ACIAD0843 / TrEMBL Alignments

BLASTP 2.2.28+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: 1fe13fe30ed2430fa5940f688c606d90.TrEMBL.fasta
           1 sequences; 43 total letters



Query= ACIAD0843

Length=44
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  Q6FDW4 Uncharacterized protein [Acinetobacter baylyi (strain AT...  92.4    7e-32


> Q6FDW4 Uncharacterized protein [Acinetobacter baylyi (strain 
ATCC 33305 / BD413 / ADP1)]
Length=43

 Score = 92.4 bits (228),  Expect = 7e-32
 Identities = 42/43 (98%), Positives = 43/43 (100%), Gaps = 0/43 (0%)

Query  1   LAQNAIKLLDNDIVKKDSNQLKNNEHHDGLAEGCPINNEKGEP  43
           +AQNAIKLLDNDIVKKDSNQLKNNEHHDGLAEGCPINNEKGEP
Sbjct  1   MAQNAIKLLDNDIVKKDSNQLKNNEHHDGLAEGCPINNEKGEP  43



Lambda      K        H        a         alpha
   0.319    0.140    0.419    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1892


  Database: 1fe13fe30ed2430fa5940f688c606d90.TrEMBL.fasta
    Posted date:  Sep 18, 2020  4:47 PM
  Number of letters in database: 43
  Number of sequences in database:  1



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40