ACIAD0862 / SwissProt Alignments

BLASTP 2.2.28+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: 84fe12a6156aad89cc161e0ed30fe610.SwissProt.fasta
           14 sequences; 2,664 total letters



Query= ACIAD0862

Length=197
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  Q83CP9 Segregation and condensation protein B homolog [Coxiella...   135    9e-43
  Q3A508 Segregation and condensation protein B [Pelobacter carbi...   107    6e-32
  Q894L3 Segregation and condensation protein B [Clostridium teta...  99.8    3e-29
  Q8RAA0 Segregation and condensation protein B [Caldanaerobacter...  95.9    5e-28
  Q3AAS0 Segregation and condensation protein B [Carboxydothermus...  93.6    5e-27
  A3DD94 Segregation and condensation protein B [Hungateiclostrid...  93.2    9e-27
  C4Z9E6 Segregation and condensation protein B [Agathobacter rec...  92.4    1e-26
  A4J3L6 Segregation and condensation protein B [Desulfotomaculum...  91.3    3e-26
  A6TR67 Segregation and condensation protein B [Alkaliphilus met...  91.3    4e-26
  B8I2V4 Segregation and condensation protein B [Ruminiclostridiu...  91.3    4e-26
  Q46206 Segregation and condensation protein B [Clostridium perf...  85.1    8e-24
  P35155 Segregation and condensation protein B [Bacillus subtili...  80.9    3e-22
  Q8DNI9 Segregation and condensation protein B [Streptococcus pn...  78.2    2e-21
  Q9EUR1 Segregation and condensation protein B [Streptococcus mi...  75.5    2e-20


> Q83CP9 Segregation and condensation protein B homolog [Coxiella 
burnetii (strain RSA 493 / Nine Mile phase I)]
Length=209

 Score =  135 bits (341),  Expect = 9e-43
 Identities = 68/165 (41%), Positives = 106/165 (64%), Gaps = 2/165 (1%)

Query  22   IEAILFASDVPISLARLKEAF--QNQYNKQQLRHFLQQLAVLQHGRSIELIETAQGFRFQ  79
            IEA LFAS  P++  RL++ F  QN  +  ++++ L +L      R ++L E A G+RFQ
Sbjct  10   IEAALFASAEPLTPERLQQLFDEQNPISLSEIKNLLSELKEDYRERGVDLQEVASGYRFQ  69

Query  80   VRSKYRNMIAQVWPERPTKLSPSLLETIAVIAYHQPVTRADIEQIRGVSNNSQILRMLFE  139
             R  +   + ++W ++P + S +LLET+A+I Y QP++R +IE++RGV+ +S I++ L +
Sbjct  70   ARPDFSPWLQRLWEKKPARYSRALLETLALIVYRQPISRGEIEEVRGVAVSSDIIKKLLD  129

Query  140  WNWIKESGFRDLPGRPALLITTPQFLNAFGLVSLGQLPPLQDAKD  184
              WI     RD+PG+PAL  TT  FL+ F L SL +LPPL+D  D
Sbjct  130  REWISVVAHRDVPGKPALFGTTKTFLDYFNLKSLEELPPLEDVVD  174


> Q3A508 Segregation and condensation protein B [Pelobacter carbinolicus 
(strain DSM 2380 / NBRC 103641 / GraBd1)]
Length=197

 Score =  107 bits (266),  Expect = 6e-32
 Identities = 61/162 (38%), Positives = 99/162 (61%), Gaps = 5/162 (3%)

Query  22   IEAILFASDVPISLARLKEAFQNQYNKQQLRHFLQQLAV--LQHGRSIELIETAQGFRFQ  79
            IEA+LFA+  P+ L +L  A     +  ++   L +L    L+ GR   L+E A+G++ +
Sbjct  10   IEALLFAAPGPVRLEQL--ALAADADPARVAPLLAELETEYLRAGRGFVLVELAEGYQLR  67

Query  80   VRSKYRNMIAQVWPERPTKLSPSLLETIAVIAYHQPVTRADIEQIRGVSNNSQILRMLFE  139
             R ++   + ++   RPT+LS + LE +A+IAY QPVTRADI+ +RGV +   +++ L +
Sbjct  68   TRPEHAEWVRRLHSSRPTRLSRAALEALAIIAYQQPVTRADIDYLRGVDSGG-VVKSLLD  126

Query  140  WNWIKESGFRDLPGRPALLITTPQFLNAFGLVSLGQLPPLQD  181
               ++  G +D+PGRP L  T+ +FL  FGL SL  LP L++
Sbjct  127  KRLVRIVGKKDVPGRPLLYGTSREFLEFFGLRSLSDLPTLKE  168


> Q894L3 Segregation and condensation protein B [Clostridium tetani 
(strain Massachusetts / E88)]
Length=189

 Score = 99.8 bits (247),  Expect = 3e-29
 Identities = 60/173 (35%), Positives = 104/173 (60%), Gaps = 6/173 (3%)

Query  22   IEAILFASDVPISLARLKEAFQNQY--NKQQLRHFLQQLAVLQHGRSIELIETAQGFRFQ  79
            IE++LFAS  P+ L  + E  +      K+ L+  +++  + + G  I+LIE  + ++  
Sbjct  20   IESLLFASGEPLGLKDISEIIELNTLDTKEILQKMIREYEIEKRG--IKLIEIEKKYQLV  77

Query  80   VRSKYRNMIAQVWPERPTK-LSPSLLETIAVIAYHQPVTRADIEQIRGVSNNSQILRMLF  138
             + +    I Q+     ++ LS + LET++++AY QPVTR D+++IRGV ++ + L+ L 
Sbjct  78   TKEENSCFIEQLLKTNSSQSLSQAALETLSIVAYKQPVTRVDVDEIRGVKSD-RALQTLL  136

Query  139  EWNWIKESGFRDLPGRPALLITTPQFLNAFGLVSLGQLPPLQDAKDAFMSLDV  191
            + + IKE+G  D+PGRP L  TT +FL  FGL S+ +LP L++  + F   D+
Sbjct  137  QKSLIKETGRLDVPGRPILYSTTEEFLKHFGLESIKELPSLEELLEEFQEEDL  189


> Q8RAA0 Segregation and condensation protein B [Caldanaerobacter 
subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 
11007 / NBRC 100824 / MB4)]
Length=168

 Score = 95.9 bits (237),  Expect = 5e-28
 Identities = 59/163 (36%), Positives = 96/163 (59%), Gaps = 6/163 (4%)

Query  21   QIEAILFASDVPISLARLKEAFQNQYNKQQLRHFLQQLA--VLQHGRSIELIETAQGFRF  78
            +IEAILFA+   + +  L EA +    ++++R  L++L    +++ R I+++        
Sbjct  6    KIEAILFAAGQAVKIRTLAEALE--VTEEEVRELLKRLKEEYVKNHRGIDIVIFEDKVEM  63

Query  79   QVRSKYRNMIAQVWPERPTK-LSPSLLETIAVIAYHQPVTRADIEQIRGVSNNSQILRML  137
                 Y +++ +      T+ LS + LE +A+IAY+QP+T+A+IE+IRGV ++  I   L
Sbjct  64   CTNDSYGDIVRKALKMEITQGLSQAALEVLAIIAYNQPITKAEIERIRGVRSDKPI-NTL  122

Query  138  FEWNWIKESGFRDLPGRPALLITTPQFLNAFGLVSLGQLPPLQ  180
             E+N IKESG    PGRP L  TT  FL  FG+ SL +LP ++
Sbjct  123  LEYNLIKESGRASSPGRPILYSTTEDFLKYFGISSLKELPEIE  165


> Q3AAS0 Segregation and condensation protein B [Carboxydothermus 
hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)]
Length=185

 Score = 93.6 bits (231),  Expect = 5e-27
 Identities = 59/164 (36%), Positives = 90/164 (55%), Gaps = 1/164 (1%)

Query  22   IEAILFASDVPISLARLKEAFQNQYNKQQLRHFLQQLAVLQHGRSIELIETAQGFRFQVR  81
            +EA+LF S  P+SL ++ +  +    + +      Q  + Q  R I L  + +      R
Sbjct  13   LEALLFVSPEPLSLKKIAQTLELSVEEAKEIVLRLQEKLEQDQRGIMLHFSGEEVWLTTR  72

Query  82   SKYRNMIAQVWPERPTKLSPSLLETIAVIAYHQPVTRADIEQIRGVSNNSQILRMLFEWN  141
              +   I +++      L+ + LET+A+IAY QPVT+ +IE IRGV  +S I  +L E  
Sbjct  73   PDFSVYIERLFKPPAQHLTQATLETLAIIAYKQPVTKTEIELIRGVKADSSIATLL-EKG  131

Query  142  WIKESGFRDLPGRPALLITTPQFLNAFGLVSLGQLPPLQDAKDA  185
             I+E+G +D PGRP +  TT +FL  FGL SL +LPPL    +A
Sbjct  132  LIEEAGRKDAPGRPIIYRTTAKFLEFFGLKSLDELPPLNLENEA  175


> A3DD94 Segregation and condensation protein B [Hungateiclostridium 
thermocellum (strain ATCC 27405 / DSM 1237 / JCM 9322 
/ NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)]
Length=198

 Score = 93.2 bits (230),  Expect = 9e-27
 Identities = 59/174 (34%), Positives = 104/174 (60%), Gaps = 8/174 (5%)

Query  23   EAILFASDVPISLARLKEAFQNQYNKQQLRHFLQQLAVLQHG---RSIELIETAQGFRFQ  79
            E +LFAS   +S+ +L        +K+ ++  +  + V  +    R I + E   G++  
Sbjct  11   EGMLFASGDKVSIEKLSSI--TGIDKKTVKLVINNMIVKYNNDPSRGITIREINNGYQLC  68

Query  80   VRSKYRNMIAQVW-PERPTKLSPSLLETIAVIAYHQPVTRADIEQIRGVSNNSQILRMLF  138
             + +Y + I Q++ P++ + LS + LET+A+IAY++P+T+A IEQIRGV+++S I ++L 
Sbjct  69   SKPEYYDYIKQLFEPKQRSGLSQAALETLAIIAYNRPITKAKIEQIRGVNSDSAITKLL-  127

Query  139  EWNWIKESGFRDLPGRPALLITTPQFLNAFGLVSLGQLPPLQDAKDAFMSLDVN  192
            E N I+E+G  D PG+P L  TT +F  +FG  S   L P+ +  D   ++++N
Sbjct  128  EKNLIREAGRLDAPGKPVLYETTDEFFRSFGFKSDADL-PIFELNDIHETVEIN  180


> C4Z9E6 Segregation and condensation protein B [Agathobacter rectalis 
(strain ATCC 33656 / DSM 3377 / JCM 17463 / KCTC 5835 
/ VPI 0990)]
Length=187

 Score = 92.4 bits (228),  Expect = 1e-26
 Identities = 59/163 (36%), Positives = 96/163 (59%), Gaps = 9/163 (6%)

Query  22   IEAILFASDVPISLARLKEAFQNQYNKQQLRHFLQQLAVLQHGRS---IELIETAQGFRF  78
            IEAILF     + L R+ +A Q   N+++ +  L +L       S   + +IE    ++ 
Sbjct  7    IEAILFTMGESVELGRIADAIQ--LNEKETKKLLDELIKEYRSSSNIGMNIIELDGAYQM  64

Query  79   QVRSKYRNMIAQVWPERPTK--LSPSLLETIAVIAYHQPVTRADIEQIRGVSNNSQILRM  136
              + +    + ++  ++P K  L+  LLET+++IAY QPVT+A+IE+IRGVS+   + + 
Sbjct  65   CTKPQMYEYLIRI-AKQPKKRVLTDVLLETLSIIAYKQPVTKAEIEKIRGVSSEHAVSK-  122

Query  137  LFEWNWIKESGFRDLPGRPALLITTPQFLNAFGLVSLGQLPPL  179
            L E+N ++E G  D PGRP L  TT +FL +FG+ S+ +LP L
Sbjct  123  LVEYNLVQELGRLDAPGRPLLFGTTEEFLRSFGVSSIDELPVL  165


> A4J3L6 Segregation and condensation protein B [Desulfotomaculum 
reducens (strain MI-1)]
Length=181

 Score = 91.3 bits (225),  Expect = 3e-26
 Identities = 55/162 (34%), Positives = 93/162 (57%), Gaps = 5/162 (3%)

Query  22   IEAILFASDVPISLARLKEAFQNQYNKQQLRHFLQQLAVLQHGR--SIELIETAQGFRFQ  79
            +EA+LF +  P+++  L    +   +       L +LA     R   +++++ +  ++  
Sbjct  13   LEALLFVASEPLTVQALARIVE--IDVADALELLLELAKEYQDRPGGLKIVQVSDTWQIC  70

Query  80   VRSKYRNMIAQVWPERPTKLSPSLLETIAVIAYHQPVTRADIEQIRGVSNNSQILRMLFE  139
             R +    I +++ +  T LS + +ET+A+IAY QP+TR+++E IRGV  +S I   L E
Sbjct  71   TRPECAPYIERLYRKSGTGLSKAAIETLAIIAYRQPITRSEVEMIRGVKVDSPI-NTLLE  129

Query  140  WNWIKESGFRDLPGRPALLITTPQFLNAFGLVSLGQLPPLQD  181
             N I+E G R+ PGRP L  TT +FL  FGL  + +LPPL++
Sbjct  130  RNLIEEKGRREGPGRPVLYGTTLEFLKHFGLKDVSELPPLEE  171


> A6TR67 Segregation and condensation protein B [Alkaliphilus metalliredigens 
(strain QYMF)]
Length=190

 Score = 91.3 bits (225),  Expect = 4e-26
 Identities = 58/167 (35%), Positives = 92/167 (55%), Gaps = 6/167 (4%)

Query  22   IEAILFASDVPISLARLKEAFQNQYN--KQQLRHFLQQLAVLQHGRSIELIETAQGFRFQ  79
            IEAILFA   PIS + L      +    K+ ++  + +     H R I++I+    ++  
Sbjct  10   IEAILFAWSDPISSSELSNILDIKVTETKEIMKEMIDEFNF--HKRGIQIIQMNDHYQMS  67

Query  80   VRSKYRNMIAQVWPERPTK-LSPSLLETIAVIAYHQPVTRADIEQIRGVSNNSQILRMLF  138
             R++Y  ++ +++  +  K L+ + LET+A+IAY QP+T+ +IE +RGV  +  I   LF
Sbjct  68   TRAEYHEILQKLFEPKQNKGLTQASLETLAIIAYRQPITKTEIESVRGVKCDKAI-STLF  126

Query  139  EWNWIKESGFRDLPGRPALLITTPQFLNAFGLVSLGQLPPLQDAKDA  185
            E N I++ G  +  GRP L  TT  FL  FGL SL  LP + +   A
Sbjct  127  EKNLIEDRGRLEKTGRPILFGTTLHFLKNFGLKSLEDLPKITEIDQA  173


> B8I2V4 Segregation and condensation protein B [Ruminiclostridium 
cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 
/ H10)]
Length=190

 Score = 91.3 bits (225),  Expect = 4e-26
 Identities = 58/161 (36%), Positives = 97/161 (60%), Gaps = 6/161 (4%)

Query  22   IEAILFASDVPISLARLKEAFQNQYNKQQLRHFLQQL--AVLQHGRSIELIETAQGFRFQ  79
            IE+++F+   P+ L ++ E  +   +K+  R  L+ +  +     R I + E  + ++  
Sbjct  10   IESLIFSYGDPLPLDKICEILE--LDKKTARSILKNMMDSYNNSNRGIIIREINEKYQMC  67

Query  80   VRSKYRNMIAQVWPERPTK-LSPSLLETIAVIAYHQPVTRADIEQIRGVSNNSQILRMLF  138
             + +Y + +++++  R  + LS +  E +A+IAY+QP+TRA IEQIRGV+++S + R L 
Sbjct  68   SKPEYFDYVSKLYQIRQKQALSQAAYEVLAIIAYNQPITRAKIEQIRGVNSDSAVTR-LT  126

Query  139  EWNWIKESGFRDLPGRPALLITTPQFLNAFGLVSLGQLPPL  179
            E N IKE+G  D+PGRP L  TT +FL  FG  S+  LP L
Sbjct  127  ERNLIKEAGKLDVPGRPRLYETTDEFLRCFGFKSIRDLPLL  167


> Q46206 Segregation and condensation protein B [Clostridium perfringens 
(strain 13 / Type A)]
Length=195

 Score = 85.1 bits (209),  Expect = 8e-24
 Identities = 52/163 (32%), Positives = 94/163 (58%), Gaps = 7/163 (4%)

Query  22   IEAILFASDVPISLARLKEAFQNQYNKQQLRHFLQQLAVLQHG---RSIELIETAQGFRF  78
            IE++LF S  P++L  +    +  +  + +   +++L  + +G   R I++I     ++ 
Sbjct  22   IESLLFVSGEPLALKDICRIVEEDF--KYVEDLMRELMNIYNGDSSRGIKIISLNGTYQL  79

Query  79   QVRSKYRNMIAQVWPERPTK-LSPSLLETIAVIAYHQPVTRADIEQIRGVSNNSQILRML  137
              ++K    + ++  +   + LS + LE++A+I Y QP+TR +I++IRGV + S I R L
Sbjct  80   VTKTKNSEYVQKLLKKNVRQSLSQASLESLAIICYKQPITRVEIDEIRGVKSESAIQR-L  138

Query  138  FEWNWIKESGFRDLPGRPALLITTPQFLNAFGLVSLGQLPPLQ  180
             E N ++E+G  ++PGRP L  TT +FL  F L  LG LP ++
Sbjct  139  VEKNLVEETGRLEVPGRPILYGTTDEFLRHFALNDLGDLPSIE  181


> P35155 Segregation and condensation protein B [Bacillus subtilis 
(strain 168)]
Length=197

 Score = 80.9 bits (198),  Expect = 3e-22
 Identities = 56/163 (34%), Positives = 89/163 (55%), Gaps = 6/163 (4%)

Query  22   IEAILFAS-DVPISLARLKEAFQNQYNKQQLRHFLQQLAVLQHG--RSIELIETAQGFRF  78
            +EA+L+A+ D  ++  +L    + +  + +L   +  +A    G  R IELIE A  +  
Sbjct  12   VEALLYAAGDEGLTKKQLLTVLEIE--EPELNTIMADVADEYRGDTRGIELIEYADTYML  69

Query  79   QVRSKYRNMIAQVWPERPTKLSPSLLETIAVIAYHQPVTRADIEQIRGVSNNSQILRMLF  138
              +  +   + ++       LS + LE +A+++Y QP+TRA+IE+IRGV  + +IL  L 
Sbjct  70   STKKDFAPYLKKLIEVPSKGLSQASLEVLAIVSYKQPITRAEIEEIRGV-KSERILHSLV  128

Query  139  EWNWIKESGFRDLPGRPALLITTPQFLNAFGLVSLGQLPPLQD  181
                + E G  D PGR  L  TTP FL  FGL +L +LPPL +
Sbjct  129  AKALLCEVGRADGPGRAILYGTTPTFLEQFGLKTLDELPPLPE  171


> Q8DNI9 Segregation and condensation protein B [Streptococcus 
pneumoniae (strain ATCC BAA-255 / R6)]
Length=189

 Score = 78.2 bits (191),  Expect = 2e-21
 Identities = 58/167 (35%), Positives = 93/167 (56%), Gaps = 6/167 (4%)

Query  19   LLQIEAILF-ASDVPISLARLKEAFQ-NQYNKQQLRHFLQQLAVLQHGRSIELIETAQGF  76
            L +IEA+LF A +  I + +L E         QQ    L Q        S+ LIET+  +
Sbjct  4    LAKIEALLFVAGEDGIRVRQLAELLSLPPTGIQQSLGKLAQKYEKDPDSSLALIETSGAY  63

Query  77   RFQVRSKYRNMIAQVWPERPTK--LSPSLLETIAVIAYHQPVTRADIEQIRGVSNNSQIL  134
            R   + ++  ++ + + + P    LS + LET+++IAY QP+TR +I+ IRGV N+S  L
Sbjct  64   RLVTKPQFAEILKE-YSKAPINQSLSRAALETLSIIAYKQPITRIEIDAIRGV-NSSGAL  121

Query  135  RMLFEWNWIKESGFRDLPGRPALLITTPQFLNAFGLVSLGQLPPLQD  181
              L  ++ IKE G +++ GRP L +TT  FL+  G+  L +LP + +
Sbjct  122  AKLQAFDLIKEDGKKEVLGRPNLYVTTDYFLDYMGINHLEELPVIDE  168


> Q9EUR1 Segregation and condensation protein B [Streptococcus 
mitis]
Length=189

 Score = 75.5 bits (184),  Expect = 2e-20
 Identities = 56/167 (34%), Positives = 90/167 (54%), Gaps = 6/167 (4%)

Query  19   LLQIEAILFASDVP-ISLARLKEAFQ-NQYNKQQLRHFLQQLAVLQHGRSIELIETAQGF  76
            L +IEA+LF      I + +L E         QQ    L Q        S++LIET   +
Sbjct  4    LAKIEALLFVRGEDWIRVRQLAELLSLPPTGIQQSLEKLSQKYEKDLDSSLDLIETGGAY  63

Query  77   RFQVRSKYRNMIAQVWPERPTK--LSPSLLETIAVIAYHQPVTRADIEQIRGVSNNSQIL  134
            R   + ++  ++ + + + P    LS   LET+++IAY QP+TR +I+ IRGV N+S  L
Sbjct  64   RLVTKPQFSEILKE-YSKAPINQSLSRPALETLSIIAYKQPITRIEIDAIRGV-NSSGAL  121

Query  135  RMLFEWNWIKESGFRDLPGRPALLITTPQFLNAFGLVSLGQLPPLQD  181
              L  ++ I+E G +++ GRP L +TT  FL+  G+  L +LP + +
Sbjct  122  AKLQAFDLIREDGKKEVLGRPNLYVTTDYFLDYMGINHLEELPVIDE  168



Lambda      K        H        a         alpha
   0.324    0.137    0.400    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 343360


  Database: 84fe12a6156aad89cc161e0ed30fe610.SwissProt.fasta
    Posted date:  Sep 18, 2020  3:13 PM
  Number of letters in database: 2,664
  Number of sequences in database:  14



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40