductase FabG [Staphyl...   234    1e-79
  Q6G9Y2 3-oxoacyl-[acyl-carrier-protein] reductase FabG [Staphyl...   234    1e-79
  P0A0I0 3-oxoacyl-[acyl-carrier-protein] reductase FabG [Staphyl...   234    1e-79
  P99093 3-oxoacyl-[acyl-carrier-protein] reductase FabG [Staphyl...   234    1e-79
  Q5HPW0 3-oxoacyl-[acyl-carrier-protein] reductase FabG [Staphyl...   231    3e-78
  Q8CPI3 3-oxoacyl-[acyl-carrier-protein] reductase FabG [Staphyl...   231    3e-78
  P51831 3-oxoacyl-[acyl-carrier-protein] reductase FabG [Bacillu...   227    1e-76
  O67610 3-oxoacyl-[acyl-carrier-protein] reductase FabG [Aquifex...   224    8e-76
  P72332 Nodulation protein G [Rhizobium sp. (strain N33)]             203    2e-67
  P06234 Nodulation protein G [Rhizobium meliloti (strain 1021)]       197    2e-65
  P28643 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplasti...   199    5e-65
  P73574 3-oxoacyl-[acyl-carrier-protein] reductase [Synechocysti...   197    5e-65


> P43713 3-oxoacyl-[acyl-carrier-protein] reductase FabG [Haemophilus 
influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)]
Length=242

 Score =  281 bits (718),  Expect = 7e-98
 Identities = 141/241 (59%), Positives = 184/241 (76%), Gaps = 0/241 (0%)

Query  4    QRKVALVTGASRGIGAAIAEQLIQDGFFVVGTATSESGAEKLAAQYGEQGTGLVLDVRHL  63
            Q K+ALVTG++RGIG AIAE+L   G FV+GTATSE GAE ++A  G++G GLVL+V   
Sbjct  2    QGKIALVTGSTRGIGRAIAEELSSKGAFVIGTATSEKGAEAISAYLGDKGKGLVLNVTDK  61

Query  64   DEIEAVVTTIEQNYGPVLVLVNNAGITRDNLLLRMSEDDWDDILNIHLKAVYRLSKRVLK  123
            + IE ++  I+ ++G + +LVNNAGITRDNLL+RM +++W DI+  +L +VY LSK +L+
Sbjct  62   ESIETLLEQIKNDFGDIDILVNNAGITRDNLLMRMKDEEWFDIMQTNLTSVYHLSKAMLR  121

Query  124  GMTKARFGRIINISSVVAHFANPGQANYSAAKAGIEAFSRSLAKEMGSRQITVNSVAPGF  183
             M K RFGRIINI SVV    NPGQ NY AAKAG+  FS+SLAKE+ +R ITVN VAPGF
Sbjct  122  SMMKKRFGRIINIGSVVGSTGNPGQTNYCAAKAGVVGFSKSLAKEVAARGITVNVVAPGF  181

Query  184  IATEMTDALSEDLRKKMSDQVALGRLGEPQDIANAVSFLASEKASYITGTVLHVNGGLYM  243
            IAT+MT+ L+++ +  +   V  GRLGE +DIA AV+FLAS+ A YITGT LHVNGGLY+
Sbjct  182  IATDMTEVLTDEQKAGILSNVPAGRLGEAKDIAKAVAFLASDDAGYITGTTLHVNGGLYL  241

Query  244  A  244
            +
Sbjct  242  S  242


> P55336 3-oxoacyl-[acyl-carrier-protein] reductase FabG [Vibrio 
harveyi]
Length=244

 Score =  278 bits (710),  Expect = 1e-96
 Identities = 139/243 (57%), Positives = 181/243 (74%), Gaps = 0/243 (0%)

Query  1    MTQQRKVALVTGASRGIGAAIAEQLIQDGFFVVGTATSESGAEKLAAQYGEQGTGLVLDV  60
            M  + K+ALVTGASRGIG AIAE L++ G  V+GTATSE GA  ++   GE G GL L+V
Sbjct  1    MNLEGKIALVTGASRGIGRAIAELLVERGATVIGTATSEGGAAAISEYLGENGKGLALNV  60

Query  61   RHLDEIEAVVTTIEQNYGPVLVLVNNAGITRDNLLLRMSEDDWDDILNIHLKAVYRLSKR  120
              ++ IEA + TI    G + +LVNNAGITRDNLL+RM +D+W+DI+N +L  +YR+SK 
Sbjct  61   TDVESIEATLKTINDECGAIDILVNNAGITRDNLLMRMKDDEWNDIINTNLTPIYRMSKA  120

Query  121  VLKGMTKARFGRIINISSVVAHFANPGQANYSAAKAGIEAFSRSLAKEMGSRQITVNSVA  180
            VL+GM K R GRIIN+ SVV    N GQ NY+AAKAG+  F++S+A+E+ SR +TVN+VA
Sbjct  121  VLRGMMKKRAGRIINVGSVVGTMGNAGQTNYAAAKAGVIGFTKSMAREVASRGVTVNTVA  180

Query  181  PGFIATEMTDALSEDLRKKMSDQVALGRLGEPQDIANAVSFLASEKASYITGTVLHVNGG  240
            PGFI T+MT AL++D R      V  GRLG+P++IA+AV FLAS +A+YITG  LHVNGG
Sbjct  181  PGFIETDMTKALNDDQRAATLSNVPAGRLGDPREIASAVVFLASPEAAYITGETLHVNGG  240

Query  241  LYM  243
            +YM
Sbjct  241  MYM  243


> Q9KQH7 3-oxoacyl-[acyl-carrier-protein] reductase FabG [Vibrio 
cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)]
Length=244

 Score =  276 bits (705),  Expect = 7e-96
 Identities = 140/243 (58%), Positives = 185/243 (76%), Gaps = 0/243 (0%)

Query  1    MTQQRKVALVTGASRGIGAAIAEQLIQDGFFVVGTATSESGAEKLAAQYGEQGTGLVLDV  60
            M  + KVALVTGASRGIG AIAE L + G  V+GTATSESGA+ ++   G+ G G+ L+V
Sbjct  1    MNLEGKVALVTGASRGIGKAIAELLAERGAKVIGTATSESGAQAISDYLGDNGKGMALNV  60

Query  61   RHLDEIEAVVTTIEQNYGPVLVLVNNAGITRDNLLLRMSEDDWDDILNIHLKAVYRLSKR  120
             + + IEAV+  I   +G V +LVNNAGITRDNLL+RM E++W DI+  +L +++RLSK 
Sbjct  61   TNPESIEAVLKAITDEFGGVDILVNNAGITRDNLLMRMKEEEWSDIMETNLTSIFRLSKA  120

Query  121  VLKGMTKARFGRIINISSVVAHFANPGQANYSAAKAGIEAFSRSLAKEMGSRQITVNSVA  180
            VL+GM K R GRIIN+ SVV    N GQANY+AAKAG+  F++S+A+E+ SR +TVN+VA
Sbjct  121  VLRGMMKKRQGRIINVGSVVGTMGNAGQANYAAAKAGVIGFTKSMAREVASRGVTVNTVA  180

Query  181  PGFIATEMTDALSEDLRKKMSDQVALGRLGEPQDIANAVSFLASEKASYITGTVLHVNGG  240
            PGFI T+MT AL+++ R     QV  GRLG+P++IA+AV+FLAS +A+YITG  LHVNGG
Sbjct  181  PGFIETDMTKALNDEQRTATLAQVPAGRLGDPREIASAVAFLASPEAAYITGETLHVNGG  240

Query  241  LYM  243
            +YM
Sbjct  241  MYM  243


> O54438 3-oxoacyl-[acyl-carrier-protein] reductase FabG [Pseudomonas 
aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 
/ JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)]
Length=247

 Score =  274 bits (701),  Expect = 3e-95
 Identities = 144/247 (58%), Positives = 187/247 (76%), Gaps = 3/247 (1%)

Query  1    MTQQRKVALVTGASRGIGAAIAEQLIQDGFFVVGTATSESGAEKLAAQY---GEQGTGLV  57
            M+ Q KVALVTGASRGIG AIA +L + G  V+GTATS SGAEK+A      G +G GLV
Sbjct  1    MSLQGKVALVTGASRGIGQAIALELGRLGAVVIGTATSASGAEKIAETLKANGVEGAGLV  60

Query  58   LDVRHLDEIEAVVTTIEQNYGPVLVLVNNAGITRDNLLLRMSEDDWDDILNIHLKAVYRL  117
            LDV   + + A +  I+Q+ G  L++VNNAGITRDNLL+RM +D+W D++N +L ++YRL
Sbjct  61   LDVSSDESVAATLEHIQQHLGQPLIVVNNAGITRDNLLVRMKDDEWFDVVNTNLNSLYRL  120

Query  118  SKRVLKGMTKARFGRIINISSVVAHFANPGQANYSAAKAGIEAFSRSLAKEMGSRQITVN  177
            SK VL+GMTKAR+GRIINI SVV    N GQ NY+AAKAG+E F+R+LA+E+GSR ITVN
Sbjct  121  SKAVLRGMTKARWGRIINIGSVVGAMGNAGQTNYAAAKAGLEGFTRALAREVGSRAITVN  180

Query  178  SVAPGFIATEMTDALSEDLRKKMSDQVALGRLGEPQDIANAVSFLASEKASYITGTVLHV  237
            +VAPGFI T+MT  L E  R+ +  Q+ LGRLG+ ++IA  V FLAS+ A+Y+TG  + V
Sbjct  181  AVAPGFIDTDMTRELPEAQREALLGQIPLGRLGQAEEIAKVVGFLASDGAAYVTGATVPV  240

Query  238  NGGLYMA  244
            NGG+YM+
Sbjct  241  NGGMYMS  247


> P0A2D0 3-oxoacyl-[acyl-carrier-protein] reductase FabG [Salmonella 
typhi]
Length=244

 Score =  271 bits (694),  Expect = 3e-94
 Identities = 143/243 (59%), Positives = 182/243 (75%), Gaps = 0/243 (0%)

Query  1    MTQQRKVALVTGASRGIGAAIAEQLIQDGFFVVGTATSESGAEKLAAQYGEQGTGLVLDV  60
            M+ + K+ALVTGASRGIG AIAE L+  G  V+GTATSE+GA+ ++   G  G GL+L+V
Sbjct  1    MSFEGKIALVTGASRGIGRAIAETLVARGAKVIGTATSENGAKNISDYLGANGKGLMLNV  60

Query  61   RHLDEIEAVVTTIEQNYGPVLVLVNNAGITRDNLLLRMSEDDWDDILNIHLKAVYRLSKR  120
                 IE+V+  I   +G V +LVNNAGITRDNLL+RM +D+W+DI+  +L +V+RLSK 
Sbjct  61   TDPASIESVLENIRAEFGEVDILVNNAGITRDNLLMRMKDDEWNDIIETNLSSVFRLSKA  120

Query  121  VLKGMTKARFGRIINISSVVAHFANPGQANYSAAKAGIEAFSRSLAKEMGSRQITVNSVA  180
            V++ M K R GRII I SVV    N GQANY+AAKAG+  FS+SLA+E+ SR ITVN VA
Sbjct  121  VMRAMMKKRCGRIITIGSVVGTMGNAGQANYAAAKAGLIGFSKSLAREVASRGITVNVVA  180

Query  181  PGFIATEMTDALSEDLRKKMSDQVALGRLGEPQDIANAVSFLASEKASYITGTVLHVNGG  240
            PGFI T+MT ALS+D R  +  QV  GRLG  Q+IA+AV+FLAS++ASYITG  LHVNGG
Sbjct  181  PGFIETDMTRALSDDQRAGILAQVPAGRLGGAQEIASAVAFLASDEASYITGETLHVNGG  240

Query  241  LYM  243
            +YM
Sbjct  241  MYM  243


> P0A2C9 3-oxoacyl-[acyl-carrier-protein] reductase FabG [Salmonella 
typhimurium (strain LT2 / SGSC1412 / ATCC 700720)]
Length=244

 Score =  271 bits (694),  Expect = 3e-94
 Identities = 143/243 (59%), Positives = 182/243 (75%), Gaps = 0/243 (0%)

Query  1    MTQQRKVALVTGASRGIGAAIAEQLIQDGFFVVGTATSESGAEKLAAQYGEQGTGLVLDV  60
            M+ + K+ALVTGASRGIG AIAE L+  G  V+GTATSE+GA+ ++   G  G GL+L+V
Sbjct  1    MSFEGKIALVTGASRGIGRAIAETLVARGAKVIGTATSENGAKNISDYLGANGKGLMLNV  60

Query  61   RHLDEIEAVVTTIEQNYGPVLVLVNNAGITRDNLLLRMSEDDWDDILNIHLKAVYRLSKR  120
                 IE+V+  I   +G V +LVNNAGITRDNLL+RM +D+W+DI+  +L +V+RLSK 
Sbjct  61   TDPASIESVLENIRAEFGEVDILVNNAGITRDNLLMRMKDDEWNDIIETNLSSVFRLSKA  120

Query  121  VLKGMTKARFGRIINISSVVAHFANPGQANYSAAKAGIEAFSRSLAKEMGSRQITVNSVA  180
            V++ M K R GRII I SVV    N GQANY+AAKAG+  FS+SLA+E+ SR ITVN VA
Sbjct  121  VMRAMMKKRCGRIITIGSVVGTMGNAGQANYAAAKAGLIGFSKSLAREVASRGITVNVVA  180

Query  181  PGFIATEMTDALSEDLRKKMSDQVALGRLGEPQDIANAVSFLASEKASYITGTVLHVNGG  240
            PGFI T+MT ALS+D R  +  QV  GRLG  Q+IA+AV+FLAS++ASYITG  LHVNGG
Sbjct  181  PGFIETDMTRALSDDQRAGILAQVPAGRLGGAQEIASAVAFLASDEASYITGETLHVNGG  240

Query  241  LYM  243
            +YM
Sbjct  241  MYM  243


> P0AEK3 3-oxoacyl-[acyl-carrier-protein] reductase FabG [Shigella 
flexneri]
Length=244

 Score =  268 bits (686),  Expect = 5e-93
 Identities = 142/243 (58%), Positives = 180/243 (74%), Gaps = 0/243 (0%)

Query  1    MTQQRKVALVTGASRGIGAAIAEQLIQDGFFVVGTATSESGAEKLAAQYGEQGTGLVLDV  60
            M  + K+ALVTGASRGIG AIAE L   G  V+GTATSE+GA+ ++   G  G GL+L+V
Sbjct  1    MNFEGKIALVTGASRGIGRAIAETLAARGAKVIGTATSENGAQAISDYLGANGKGLMLNV  60

Query  61   RHLDEIEAVVTTIEQNYGPVLVLVNNAGITRDNLLLRMSEDDWDDILNIHLKAVYRLSKR  120
                 IE+V+  I   +G V +LVNNAGITRDNLL+RM +++W+DI+  +L +V+RLSK 
Sbjct  61   TDPASIESVLEKIRAEFGEVDILVNNAGITRDNLLMRMKDEEWNDIIETNLSSVFRLSKA  120

Query  121  VLKGMTKARFGRIINISSVVAHFANPGQANYSAAKAGIEAFSRSLAKEMGSRQITVNSVA  180
            V++ M K R GRII I SVV    N GQANY+AAKAG+  FS+SLA+E+ SR ITVN VA
Sbjct  121  VMRAMMKKRHGRIITIGSVVGTMGNGGQANYAAAKAGLIGFSKSLAREVASRGITVNVVA  180

Query  181  PGFIATEMTDALSEDLRKKMSDQVALGRLGEPQDIANAVSFLASEKASYITGTVLHVNGG  240
            PGFI T+MT ALS+D R  +  QV  GRLG  Q+IANAV+FLAS++A+YITG  LHVNGG
Sbjct  181  PGFIETDMTRALSDDQRAGILAQVPAGRLGGAQEIANAVAFLASDEAAYITGETLHVNGG  240

Query  241  LYM  243
            +YM
Sbjct  241  MYM  243


> P0AEK2 3-oxoacyl-[acyl-carrier-protein] reductase FabG [Escherichia 
coli (strain K12)]
Length=244

 Score =  268 bits (686),  Expect = 5e-93
 Identities = 142/243 (58%), Positives = 180/243 (74%), Gaps = 0/243 (0%)

Query  1    MTQQRKVALVTGASRGIGAAIAEQLIQDGFFVVGTATSESGAEKLAAQYGEQGTGLVLDV  60
            M  + K+ALVTGASRGIG AIAE L   G  V+GTATSE+GA+ ++   G  G GL+L+V
Sbjct  1    MNFEGKIALVTGASRGIGRAIAETLAARGAKVIGTATSENGAQAISDYLGANGKGLMLNV  60

Query  61   RHLDEIEAVVTTIEQNYGPVLVLVNNAGITRDNLLLRMSEDDWDDILNIHLKAVYRLSKR  120
                 IE+V+  I   +G V +LVNNAGITRDNLL+RM +++W+DI+  +L +V+RLSK 
Sbjct  61   TDPASIESVLEKIRAEFGEVDILVNNAGITRDNLLMRMKDEEWNDIIETNLSSVFRLSKA  120

Query  121  VLKGMTKARFGRIINISSVVAHFANPGQANYSAAKAGIEAFSRSLAKEMGSRQITVNSVA  180
            V++ M K R GRII I SVV    N GQANY+AAKAG+  FS+SLA+E+ SR ITVN VA
Sbjct  121  VMRAMMKKRHGRIITIGSVVGTMGNGGQANYAAAKAGLIGFSKSLAREVASRGITVNVVA  180

Query  181  PGFIATEMTDALSEDLRKKMSDQVALGRLGEPQDIANAVSFLASEKASYITGTVLHVNGG  240
            PGFI T+MT ALS+D R  +  QV  GRLG  Q+IANAV+FLAS++A+YITG  LHVNGG
Sbjct  181  PGFIETDMTRALSDDQRAGILAQVPAGRLGGAQEIANAVAFLASDEAAYITGETLHVNGG  240

Query  241  LYM  243
            +YM
Sbjct  241  MYM  243


> P0A0H9 3-oxoacyl-[acyl-carrier-protein] reductase FabG [Staphylococcus 
aureus (strain Mu50 / ATCC 700699)]
Length=246

 Score =  234 bits (597),  Expect = 1e-79
 Identities = 122/242 (50%), Positives = 169/242 (70%), Gaps = 4/242 (2%)

Query  6    KVALVTGASRGIGAAIAEQLIQDGFFV-VGTATSESGAEKLAAQYGEQGT---GLVLDVR  61
            K ALVTGASRGIG +IA QL ++G+ V V  A S+  AE +  +   +G     +  +V 
Sbjct  5    KSALVTGASRGIGRSIALQLAEEGYNVAVNYAGSKEKAEAVVEEIKAKGVDSFAIQANVA  64

Query  62   HLDEIEAVVTTIEQNYGPVLVLVNNAGITRDNLLLRMSEDDWDDILNIHLKAVYRLSKRV  121
              DE++A++  +   +G + VLVNNAGITRDNLL+RM E +WDD+++ +LK V+   ++ 
Sbjct  65   DADEVKAMIKEVVSQFGSLDVLVNNAGITRDNLLMRMKEQEWDDVIDTNLKGVFNCIQKA  124

Query  122  LKGMTKARFGRIINISSVVAHFANPGQANYSAAKAGIEAFSRSLAKEMGSRQITVNSVAP  181
               M + R G IIN+SSVV    NPGQANY A KAG+   ++S A+E+ SR ITVN+VAP
Sbjct  125  TPQMLRQRSGAIINLSSVVGAVGNPGQANYVATKAGVIGLTKSAARELASRGITVNAVAP  184

Query  182  GFIATEMTDALSEDLRKKMSDQVALGRLGEPQDIANAVSFLASEKASYITGTVLHVNGGL  241
            GFI ++MTDALS++L+++M  Q+ L R G+  DIAN V+FLAS+KA YITG  +HVNGG+
Sbjct  185  GFIVSDMTDALSDELKEQMLTQIPLARFGQDTDIANTVAFLASDKAKYITGQTIHVNGGM  244

Query  242  YM  243
            YM
Sbjct  245  YM  246


> Q6GHK4 3-oxoacyl-[acyl-carrier-protein] reductase FabG [Staphylococcus 
aureus (strain MRSA252)]
Length=246

 Score =  234 bits (597),  Expect = 1e-79
 Identities = 122/242 (50%), Positives = 169/242 (70%), Gaps = 4/242 (2%)

Query  6    KVALVTGASRGIGAAIAEQLIQDGFFV-VGTATSESGAEKLAAQYGEQGT---GLVLDVR  61
            K ALVTGASRGIG +IA QL ++G+ V V  A S+  AE +  +   +G     +  +V 
Sbjct  5    KSALVTGASRGIGRSIALQLAEEGYNVAVNYAGSKEKAEAVVEEIKAKGVDSFAIQANVA  64

Query  62   HLDEIEAVVTTIEQNYGPVLVLVNNAGITRDNLLLRMSEDDWDDILNIHLKAVYRLSKRV  121
              DE++A++  +   +G + VLVNNAGITRDNLL+RM E +WDD+++ +LK V+   ++ 
Sbjct  65   DADEVKAMIKEVVSQFGSLDVLVNNAGITRDNLLMRMKEQEWDDVIDTNLKGVFNCIQKA  124

Query  122  LKGMTKARFGRIINISSVVAHFANPGQANYSAAKAGIEAFSRSLAKEMGSRQITVNSVAP  181
               M + R G IIN+SSVV    NPGQANY A KAG+   ++S A+E+ SR ITVN+VAP
Sbjct  125  TPQMLRQRSGAIINLSSVVGAVGNPGQANYVATKAGVIGLTKSAARELASRGITVNAVAP  184

Query  182  GFIATEMTDALSEDLRKKMSDQVALGRLGEPQDIANAVSFLASEKASYITGTVLHVNGGL  241
            GFI ++MTDALS++L+++M  Q+ L R G+  DIAN V+FLAS+KA YITG  +HVNGG+
Sbjct  185  GFIVSDMTDALSDELKEQMLTQIPLARFGQDTDIANTVAFLASDKAKYITGQTIHVNGGM  244

Query  242  YM  243
            YM
Sbjct  245  YM  246


> Q6G9Y2 3-oxoacyl-[acyl-carrier-protein] reductase FabG [Staphylococcus 
aureus (strain MSSA476)]
Length=246

 Score =  234 bits (597),  Expect = 1e-79
 Identities = 122/242 (50%), Positives = 169/242 (70%), Gaps = 4/242 (2%)

Query  6    KVALVTGASRGIGAAIAEQLIQDGFFV-VGTATSESGAEKLAAQYGEQGT---GLVLDVR  61
            K ALVTGASRGIG +IA QL ++G+ V V  A S+  AE +  +   +G     +  +V 
Sbjct  5    KSALVTGASRGIGRSIALQLAEEGYNVAVNYAGSKEKAEAVVEEIKAKGVDSFAIQANVA  64

Query  62   HLDEIEAVVTTIEQNYGPVLVLVNNAGITRDNLLLRMSEDDWDDILNIHLKAVYRLSKRV  121
              DE++A++  +   +G + VLVNNAGITRDNLL+RM E +WDD+++ +LK V+   ++ 
Sbjct  65   DADEVKAMIKEVVSQFGSLDVLVNNAGITRDNLLMRMKEQEWDDVIDTNLKGVFNCIQKA  124

Query  122  LKGMTKARFGRIINISSVVAHFANPGQANYSAAKAGIEAFSRSLAKEMGSRQITVNSVAP  181
               M + R G IIN+SSVV    NPGQANY A KAG+   ++S A+E+ SR ITVN+VAP
Sbjct  125  TPQMLRQRSGAIINLSSVVGAVGNPGQANYVATKAGVIGLTKSAARELASRGITVNAVAP  184

Query  182  GFIATEMTDALSEDLRKKMSDQVALGRLGEPQDIANAVSFLASEKASYITGTVLHVNGGL  241
            GFI ++MTDALS++L+++M  Q+ L R G+  DIAN V+FLAS+KA YITG  +HVNGG+
Sbjct  185  GFIVSDMTDALSDELKEQMLTQIPLARFGQDTDIANTVAFLASDKAKYITGQTIHVNGGM  244

Query  242  YM  243
            YM
Sbjct  245  YM  246


> P0A0I0 3-oxoacyl-[acyl-carrier-protein] reductase FabG [Staphylococcus 
aureus (strain MW2)]
Length=246

 Score =  234 bits (597),  Expect = 1e-79
 Identities = 122/242 (50%), Positives = 169/242 (70%), Gaps = 4/242 (2%)

Query  6    KVALVTGASRGIGAAIAEQLIQDGFFV-VGTATSESGAEKLAAQYGEQGT---GLVLDVR  61
            K ALVTGASRGIG +IA QL ++G+ V V  A S+  AE +  +   +G     +  +V 
Sbjct  5    KSALVTGASRGIGRSIALQLAEEGYNVAVNYAGSKEKAEAVVEEIKAKGVDSFAIQANVA  64

Query  62   HLDEIEAVVTTIEQNYGPVLVLVNNAGITRDNLLLRMSEDDWDDILNIHLKAVYRLSKRV  121
              DE++A++  +   +G + VLVNNAGITRDNLL+RM E +WDD+++ +LK V+   ++ 
Sbjct  65   DADEVKAMIKEVVSQFGSLDVLVNNAGITRDNLLMRMKEQEWDDVIDTNLKGVFNCIQKA  124

Query  122  LKGMTKARFGRIINISSVVAHFANPGQANYSAAKAGIEAFSRSLAKEMGSRQITVNSVAP  181
               M + R G IIN+SSVV    NPGQANY A KAG+   ++S A+E+ SR ITVN+VAP
Sbjct  125  TPQMLRQRSGAIINLSSVVGAVGNPGQANYVATKAGVIGLTKSAARELASRGITVNAVAP  184

Query  182  GFIATEMTDALSEDLRKKMSDQVALGRLGEPQDIANAVSFLASEKASYITGTVLHVNGGL  241
            GFI ++MTDALS++L+++M  Q+ L R G+  DIAN V+FLAS+KA YITG  +HVNGG+
Sbjct  185  GFIVSDMTDALSDELKEQMLTQIPLARFGQDTDIANTVAFLASDKAKYITGQTIHVNGGM  244

Query  242  YM  243
            YM
Sbjct  245  YM  246


> P99093 3-oxoacyl-[acyl-carrier-protein] reductase FabG [Staphylococcus 
aureus (strain N315)]
Length=246

 Score =  234 bits (597),  Expect = 1e-79
 Identities = 122/242 (50%), Positives = 169/242 (70%), Gaps = 4/242 (2%)

Query  6    KVALVTGASRGIGAAIAEQLIQDGFFV-VGTATSESGAEKLAAQYGEQGT---GLVLDVR  61
            K ALVTGASRGIG +IA QL ++G+ V V  A S+  AE +  +   +G     +  +V 
Sbjct  5    KSALVTGASRGIGRSIALQLAEEGYNVAVNYAGSKEKAEAVVEEIKAKGVDSFAIQANVA  64

Query  62   HLDEIEAVVTTIEQNYGPVLVLVNNAGITRDNLLLRMSEDDWDDILNIHLKAVYRLSKRV  121
              DE++A++  +   +G + VLVNNAGITRDNLL+RM E +WDD+++ +LK V+   ++ 
Sbjct  65   DADEVKAMIKEVVSQFGSLDVLVNNAGITRDNLLMRMKEQEWDDVIDTNLKGVFNCIQKA  124

Query  122  LKGMTKARFGRIINISSVVAHFANPGQANYSAAKAGIEAFSRSLAKEMGSRQITVNSVAP  181
               M + R G IIN+SSVV    NPGQANY A KAG+   ++S A+E+ SR ITVN+VAP
Sbjct  125  TPQMLRQRSGAIINLSSVVGAVGNPGQANYVATKAGVIGLTKSAARELASRGITVNAVAP  184

Query  182  GFIATEMTDALSEDLRKKMSDQVALGRLGEPQDIANAVSFLASEKASYITGTVLHVNGGL  241
            GFI ++MTDALS++L+++M  Q+ L R G+  DIAN V+FLAS+KA YITG  +HVNGG+
Sbjct  185  GFIVSDMTDALSDELKEQMLTQIPLARFGQDTDIANTVAFLASDKAKYITGQTIHVNGGM  244

Query  242  YM  243
            YM
Sbjct  245  YM  246


> Q5HPW0 3-oxoacyl-[acyl-carrier-protein] reductase FabG [Staphylococcus 
epidermidis (strain ATCC 35984 / RP62A)]
Length=244

 Score =  231 bits (588),  Expect = 3e-78
 Identities = 120/242 (50%), Positives = 169/242 (70%), Gaps = 4/242 (2%)

Query  6    KVALVTGASRGIGAAIAEQLIQDGFFV-VGTATSESGAEKLAAQYGEQGT---GLVLDVR  61
            K ALVTGASRGIG +IA QL ++G+ V V  A S+  AE +  +   +G     +  +V 
Sbjct  3    KSALVTGASRGIGRSIALQLAEEGYNVAVNYAGSKDKAEAVVEEIKAKGVESFAIQANVA  62

Query  62   HLDEIEAVVTTIEQNYGPVLVLVNNAGITRDNLLLRMSEDDWDDILNIHLKAVYRLSKRV  121
              DE++ ++  +   +G V VLVNNAGIT+DNLL+RM E +WDD+++ +LK V+   ++V
Sbjct  63   KGDEVKEMIKEVVSQFGSVDVLVNNAGITKDNLLMRMKEQEWDDVIDTNLKGVFNCIQKV  122

Query  122  LKGMTKARFGRIINISSVVAHFANPGQANYSAAKAGIEAFSRSLAKEMGSRQITVNSVAP  181
               M + R G IIN++S+V    NPGQANY A KAG+   +++ A+E+ SR ITVN+VAP
Sbjct  123  TPQMLRQRSGAIINLTSIVGAMGNPGQANYVATKAGVIGLTKTAARELASRGITVNAVAP  182

Query  182  GFIATEMTDALSEDLRKKMSDQVALGRLGEPQDIANAVSFLASEKASYITGTVLHVNGGL  241
            GFI ++MT+ALS+DL+ +M +Q+ L R GE  DIAN V+FLAS+KA YITG  +HVNGG+
Sbjct  183  GFIVSDMTNALSDDLKDQMLEQIPLKRFGEDTDIANTVAFLASDKAKYITGQTIHVNGGM  242

Query  242  YM  243
            YM
Sbjct  243  YM  244


> Q8CPI3 3-oxoacyl-[acyl-carrier-protein] reductase FabG [Staphylococcus 
epidermidis (strain ATCC 12228)]
Length=244

 Score =  231 bits (588),  Expect = 3e-78
 Identities = 120/242 (50%), Positives = 169/242 (70%), Gaps = 4/242 (2%)

Query  6    KVALVTGASRGIGAAIAEQLIQDGFFV-VGTATSESGAEKLAAQYGEQGT---GLVLDVR  61
            K ALVTGASRGIG +IA QL ++G+ V V  A S+  AE +  +   +G     +  +V 
Sbjct  3    KSALVTGASRGIGRSIALQLAEEGYNVAVNYAGSKDKAEAVVEEIKAKGVESFAIQANVA  62

Query  62   HLDEIEAVVTTIEQNYGPVLVLVNNAGITRDNLLLRMSEDDWDDILNIHLKAVYRLSKRV  121
              DE++ ++  +   +G V VLVNNAGIT+DNLL+RM E +WDD+++ +LK V+   ++V
Sbjct  63   KGDEVKEMIKEVVSQFGSVDVLVNNAGITKDNLLMRMKEQEWDDVIDTNLKGVFNCIQKV  122

Query  122  LKGMTKARFGRIINISSVVAHFANPGQANYSAAKAGIEAFSRSLAKEMGSRQITVNSVAP  181
               M + R G IIN++S+V    NPGQANY A KAG+   +++ A+E+ SR ITVN+VAP
Sbjct  123  TPQMLRQRSGAIINLTSIVGAMGNPGQANYVATKAGVIGLTKTAARELASRGITVNAVAP  182

Query  182  GFIATEMTDALSEDLRKKMSDQVALGRLGEPQDIANAVSFLASEKASYITGTVLHVNGGL  241
            GFI ++MT+ALS+DL+ +M +Q+ L R GE  DIAN V+FLAS+KA YITG  +HVNGG+
Sbjct  183  GFIVSDMTNALSDDLKDQMLEQIPLKRFGEDTDIANTVAFLASDKAKYITGQTIHVNGGM  242

Query  242  YM  243
            YM
Sbjct  243  YM  244


> P51831 3-oxoacyl-[acyl-carrier-protein] reductase FabG [Bacillus 
subtilis (strain 168)]
Length=246

 Score =  227 bits (578),  Expect = 1e-76
 Identities = 115/242 (48%), Positives = 169/242 (70%), Gaps = 4/242 (2%)

Query  6    KVALVTGASRGIGAAIAEQLIQDGF-FVVGTATSESGAEKLAAQY---GEQGTGLVLDVR  61
            K A+VTGASRGIG +IA  L + G   VV  + +E+ A ++  +    G +   +  DV 
Sbjct  5    KTAIVTGASRGIGRSIALDLAKSGANVVVNYSGNEAKANEVVDEIKSMGRKAIAVKADVS  64

Query  62   HLDEIEAVVTTIEQNYGPVLVLVNNAGITRDNLLLRMSEDDWDDILNIHLKAVYRLSKRV  121
            + ++++ ++      +  + +LVNNAGITRDNL++RM ED+WDD++NI+LK V+  +K V
Sbjct  65   NPEDVQNMIKETLSVFSTIDILVNNAGITRDNLIMRMKEDEWDDVININLKGVFNCTKAV  124

Query  122  LKGMTKARFGRIINISSVVAHFANPGQANYSAAKAGIEAFSRSLAKEMGSRQITVNSVAP  181
             + M K R GRIIN+SS+V    NPGQANY AAKAG+   ++S AKE+ SR ITVN++AP
Sbjct  125  TRQMMKQRSGRIINVSSIVGVSGNPGQANYVAAKAGVIGLTKSSAKELASRNITVNAIAP  184

Query  182  GFIATEMTDALSEDLRKKMSDQVALGRLGEPQDIANAVSFLASEKASYITGTVLHVNGGL  241
            GFI+T+MTD L++D++ +M  Q+ L R GEP D+++ V+FLASE A Y+TG  LH++GG+
Sbjct  185  GFISTDMTDKLAKDVQDEMLKQIPLARFGEPSDVSSVVTFLASEGARYMTGQTLHIDGGM  244

Query  242  YM  243
             M
Sbjct  245  VM  246


> O67610 3-oxoacyl-[acyl-carrier-protein] reductase FabG [Aquifex 
aeolicus (strain VF5)]
Length=248

 Score =  224 bits (572),  Expect = 8e-76
 Identities = 117/243 (48%), Positives = 166/243 (68%), Gaps = 4/243 (2%)

Query  4    QRKVALVTGASRGIGAAIAEQLIQDGFFVVGTATS----ESGAEKLAAQYGEQGTGLVLD  59
            Q KV+LVTG++RGIG AIAE+L   G  V+ T TS    ++ AE++A +YG +  G+ ++
Sbjct  6    QGKVSLVTGSTRGIGRAIAEKLASAGSTVIITGTSGERAKAVAEEIANKYGVKAHGVEMN  65

Query  60   VRHLDEIEAVVTTIEQNYGPVLVLVNNAGITRDNLLLRMSEDDWDDILNIHLKAVYRLSK  119
            +   + I      I      + +LVNNAGITRD L LRMS  DW+++L ++L   + +++
Sbjct  66   LLSEESINKAFEEIYNLVDGIDILVNNAGITRDKLFLRMSLLDWEEVLKVNLTGTFLVTQ  125

Query  120  RVLKGMTKARFGRIINISSVVAHFANPGQANYSAAKAGIEAFSRSLAKEMGSRQITVNSV  179
              L+ M K R+GRI+NISSVV    N GQ NYS  KAG+  F++SLAKE+  R + VN+V
Sbjct  126  NSLRKMIKQRWGRIVNISSVVGFTGNVGQVNYSTTKAGLIGFTKSLAKELAPRNVLVNAV  185

Query  180  APGFIATEMTDALSEDLRKKMSDQVALGRLGEPQDIANAVSFLASEKASYITGTVLHVNG  239
            APGFI T+MT  LSE++++K  +Q+ LGR G P+++AN V FL SE ASYITG V+HVNG
Sbjct  186  APGFIETDMTAVLSEEIKQKYKEQIPLGRFGSPEEVANVVLFLCSELASYITGEVIHVNG  245

Query  240  GLY  242
            G++
Sbjct  246  GMF  248


> P72332 Nodulation protein G [Rhizobium sp. (strain N33)]
Length=245

 Score =  203 bits (516),  Expect = 2e-67
 Identities = 110/236 (47%), Positives = 156/236 (66%), Gaps = 0/236 (0%)

Query  8    ALVTGASRGIGAAIAEQLIQDGFFVVGTATSESGAEKLAAQYGEQGTGLVLDVRHLDEIE  67
            ALVTGAS GIG AIA  L   G  V    T     E LAA+ G++      ++ + DE++
Sbjct  9    ALVTGASGGIGEAIARVLHAQGAIVGLHGTRVEKLETLAAELGDRVKLFPANLSNRDEVK  68

Query  68   AVVTTIEQNYGPVLVLVNNAGITRDNLLLRMSEDDWDDILNIHLKAVYRLSKRVLKGMTK  127
            A+    E +   V +LVNNAGIT+D L +RMS+ DWD +L ++L AV+RL++ +   M +
Sbjct  69   ALGQKAEADLEGVDILVNNAGITKDGLFVRMSDADWDTVLEVNLTAVFRLTRELTHPMMR  128

Query  128  ARFGRIINISSVVAHFANPGQANYSAAKAGIEAFSRSLAKEMGSRQITVNSVAPGFIATE  187
             R GRIINI+SVV    NPGQ NY A+KAG+  FS+SLA+E+ +R ITVN VAPGFI + 
Sbjct  129  RRHGRIINITSVVGVTGNPGQTNYCASKAGMIGFSKSLAQEIATRNITVNCVAPGFIESA  188

Query  188  MTDALSEDLRKKMSDQVALGRLGEPQDIANAVSFLASEKASYITGTVLHVNGGLYM  243
            MTD L++  ++ +   +   R+G   ++A+AV++LAS +A+Y+TG  +HVNGGL M
Sbjct  189  MTDKLNDKQKEAIMAAIPTRRMGTSVEVASAVAYLASNEAAYVTGQTIHVNGGLAM  244


> P06234 Nodulation protein G [Rhizobium meliloti (strain 1021)]
Length=245

 Score =  197 bits (502),  Expect = 2e-65
 Identities = 104/236 (44%), Positives = 154/236 (65%), Gaps = 0/236 (0%)

Query  8    ALVTGASRGIGAAIAEQLIQDGFFVVGTATSESGAEKLAAQYGEQGTGLVLDVRHLDEIE  67
            ALVTGAS  IG AIA  L   G  V    T     E LA + G++      ++ + DE++
Sbjct  9    ALVTGASGAIGGAIARVLHAQGAIVGLHGTQIEKLETLATELGDRVKLFPANLANRDEVK  68

Query  68   AVVTTIEQNYGPVLVLVNNAGITRDNLLLRMSEDDWDDILNIHLKAVYRLSKRVLKGMTK  127
            A+    E +   V +LVNNAGIT+D L L M++ DWD +L ++L A++RL++ + + M +
Sbjct  69   ALGQRAEADLEGVDILVNNAGITKDGLFLHMADPDWDIVLEVNLTAMFRLTREITQQMIR  128

Query  128  ARFGRIINISSVVAHFANPGQANYSAAKAGIEAFSRSLAKEMGSRQITVNSVAPGFIATE  187
             R GRIIN++SV     NPGQ NY A+KAG+  FS+SLA+E+ +R ITVN VAPGFI + 
Sbjct  129  RRNGRIINVTSVAGAIGNPGQTNYCASKAGMIGFSKSLAQEIATRNITVNCVAPGFIESA  188

Query  188  MTDALSEDLRKKMSDQVALGRLGEPQDIANAVSFLASEKASYITGTVLHVNGGLYM  243
            MTD L+   ++K+   + + R+G   ++A+AV++LAS+ A+Y+TG  +HVNGG+ M
Sbjct  189  MTDKLNHKQKEKIMVAIPIHRMGTGTEVASAVAYLASDHAAYVTGQTIHVNGGMAM  244


> P28643 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic 
[Cuphea lanceolata]
Length=320

 Score =  199 bits (506),  Expect = 5e-65
 Identities = 110/242 (45%), Positives = 160/242 (66%), Gaps = 5/242 (2%)

Query  7    VALVTGASRGIGAAIAEQLIQDGFFV-VGTATSESGAEKLAAQ---YGEQGTGLVLDVRH  62
            V +VTGASRGIG AIA  L + G  V V  A S   AE+++ +   +G Q      DV  
Sbjct  79   VVIVTGASRGIGKAIALSLGKAGCKVLVNYARSSKEAEEVSKEIEAFGGQALTFGGDVSK  138

Query  63   LDEIEAVVTTIEQNYGPVLVLVNNAGITRDNLLLRMSEDDWDDILNIHLKAVYRLSKRVL  122
             +++EA++ T    +G V +LVNNAGITRD LL+RM +  W ++++++L  V+  ++   
Sbjct  139  EEDVEAMIKTAVDAWGTVDILVNNAGITRDGLLMRMKKSQWQEVIDLNLTGVFLCTQAAA  198

Query  123  KGMTKARFGRIINISSVVAHFANPGQANYSAAKAGIEAFSRSLAKEMGSRQITVNSVAPG  182
            K M K + GRIINI+SVV    N GQANYSAAKAG+  F++++A+E  SR I VN+VAPG
Sbjct  199  KIMMKKKKGRIINIASVVGLVGNAGQANYSAAKAGVIGFTKTVAREYASRNINVNAVAPG  258

Query  183  FIATEMTDALSEDLRKKMSDQVALGRLGEPQDIANAVSFLASEKA-SYITGTVLHVNGGL  241
            FI+++MT  L +D+ KK+ + + LGR G+P+++A  V FLA   A SY+TG V  ++GG+
Sbjct  259  FISSDMTSKLGDDINKKILETIPLGRYGQPEEVAGLVEFLAINPASSYVTGQVFTIDGGM  318

Query  242  YM  243
             M
Sbjct  319  TM  320


> P73574 3-oxoacyl-[acyl-carrier-protein] reductase [Synechocystis 
sp. (strain PCC 6803 / Kazusa)]
Length=247

 Score =  197 bits (500),  Expect = 5e-65
 Identities = 110/243 (45%), Positives = 160/243 (66%), Gaps = 8/243 (3%)

Query  6    KVALVTGASRGIGAAIAEQLIQDGF-FVVGTATSESGAEKLAAQY---GEQGTGLVLDVR  61
            +VALVTGASRGIG A A  L   G   VV  A S + A+ + A+    G +   +  +V 
Sbjct  7    QVALVTGASRGIGKATALALAATGMKVVVNYAQSSTAADAVVAEIIANGGEAIAVQANVA  66

Query  62   HLDEIEAVVTTIEQNYGPVLVLVNNAGITRDNLLLRMSEDDWDDILNIHLKAVYRLSKRV  121
            + DE++ ++ T    +  + VLVNNAGITRD LLLRM  +DW  +++++L  V+  +K V
Sbjct  67   NADEVDQLIKTTLDKFSRIDVLVNNAGITRDTLLLRMKLEDWQAVIDLNLTGVFLCTKAV  126

Query  122  LKGMTKARFGRIINISSVVAHFANPGQANYSAAKAGIEAFSRSLAKEMGSRQITVNSVAP  181
             K M K + GRIINI+SV     NPGQANYSAAKAG+  F++++AKE+ SR +TVN+VAP
Sbjct  127  SKLMLKQKSGRIINITSVAGMMGNPGQANYSAAKAGVIGFTKTVAKELASRGVTVNAVAP  186

Query  182  GFIATEMTDALSEDLRKKMSDQVALGRLGEPQDIANAVSFLASE-KASYITGTVLHVNGG  240
            GFIAT+MT+ L+ +    +   + L R G+P+++A  + FLA++  A+YITG   +V+GG
Sbjct  187  GFIATDMTENLNAE---PILQFIPLARYGQPEEVAGTIRFLATDPAAAYITGQTFNVDGG  243

Query  241  LYM  243
            + M
Sbjct  244  MVM  246



Lambda      K        H        a         alpha
   0.319    0.133    0.366    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 863898


  Database: abd9c5aab9412d7a36a22aaafe7ca3d1.SwissProt.fasta
    Posted date:  Sep 19, 2020  12:09 PM
  Number of letters in database: 5,222
  Number of sequences in database:  21



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40