ACIAD0862 / TrEMBL Alignments

BLASTP 2.2.28+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: 378896ce362ae8267867467689561613.TrEMBL.fasta
           22 sequences; 4,473 total letters



Query= ACIAD0862

Length=197
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  Q6FDU6 Segregation and condensation protein B [Acinetobacter ba...   387    4e-141
  A0A1P8EJ16 Segregation and condensation protein B [Acinetobacte...   371    7e-135
  A0A0M1I2X3 Segregation and condensation protein B [Acinetobacte...   369    4e-134
  N9BWZ2 Segregation and condensation protein B [Acinetobacter so...   369    4e-134
  N9N1H2 Segregation and condensation protein B [Acinetobacter sp...   350    1e-126
  N9KJG7 Segregation and condensation protein B [Acinetobacter sp...   350    1e-126
  A0A1Q3NNV1 Segregation and condensation protein B [Acinetobacte...   350    1e-126
  N8QXA9 Segregation and condensation protein B [Acinetobacter sp...   350    1e-126
  A0A1Q3N6S2 Segregation and condensation protein B [Acinetobacte...   350    1e-126
  N9RVF0 Segregation and condensation protein B [Acinetobacter sp...   348    5e-126
  N9LUW4 Segregation and condensation protein B [Acinetobacter sp...   348    5e-126
  V2UJY3 Segregation and condensation protein B [Acinetobacter tj...   348    5e-126
  N9FV93 Segregation and condensation protein B [Acinetobacter be...   348    7e-126
  N9DVV1 Segregation and condensation protein B [Acinetobacter be...   348    7e-126
  A0A0M3A0K7 Segregation and condensation protein B [Acinetobacte...   348    7e-126
  A0A009ZQ83 Segregation and condensation protein B [Acinetobacte...   347    1e-125
  N9C288 Segregation and condensation protein B [Acinetobacter ur...   347    1e-125
  N9QT19 Segregation and condensation protein B [Acinetobacter ur...   347    1e-125
  A0A2R4TIG4 Segregation and condensation protein B [Acinetobacte...   347    2e-125
  Q8KF54 Segregation and condensation protein B [Chlorobaculum te...  99.0    1e-28 
  A0A0E0TE00 Segregation and condensation protein B [Geobacillus ...  87.4    4e-24 
  O33209 Segregation and condensation protein B [Mycobacterium tu...  72.8    3e-19 


> Q6FDU6 Segregation and condensation protein B [Acinetobacter 
baylyi (strain ATCC 33305 / BD413 / ADP1)]
Length=196

 Score =  387 bits (993),  Expect = 4e-141
 Identities = 196/196 (100%), Positives = 196/196 (100%), Gaps = 0/196 (0%)

Query  1    MTIDQSSALSLEDIHHEVLLQIEAILFASDVPISLARLKEAFQNQYNKQQLRHFLQQLAV  60
            MTIDQSSALSLEDIHHEVLLQIEAILFASDVPISLARLKEAFQNQYNKQQLRHFLQQLAV
Sbjct  1    MTIDQSSALSLEDIHHEVLLQIEAILFASDVPISLARLKEAFQNQYNKQQLRHFLQQLAV  60

Query  61   LQHGRSIELIETAQGFRFQVRSKYRNMIAQVWPERPTKLSPSLLETIAVIAYHQPVTRAD  120
            LQHGRSIELIETAQGFRFQVRSKYRNMIAQVWPERPTKLSPSLLETIAVIAYHQPVTRAD
Sbjct  61   LQHGRSIELIETAQGFRFQVRSKYRNMIAQVWPERPTKLSPSLLETIAVIAYHQPVTRAD  120

Query  121  IEQIRGVSNNSQILRMLFEWNWIKESGFRDLPGRPALLITTPQFLNAFGLVSLGQLPPLQ  180
            IEQIRGVSNNSQILRMLFEWNWIKESGFRDLPGRPALLITTPQFLNAFGLVSLGQLPPLQ
Sbjct  121  IEQIRGVSNNSQILRMLFEWNWIKESGFRDLPGRPALLITTPQFLNAFGLVSLGQLPPLQ  180

Query  181  DAKDAFMSLDVNTPKS  196
            DAKDAFMSLDVNTPKS
Sbjct  181  DAKDAFMSLDVNTPKS  196


> A0A1P8EJ16 Segregation and condensation protein B [Acinetobacter 
soli]
Length=196

 Score =  371 bits (952),  Expect = 7e-135
 Identities = 185/196 (94%), Positives = 192/196 (98%), Gaps = 0/196 (0%)

Query  1    MTIDQSSALSLEDIHHEVLLQIEAILFASDVPISLARLKEAFQNQYNKQQLRHFLQQLAV  60
            MTIDQS+ALS EDIHHEVLLQ+EAILFASD P+SLARLKEAF NQY+KQQLRHFLQQLAV
Sbjct  1    MTIDQSAALSFEDIHHEVLLQMEAILFASDAPVSLARLKEAFNNQYSKQQLRHFLQQLAV  60

Query  61   LQHGRSIELIETAQGFRFQVRSKYRNMIAQVWPERPTKLSPSLLETIAVIAYHQPVTRAD  120
            LQHGRSIELIETAQGFRFQVRSKYRN+IAQVWPERPTKLSPSLLETIAVIAYHQPVTRAD
Sbjct  61   LQHGRSIELIETAQGFRFQVRSKYRNIIAQVWPERPTKLSPSLLETIAVIAYHQPVTRAD  120

Query  121  IEQIRGVSNNSQILRMLFEWNWIKESGFRDLPGRPALLITTPQFLNAFGLVSLGQLPPLQ  180
            IEQIRGVSNNSQILR+LFEWNWIKESGFRDLPGRPALLITTPQFLNAFGLVSLGQLPPLQ
Sbjct  121  IEQIRGVSNNSQILRLLFEWNWIKESGFRDLPGRPALLITTPQFLNAFGLVSLGQLPPLQ  180

Query  181  DAKDAFMSLDVNTPKS  196
            DAKDAFM LDV+TPKS
Sbjct  181  DAKDAFMGLDVHTPKS  196


> A0A0M1I2X3 Segregation and condensation protein B [Acinetobacter 
sp. C15]
Length=196

 Score =  369 bits (947),  Expect = 4e-134
 Identities = 184/196 (94%), Positives = 191/196 (97%), Gaps = 0/196 (0%)

Query  1    MTIDQSSALSLEDIHHEVLLQIEAILFASDVPISLARLKEAFQNQYNKQQLRHFLQQLAV  60
            MTIDQS+ALS EDIHHEVLLQ+EAILFASD P+SLARLKEAF NQY+KQQLRHFLQQLAV
Sbjct  1    MTIDQSAALSFEDIHHEVLLQMEAILFASDAPVSLARLKEAFNNQYSKQQLRHFLQQLAV  60

Query  61   LQHGRSIELIETAQGFRFQVRSKYRNMIAQVWPERPTKLSPSLLETIAVIAYHQPVTRAD  120
            LQHGRSIELIETAQGFRFQVRSKYRN+IAQVWPERPTKLSPSLLETIAVIAYHQPVTRAD
Sbjct  61   LQHGRSIELIETAQGFRFQVRSKYRNIIAQVWPERPTKLSPSLLETIAVIAYHQPVTRAD  120

Query  121  IEQIRGVSNNSQILRMLFEWNWIKESGFRDLPGRPALLITTPQFLNAFGLVSLGQLPPLQ  180
            IEQIRGVSNNSQILR+LFEWNWIKESGFRDLPGRPALLITTPQFLNAFGLVSLGQLPPLQ
Sbjct  121  IEQIRGVSNNSQILRLLFEWNWIKESGFRDLPGRPALLITTPQFLNAFGLVSLGQLPPLQ  180

Query  181  DAKDAFMSLDVNTPKS  196
            DAKDAFM LDV+ PKS
Sbjct  181  DAKDAFMGLDVHAPKS  196


> N9BWZ2 Segregation and condensation protein B [Acinetobacter 
soli NIPH 2899]
Length=196

 Score =  369 bits (947),  Expect = 4e-134
 Identities = 184/196 (94%), Positives = 191/196 (97%), Gaps = 0/196 (0%)

Query  1    MTIDQSSALSLEDIHHEVLLQIEAILFASDVPISLARLKEAFQNQYNKQQLRHFLQQLAV  60
            MTIDQS+ALS EDIHHEVLLQ+EAILFASD P+SLARLKEAF NQY+KQQLRHFLQQLAV
Sbjct  1    MTIDQSAALSFEDIHHEVLLQMEAILFASDAPVSLARLKEAFNNQYSKQQLRHFLQQLAV  60

Query  61   LQHGRSIELIETAQGFRFQVRSKYRNMIAQVWPERPTKLSPSLLETIAVIAYHQPVTRAD  120
            LQHGRSIELIETAQGFRFQVRSKYRN+IAQVWPERPTKLSPSLLETIAVIAYHQPVTRAD
Sbjct  61   LQHGRSIELIETAQGFRFQVRSKYRNIIAQVWPERPTKLSPSLLETIAVIAYHQPVTRAD  120

Query  121  IEQIRGVSNNSQILRMLFEWNWIKESGFRDLPGRPALLITTPQFLNAFGLVSLGQLPPLQ  180
            IEQIRGVSNNSQILR+LFEWNWIKESGFRDLPGRPALLITTPQFLNAFGLVSLGQLPPLQ
Sbjct  121  IEQIRGVSNNSQILRLLFEWNWIKESGFRDLPGRPALLITTPQFLNAFGLVSLGQLPPLQ  180

Query  181  DAKDAFMSLDVNTPKS  196
            DAKDAFM LDV+ PKS
Sbjct  181  DAKDAFMGLDVHAPKS  196


> N9N1H2 Segregation and condensation protein B [Acinetobacter 
sp. ANC 3862]
Length=199

 Score =  350 bits (898),  Expect = 1e-126
 Identities = 171/193 (89%), Positives = 185/193 (96%), Gaps = 0/193 (0%)

Query  4    DQSSALSLEDIHHEVLLQIEAILFASDVPISLARLKEAFQNQYNKQQLRHFLQQLAVLQH  63
            D +  +SLEDIHH+VLLQIEAILFASD P+SLARLKEAFQNQYNKQQLRHFLQQLA+LQH
Sbjct  7    DTNEGMSLEDIHHDVLLQIEAILFASDSPVSLARLKEAFQNQYNKQQLRHFLQQLAMLQH  66

Query  64   GRSIELIETAQGFRFQVRSKYRNMIAQVWPERPTKLSPSLLETIAVIAYHQPVTRADIEQ  123
            GRSIELIETAQGFRFQVR+KYRN+IAQVWPERPTKLSPSLLET+AVIAYHQPVTRADIEQ
Sbjct  67   GRSIELIETAQGFRFQVRAKYRNIIAQVWPERPTKLSPSLLETVAVIAYHQPVTRADIEQ  126

Query  124  IRGVSNNSQILRMLFEWNWIKESGFRDLPGRPALLITTPQFLNAFGLVSLGQLPPLQDAK  183
            IRGVSNNSQILR LF+WNWIKESGFRDLPGRPALL+TTPQFLNAFGL SLGQLPPLQ+AK
Sbjct  127  IRGVSNNSQILRNLFDWNWIKESGFRDLPGRPALLVTTPQFLNAFGLASLGQLPPLQNAK  186

Query  184  DAFMSLDVNTPKS  196
            +AFM+LD + PKS
Sbjct  187  EAFMTLDAHAPKS  199


> N9KJG7 Segregation and condensation protein B [Acinetobacter 
sp. NIPH 284]
Length=199

 Score =  350 bits (898),  Expect = 1e-126
 Identities = 171/193 (89%), Positives = 185/193 (96%), Gaps = 0/193 (0%)

Query  4    DQSSALSLEDIHHEVLLQIEAILFASDVPISLARLKEAFQNQYNKQQLRHFLQQLAVLQH  63
            D +  +SLEDIHH+VLLQIEAILFASD P+SLARLKEAFQNQYNKQQLRHFLQQLA+LQH
Sbjct  7    DTNEGMSLEDIHHDVLLQIEAILFASDSPVSLARLKEAFQNQYNKQQLRHFLQQLAMLQH  66

Query  64   GRSIELIETAQGFRFQVRSKYRNMIAQVWPERPTKLSPSLLETIAVIAYHQPVTRADIEQ  123
            GRSIELIETAQGFRFQVR+KYRN+IAQVWPERPTKLSPSLLET+AVIAYHQPVTRADIEQ
Sbjct  67   GRSIELIETAQGFRFQVRAKYRNIIAQVWPERPTKLSPSLLETVAVIAYHQPVTRADIEQ  126

Query  124  IRGVSNNSQILRMLFEWNWIKESGFRDLPGRPALLITTPQFLNAFGLVSLGQLPPLQDAK  183
            IRGVSNNSQILR LF+WNWIKESGFRDLPGRPALL+TTPQFLNAFGL SLGQLPPLQ+AK
Sbjct  127  IRGVSNNSQILRNLFDWNWIKESGFRDLPGRPALLVTTPQFLNAFGLASLGQLPPLQNAK  186

Query  184  DAFMSLDVNTPKS  196
            +AFM+LD + PKS
Sbjct  187  EAFMTLDAHAPKS  199


> A0A1Q3NNV1 Segregation and condensation protein B [Acinetobacter 
sp. 38-8]
Length=199

 Score =  350 bits (898),  Expect = 1e-126
 Identities = 171/193 (89%), Positives = 185/193 (96%), Gaps = 0/193 (0%)

Query  4    DQSSALSLEDIHHEVLLQIEAILFASDVPISLARLKEAFQNQYNKQQLRHFLQQLAVLQH  63
            D +  +SLEDIHH+VLLQIEAILFASD P+SLARLKEAFQNQYNKQQLRHFLQQLA+LQH
Sbjct  7    DTNEGMSLEDIHHDVLLQIEAILFASDSPVSLARLKEAFQNQYNKQQLRHFLQQLAMLQH  66

Query  64   GRSIELIETAQGFRFQVRSKYRNMIAQVWPERPTKLSPSLLETIAVIAYHQPVTRADIEQ  123
            GRSIELIETAQGFRFQVR+KYRN+IAQVWPERPTKLSPSLLET+AVIAYHQPVTRADIEQ
Sbjct  67   GRSIELIETAQGFRFQVRAKYRNIIAQVWPERPTKLSPSLLETVAVIAYHQPVTRADIEQ  126

Query  124  IRGVSNNSQILRMLFEWNWIKESGFRDLPGRPALLITTPQFLNAFGLVSLGQLPPLQDAK  183
            IRGVSNNSQILR LF+WNWIKESGFRDLPGRPALL+TTPQFLNAFGL SLGQLPPLQ+AK
Sbjct  127  IRGVSNNSQILRNLFDWNWIKESGFRDLPGRPALLVTTPQFLNAFGLASLGQLPPLQNAK  186

Query  184  DAFMSLDVNTPKS  196
            +AFM+LD + PKS
Sbjct  187  EAFMTLDAHAPKS  199


> N8QXA9 Segregation and condensation protein B [Acinetobacter 
sp. NIPH 236]
Length=199

 Score =  350 bits (898),  Expect = 1e-126
 Identities = 171/193 (89%), Positives = 185/193 (96%), Gaps = 0/193 (0%)

Query  4    DQSSALSLEDIHHEVLLQIEAILFASDVPISLARLKEAFQNQYNKQQLRHFLQQLAVLQH  63
            D +  +SLEDIHH+VLLQIEAILFASD P+SLARLKEAFQNQYNKQQLRHFLQQLA+LQH
Sbjct  7    DTNEGMSLEDIHHDVLLQIEAILFASDSPVSLARLKEAFQNQYNKQQLRHFLQQLAMLQH  66

Query  64   GRSIELIETAQGFRFQVRSKYRNMIAQVWPERPTKLSPSLLETIAVIAYHQPVTRADIEQ  123
            GRSIELIETAQGFRFQVR+KYRN+IAQVWPERPTKLSPSLLET+AVIAYHQPVTRADIEQ
Sbjct  67   GRSIELIETAQGFRFQVRAKYRNIIAQVWPERPTKLSPSLLETVAVIAYHQPVTRADIEQ  126

Query  124  IRGVSNNSQILRMLFEWNWIKESGFRDLPGRPALLITTPQFLNAFGLVSLGQLPPLQDAK  183
            IRGVSNNSQILR LF+WNWIKESGFRDLPGRPALL+TTPQFLNAFGL SLGQLPPLQ+AK
Sbjct  127  IRGVSNNSQILRNLFDWNWIKESGFRDLPGRPALLVTTPQFLNAFGLASLGQLPPLQNAK  186

Query  184  DAFMSLDVNTPKS  196
            +AFM+LD + PKS
Sbjct  187  EAFMTLDAHAPKS  199


> A0A1Q3N6S2 Segregation and condensation protein B [Acinetobacter 
sp. 39-4]
Length=199

 Score =  350 bits (898),  Expect = 1e-126
 Identities = 171/193 (89%), Positives = 185/193 (96%), Gaps = 0/193 (0%)

Query  4    DQSSALSLEDIHHEVLLQIEAILFASDVPISLARLKEAFQNQYNKQQLRHFLQQLAVLQH  63
            D +  +SLEDIHH+VLLQIEAILFASD P+SLARLKEAFQNQYNKQQLRHFLQQLA+LQH
Sbjct  7    DTNEGMSLEDIHHDVLLQIEAILFASDSPVSLARLKEAFQNQYNKQQLRHFLQQLAMLQH  66

Query  64   GRSIELIETAQGFRFQVRSKYRNMIAQVWPERPTKLSPSLLETIAVIAYHQPVTRADIEQ  123
            GRSIELIETAQGFRFQVR+KYRN+IAQVWPERPTKLSPSLLET+AVIAYHQPVTRADIEQ
Sbjct  67   GRSIELIETAQGFRFQVRAKYRNIIAQVWPERPTKLSPSLLETVAVIAYHQPVTRADIEQ  126

Query  124  IRGVSNNSQILRMLFEWNWIKESGFRDLPGRPALLITTPQFLNAFGLVSLGQLPPLQDAK  183
            IRGVSNNSQILR LF+WNWIKESGFRDLPGRPALL+TTPQFLNAFGL SLGQLPPLQ+AK
Sbjct  127  IRGVSNNSQILRNLFDWNWIKESGFRDLPGRPALLVTTPQFLNAFGLASLGQLPPLQNAK  186

Query  184  DAFMSLDVNTPKS  196
            +AFM+LD + PKS
Sbjct  187  EAFMTLDAHAPKS  199


> N9RVF0 Segregation and condensation protein B [Acinetobacter 
sp. NIPH 2100]
Length=199

 Score =  348 bits (894),  Expect = 5e-126
 Identities = 170/194 (88%), Positives = 186/194 (96%), Gaps = 0/194 (0%)

Query  3    IDQSSALSLEDIHHEVLLQIEAILFASDVPISLARLKEAFQNQYNKQQLRHFLQQLAVLQ  62
            +DQ+  +SLEDIHH+VLLQIEAILFASD P+SLARLKEAFQNQYNKQQLR FLQQLA+LQ
Sbjct  6    LDQTEGMSLEDIHHDVLLQIEAILFASDSPVSLARLKEAFQNQYNKQQLRFFLQQLAMLQ  65

Query  63   HGRSIELIETAQGFRFQVRSKYRNMIAQVWPERPTKLSPSLLETIAVIAYHQPVTRADIE  122
            HGRSIELIETAQGFRFQVR+KYRN+IAQVWPERPTKLSPSLLET+AVIAYHQPVTRADIE
Sbjct  66   HGRSIELIETAQGFRFQVRAKYRNIIAQVWPERPTKLSPSLLETVAVIAYHQPVTRADIE  125

Query  123  QIRGVSNNSQILRMLFEWNWIKESGFRDLPGRPALLITTPQFLNAFGLVSLGQLPPLQDA  182
            QIRGVSNNSQILR LF+WNWIKE+GFRDLPGRPALL+TTPQFLNAFGL SLGQLPPLQ+A
Sbjct  126  QIRGVSNNSQILRNLFDWNWIKEAGFRDLPGRPALLVTTPQFLNAFGLASLGQLPPLQNA  185

Query  183  KDAFMSLDVNTPKS  196
            K+AFM+LD + PKS
Sbjct  186  KEAFMTLDAHAPKS  199


> N9LUW4 Segregation and condensation protein B [Acinetobacter 
sp. ANC 3929]
Length=199

 Score =  348 bits (894),  Expect = 5e-126
 Identities = 170/194 (88%), Positives = 186/194 (96%), Gaps = 0/194 (0%)

Query  3    IDQSSALSLEDIHHEVLLQIEAILFASDVPISLARLKEAFQNQYNKQQLRHFLQQLAVLQ  62
            +DQ+  +SLEDIHH+VLLQIEAILFASD P+SLARLKEAFQNQYNKQQLR FLQQLA+LQ
Sbjct  6    LDQTEGMSLEDIHHDVLLQIEAILFASDSPVSLARLKEAFQNQYNKQQLRFFLQQLAMLQ  65

Query  63   HGRSIELIETAQGFRFQVRSKYRNMIAQVWPERPTKLSPSLLETIAVIAYHQPVTRADIE  122
            HGRSIELIETAQGFRFQVR+KYRN+IAQVWPERPTKLSPSLLET+AVIAYHQPVTRADIE
Sbjct  66   HGRSIELIETAQGFRFQVRAKYRNIIAQVWPERPTKLSPSLLETVAVIAYHQPVTRADIE  125

Query  123  QIRGVSNNSQILRMLFEWNWIKESGFRDLPGRPALLITTPQFLNAFGLVSLGQLPPLQDA  182
            QIRGVSNNSQILR LF+WNWIKE+GFRDLPGRPALL+TTPQFLNAFGL SLGQLPPLQ+A
Sbjct  126  QIRGVSNNSQILRNLFDWNWIKEAGFRDLPGRPALLVTTPQFLNAFGLASLGQLPPLQNA  185

Query  183  KDAFMSLDVNTPKS  196
            K+AFM+LD + PKS
Sbjct  186  KEAFMTLDAHAPKS  199


> V2UJY3 Segregation and condensation protein B [Acinetobacter 
tjernbergiae DSM 14971 = CIP 107465]
Length=199

 Score =  348 bits (894),  Expect = 5e-126
 Identities = 171/195 (88%), Positives = 185/195 (95%), Gaps = 0/195 (0%)

Query  2    TIDQSSALSLEDIHHEVLLQIEAILFASDVPISLARLKEAFQNQYNKQQLRHFLQQLAVL  61
            + D +  +SLEDIHH+VLLQIEAILFASD P+SLARLKEAFQNQYNKQQLR FLQQLAVL
Sbjct  5    SFDPNEGMSLEDIHHDVLLQIEAILFASDSPVSLARLKEAFQNQYNKQQLRQFLQQLAVL  64

Query  62   QHGRSIELIETAQGFRFQVRSKYRNMIAQVWPERPTKLSPSLLETIAVIAYHQPVTRADI  121
            QHGRSIELIETAQGFRFQVR+KYRN+IAQVWPERPTKLSPSLLET+AVIAYHQPVTRADI
Sbjct  65   QHGRSIELIETAQGFRFQVRAKYRNIIAQVWPERPTKLSPSLLETVAVIAYHQPVTRADI  124

Query  122  EQIRGVSNNSQILRMLFEWNWIKESGFRDLPGRPALLITTPQFLNAFGLVSLGQLPPLQD  181
            EQIRGVSNNSQILR LF+WNWIKESGFRDLPGRPALL+TTPQFLNAFGL SLGQLPPLQ+
Sbjct  125  EQIRGVSNNSQILRNLFDWNWIKESGFRDLPGRPALLVTTPQFLNAFGLASLGQLPPLQN  184

Query  182  AKDAFMSLDVNTPKS  196
            AK+AFM+LD + PKS
Sbjct  185  AKEAFMTLDAHAPKS  199


> N9FV93 Segregation and condensation protein B [Acinetobacter 
beijerinckii CIP 110307]
Length=199

 Score =  348 bits (893),  Expect = 7e-126
 Identities = 170/194 (88%), Positives = 185/194 (95%), Gaps = 0/194 (0%)

Query  3    IDQSSALSLEDIHHEVLLQIEAILFASDVPISLARLKEAFQNQYNKQQLRHFLQQLAVLQ  62
            +D +  +SLEDIHH+VLLQ+EAILFASD P+SLARLKEAFQNQYNKQQLR FLQQLAVLQ
Sbjct  6    LDSNEGMSLEDIHHDVLLQMEAILFASDSPVSLARLKEAFQNQYNKQQLRQFLQQLAVLQ  65

Query  63   HGRSIELIETAQGFRFQVRSKYRNMIAQVWPERPTKLSPSLLETIAVIAYHQPVTRADIE  122
            HGRSIELIETAQGFRFQVR+KYRN+IAQVWPERPTKLSPSLLET+AVIAYHQPVTRADIE
Sbjct  66   HGRSIELIETAQGFRFQVRAKYRNIIAQVWPERPTKLSPSLLETVAVIAYHQPVTRADIE  125

Query  123  QIRGVSNNSQILRMLFEWNWIKESGFRDLPGRPALLITTPQFLNAFGLVSLGQLPPLQDA  182
            QIRGVSNNSQILR LF+WNWIKESGFRDLPGRPALL+TTPQFLNAFGL SLGQLPPLQ+A
Sbjct  126  QIRGVSNNSQILRNLFDWNWIKESGFRDLPGRPALLVTTPQFLNAFGLASLGQLPPLQNA  185

Query  183  KDAFMSLDVNTPKS  196
            K+AFM+LD + PKS
Sbjct  186  KEAFMTLDAHAPKS  199


> N9DVV1 Segregation and condensation protein B [Acinetobacter 
beijerinckii ANC 3835]
Length=199

 Score =  348 bits (893),  Expect = 7e-126
 Identities = 170/194 (88%), Positives = 185/194 (95%), Gaps = 0/194 (0%)

Query  3    IDQSSALSLEDIHHEVLLQIEAILFASDVPISLARLKEAFQNQYNKQQLRHFLQQLAVLQ  62
            +D +  +SLEDIHH+VLLQ+EAILFASD P+SLARLKEAFQNQYNKQQLR FLQQLAVLQ
Sbjct  6    LDSNEGMSLEDIHHDVLLQMEAILFASDSPVSLARLKEAFQNQYNKQQLRQFLQQLAVLQ  65

Query  63   HGRSIELIETAQGFRFQVRSKYRNMIAQVWPERPTKLSPSLLETIAVIAYHQPVTRADIE  122
            HGRSIELIETAQGFRFQVR+KYRN+IAQVWPERPTKLSPSLLET+AVIAYHQPVTRADIE
Sbjct  66   HGRSIELIETAQGFRFQVRAKYRNIIAQVWPERPTKLSPSLLETVAVIAYHQPVTRADIE  125

Query  123  QIRGVSNNSQILRMLFEWNWIKESGFRDLPGRPALLITTPQFLNAFGLVSLGQLPPLQDA  182
            QIRGVSNNSQILR LF+WNWIKESGFRDLPGRPALL+TTPQFLNAFGL SLGQLPPLQ+A
Sbjct  126  QIRGVSNNSQILRNLFDWNWIKESGFRDLPGRPALLVTTPQFLNAFGLASLGQLPPLQNA  185

Query  183  KDAFMSLDVNTPKS  196
            K+AFM+LD + PKS
Sbjct  186  KEAFMTLDAHAPKS  199


> A0A0M3A0K7 Segregation and condensation protein B [Acinetobacter 
sp. AG1]
Length=199

 Score =  348 bits (893),  Expect = 7e-126
 Identities = 170/193 (88%), Positives = 184/193 (95%), Gaps = 0/193 (0%)

Query  4    DQSSALSLEDIHHEVLLQIEAILFASDVPISLARLKEAFQNQYNKQQLRHFLQQLAVLQH  63
            D +  +SLEDIHH+VLLQIEAILFASD P+SLARLKEAFQNQYNKQQLRHFLQQLA+LQH
Sbjct  7    DTNEGMSLEDIHHDVLLQIEAILFASDSPVSLARLKEAFQNQYNKQQLRHFLQQLAMLQH  66

Query  64   GRSIELIETAQGFRFQVRSKYRNMIAQVWPERPTKLSPSLLETIAVIAYHQPVTRADIEQ  123
            GRSIELIETAQGFRFQVR+KYRN+IAQVWPERPTKLSPSLLET+AVIAYHQPVTRADIEQ
Sbjct  67   GRSIELIETAQGFRFQVRAKYRNIIAQVWPERPTKLSPSLLETVAVIAYHQPVTRADIEQ  126

Query  124  IRGVSNNSQILRMLFEWNWIKESGFRDLPGRPALLITTPQFLNAFGLVSLGQLPPLQDAK  183
            IRGVSNNS ILR LF+WNWIKESGFRDLPGRPALL+TTPQFLNAFGL SLGQLPPLQ+AK
Sbjct  127  IRGVSNNSHILRNLFDWNWIKESGFRDLPGRPALLVTTPQFLNAFGLASLGQLPPLQNAK  186

Query  184  DAFMSLDVNTPKS  196
            +AFM+LD + PKS
Sbjct  187  EAFMTLDAHAPKS  199


> A0A009ZQ83 Segregation and condensation protein B [Acinetobacter 
sp. 479375]
Length=196

 Score =  347 bits (891),  Expect = 1e-125
 Identities = 172/196 (88%), Positives = 184/196 (94%), Gaps = 0/196 (0%)

Query  1    MTIDQSSALSLEDIHHEVLLQIEAILFASDVPISLARLKEAFQNQYNKQQLRHFLQQLAV  60
            MT+DQ  A+S ED+HH+VLLQIEAILFASD P+SLARLK+AFQ+QYNK QLR FLQQLAV
Sbjct  1    MTLDQQLAMSPEDMHHDVLLQIEAILFASDAPVSLARLKQAFQDQYNKPQLRQFLQQLAV  60

Query  61   LQHGRSIELIETAQGFRFQVRSKYRNMIAQVWPERPTKLSPSLLETIAVIAYHQPVTRAD  120
            LQHGRSIELIETAQGFRFQVRSKYRN+I QVWPERPTKLSPSLLETIAVIAYHQPVTRAD
Sbjct  61   LQHGRSIELIETAQGFRFQVRSKYRNIITQVWPERPTKLSPSLLETIAVIAYHQPVTRAD  120

Query  121  IEQIRGVSNNSQILRMLFEWNWIKESGFRDLPGRPALLITTPQFLNAFGLVSLGQLPPLQ  180
            IEQIRGV+NNSQILR LF+WNWIKESGFRDLPGRPALLITTPQFLNAFGL SLGQLPPLQ
Sbjct  121  IEQIRGVTNNSQILRTLFDWNWIKESGFRDLPGRPALLITTPQFLNAFGLASLGQLPPLQ  180

Query  181  DAKDAFMSLDVNTPKS  196
            DAK+AFM+LD N  KS
Sbjct  181  DAKEAFMTLDANAAKS  196


> N9C288 Segregation and condensation protein B [Acinetobacter 
ursingii ANC 3649]
Length=196

 Score =  347 bits (891),  Expect = 1e-125
 Identities = 172/196 (88%), Positives = 184/196 (94%), Gaps = 0/196 (0%)

Query  1    MTIDQSSALSLEDIHHEVLLQIEAILFASDVPISLARLKEAFQNQYNKQQLRHFLQQLAV  60
            MT+DQ  A+S ED+HH+VLLQIEAILFASD P+SLARLK+AFQ+QYNK QLR FLQQLAV
Sbjct  1    MTLDQQLAMSPEDMHHDVLLQIEAILFASDAPVSLARLKQAFQDQYNKPQLRQFLQQLAV  60

Query  61   LQHGRSIELIETAQGFRFQVRSKYRNMIAQVWPERPTKLSPSLLETIAVIAYHQPVTRAD  120
            LQHGRSIELIETAQGFRFQVRSKYRN+I QVWPERPTKLSPSLLETIAVIAYHQPVTRAD
Sbjct  61   LQHGRSIELIETAQGFRFQVRSKYRNIITQVWPERPTKLSPSLLETIAVIAYHQPVTRAD  120

Query  121  IEQIRGVSNNSQILRMLFEWNWIKESGFRDLPGRPALLITTPQFLNAFGLVSLGQLPPLQ  180
            IEQIRGV+NNSQILR LF+WNWIKESGFRDLPGRPALLITTPQFLNAFGL SLGQLPPLQ
Sbjct  121  IEQIRGVTNNSQILRTLFDWNWIKESGFRDLPGRPALLITTPQFLNAFGLASLGQLPPLQ  180

Query  181  DAKDAFMSLDVNTPKS  196
            DAK+AFM+LD N  KS
Sbjct  181  DAKEAFMTLDANAAKS  196


> N9QT19 Segregation and condensation protein B [Acinetobacter 
ursingii NIPH 706]
Length=196

 Score =  347 bits (891),  Expect = 1e-125
 Identities = 172/196 (88%), Positives = 184/196 (94%), Gaps = 0/196 (0%)

Query  1    MTIDQSSALSLEDIHHEVLLQIEAILFASDVPISLARLKEAFQNQYNKQQLRHFLQQLAV  60
            MT+DQ  A+S ED+HH+VLLQIEAILFASD P+SLARLK+AFQ+QYNK QLR FLQQLAV
Sbjct  1    MTLDQQLAMSPEDMHHDVLLQIEAILFASDAPVSLARLKQAFQDQYNKPQLRQFLQQLAV  60

Query  61   LQHGRSIELIETAQGFRFQVRSKYRNMIAQVWPERPTKLSPSLLETIAVIAYHQPVTRAD  120
            LQHGRSIELIETAQGFRFQVRSKYRN+I QVWPERPTKLSPSLLETIAVIAYHQPVTRAD
Sbjct  61   LQHGRSIELIETAQGFRFQVRSKYRNIITQVWPERPTKLSPSLLETIAVIAYHQPVTRAD  120

Query  121  IEQIRGVSNNSQILRMLFEWNWIKESGFRDLPGRPALLITTPQFLNAFGLVSLGQLPPLQ  180
            IEQIRGV+NNSQILR LF+WNWIKESGFRDLPGRPALLITTPQFLNAFGL SLGQLPPLQ
Sbjct  121  IEQIRGVTNNSQILRTLFDWNWIKESGFRDLPGRPALLITTPQFLNAFGLASLGQLPPLQ  180

Query  181  DAKDAFMSLDVNTPKS  196
            DAK+AFM+LD N  KS
Sbjct  181  DAKEAFMTLDANAAKS  196


> A0A2R4TIG4 Segregation and condensation protein B [Acinetobacter 
sp. WCHA45]
Length=199

 Score =  347 bits (890),  Expect = 2e-125
 Identities = 170/193 (88%), Positives = 184/193 (95%), Gaps = 0/193 (0%)

Query  4    DQSSALSLEDIHHEVLLQIEAILFASDVPISLARLKEAFQNQYNKQQLRHFLQQLAVLQH  63
            D +  +SLEDIHH+VLLQIEAILFASD P+SLARLKEAFQNQYNKQQLRHFLQQLA+LQH
Sbjct  7    DTNEGMSLEDIHHDVLLQIEAILFASDSPVSLARLKEAFQNQYNKQQLRHFLQQLAMLQH  66

Query  64   GRSIELIETAQGFRFQVRSKYRNMIAQVWPERPTKLSPSLLETIAVIAYHQPVTRADIEQ  123
            GRSIELIETAQGFRFQVR+KYRN+I QVWPERPTKLSPSLLET+AVIAYHQPVTRADIEQ
Sbjct  67   GRSIELIETAQGFRFQVRAKYRNIITQVWPERPTKLSPSLLETVAVIAYHQPVTRADIEQ  126

Query  124  IRGVSNNSQILRMLFEWNWIKESGFRDLPGRPALLITTPQFLNAFGLVSLGQLPPLQDAK  183
            IRGVSNNSQILR LF+WNWIKE+GFRDLPGRPALLITTPQFLNAFGLVSL QLPPLQ+AK
Sbjct  127  IRGVSNNSQILRNLFDWNWIKEAGFRDLPGRPALLITTPQFLNAFGLVSLNQLPPLQNAK  186

Query  184  DAFMSLDVNTPKS  196
            +AFM+LD + PKS
Sbjct  187  EAFMALDAHAPKS  199


> Q8KF54 Segregation and condensation protein B [Chlorobaculum 
tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)]
Length=209

 Score = 99.0 bits (245),  Expect = 1e-28
 Identities = 59/177 (33%), Positives = 103/177 (58%), Gaps = 4/177 (2%)

Query  11   LEDIHHEVLLQIEAILFASDVPISLARLKEAFQNQYNKQQLRHFLQQLA--VLQHGRSIE  68
            +++   ++L  +EA++F+S+ P++L  L +   +++   +L+  + +L       GR+  
Sbjct  1    MQEQRQQLLRSLEALIFSSEEPVNLQTLSQITAHKFTPSELQEAVDELNRDYEATGRTFR  60

Query  69   LIETAQGFRFQVRSKYRNMIAQVW-PERPTKLSPSLLETIAVIAYHQPVTRADIEQIRGV  127
            +   A G+RF    ++ +++ Q+  P    +LS S+LE +AV+A+HQPVT+ +I+QIRG 
Sbjct  61   IHAIAGGYRFLTEPEFADLVRQLLAPVIQRRLSRSMLEVLAVVAWHQPVTKGEIQQIRGA  120

Query  128  SNNSQILRMLFEWNWIKESGFRDLPGRPALLITTPQFLNAFGLVSLGQLPPLQDAKD  184
            S +  I R+L     I+  G  D PGRP    TT  FL+ F L SL  LP L++ K+
Sbjct  121  SPDYSIDRLLAR-GLIEVRGRADSPGRPLQYGTTEVFLDLFHLPSLKDLPKLREIKE  176


> A0A0E0TE00 Segregation and condensation protein B [Geobacillus 
sp. (strain Y412MC52)]
Length=273

 Score = 87.4 bits (215),  Expect = 4e-24
 Identities = 62/167 (37%), Positives = 99/167 (59%), Gaps = 7/167 (4%)

Query  22   IEAILFAS-DVPISLARLKEAFQ-NQYNKQQLRHFLQQLAVLQHGRSIELIETAQGFRFQ  79
            +EA+LFA+ D  +SL+++    + ++   + +   LQQ    +  R I+L+E    F   
Sbjct  77   VEALLFAAGDEGLSLSQIAAVLEVSELEAKAVIEELQQ-DCRREERGIQLVELGGVFLLA  135

Query  80   VRSKYRNMIAQVWPERP--TKLSPSLLETIAVIAYHQPVTRADIEQIRGVSNNSQILRML  137
             + ++   + ++  E P  + LS + LET+A+IAY QP+TRA+IE+IRGV ++   L+ L
Sbjct  136  TKKEHAPYLKKL-VEAPGASPLSQAALETLAIIAYRQPITRAEIEEIRGVKSDKP-LQTL  193

Query  138  FEWNWIKESGFRDLPGRPALLITTPQFLNAFGLVSLGQLPPLQDAKD  184
                 IKE G  +  GRP L  TTP+FL+ FGL +L +LPPL +  D
Sbjct  194  MARALIKEVGRAEGTGRPILYGTTPEFLDYFGLKTLEELPPLPEWAD  240


> O33209 Segregation and condensation protein B [Mycobacterium 
tuberculosis (strain CDC 1551 / Oshkosh)]
Length=231

 Score = 72.8 bits (177),  Expect = 3e-19
 Identities = 50/159 (31%), Positives = 79/159 (50%), Gaps = 3/159 (2%)

Query  22   IEAILFASDVPISLARLKEAFQNQYNKQQLRHFLQQLAVLQHGRSIELIETAQGFRFQVR  81
            +EA+L   D P++   L  A +    +   +  L    +      I+L  T++G+R   R
Sbjct  32   LEALLLVIDTPVTADALAAATEQPVYRVAAKLQLMADELTGRDSGIDLRHTSEGWRMYTR  91

Query  82   SKYRNMIAQVWPERP-TKLSPSLLETIAVIAYHQPVTRADIEQIRGVSNNSQILRMLFEW  140
            +++   + ++  +   TKL+ + LET+AV+AY QPVTRA +  +RGV N   ++R L   
Sbjct  92   ARFAPYVEKLLLDGARTKLTRAALETLAVVAYRQPVTRARVSAVRGV-NVDAVMRTLLAR  150

Query  141  NWIKESGFRDLPGRPALLITTPQFLNAFGLVSLGQLPPL  179
              I E G  D         TT  FL   GL SL +LP +
Sbjct  151  GLITEVG-TDADTGAVTFATTELFLERLGLTSLSELPDI  188



Lambda      K        H        a         alpha
   0.324    0.137    0.400    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 557076


  Database: 378896ce362ae8267867467689561613.TrEMBL.fasta
    Posted date:  Sep 19, 2020  2:56 PM
  Number of letters in database: 4,473
  Number of sequences in database:  22



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40