ACIAD0765 / TrEMBL Alignments

BLASTP 2.2.28+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: 057b87d6e090aedf618525672ff7c1a2.TrEMBL.fasta
           21 sequences; 5,378 total letters



Query= ACIAD0765

Length=264
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  Q6FE39 Putative enzyme [Acinetobacter baylyi (strain ATCC 33305...   536    0.0   
  N9DCZ5 AB hydrolase-1 domain-containing protein [Acinetobacter ...   427    8e-155
  A0A009Y8F5 Alpha/beta hydrolase fold family protein [Acinetobac...   425    3e-154
  N9QLS4 AB hydrolase-1 domain-containing protein [Acinetobacter ...   425    3e-154
  A0A2N6VF56 AB hydrolase-1 domain-containing protein [Acinetobac...   421    1e-152
  A0A1Z9YYW5 AB hydrolase-1 domain-containing protein [Acinetobac...   278    2e-96 
  A0A240ED26 Pimeloyl-ACP methyl ester carboxylesterase [Acinetob...   274    9e-95 
  A0A2U8HB47 Alpha/beta hydrolase [Azoarcus communis]                  243    7e-83 
  A0A2N2UQQ0 Alpha/beta hydrolase [Betaproteobacteria bacterium H...   243    7e-83 
  A0A2W7G3M5 Pimeloyl-ACP methyl ester carboxylesterase [Paraburk...   240    2e-81 
  A0A1N6QJA7 Pimeloyl-ACP methyl ester carboxylesterase [Pseudaci...   234    2e-79 
  Q60FX2 Putative alkyl salicylate esterase [Sphingomonas paucimo...   121    6e-36 
  Q9RBI4 SalE [Acinetobacter baylyi (strain ATCC 33305 / BD413 / ...  94.4    5e-26 
  Q9LAB8 Alpha/beta hydrolase fold family protein [Burkholderia g...  88.6    7e-24 
  E0DBK6 Alpha/beta hydrolase fold superfamily [Gentiana pneumona...  87.0    2e-23 
  E1CJH7 Alpha/beta hydrolase fold superfamily [Gentiana triflora]    84.7    1e-22 
  A5A7N5 Alpha/beta hydrolase fold superfamily [Gentiana triflora...  84.0    2e-22 
  A5A7N4 Alpha/beta hydrolase fold superfamily [Gentiana triflora...  83.2    4e-22 
  E0DBK7 Alpha/beta hydrolase fold superfamily [Gentiana septemfida]  82.4    7e-22 
  E1CJH8 Alpha/beta hydrolase fold superfamily [Gentiana triflora]    82.4    7e-22 
  Q5XLS1 Protein S [Catharanthus roseus]                              80.5    3e-21 


> Q6FE39 Putative enzyme [Acinetobacter baylyi (strain ATCC 33305 
/ BD413 / ADP1)]
Length=263

 Score =  536 bits (1382),  Expect = 0.0
 Identities = 263/263 (100%), Positives = 263/263 (100%), Gaps = 0/263 (0%)

Query  1    MAKHIVLVHGAWQGSWSFDLIKPWLQQKGWTVHAVDLPDNGWNSDTQITASQQSYCDYVV  60
            MAKHIVLVHGAWQGSWSFDLIKPWLQQKGWTVHAVDLPDNGWNSDTQITASQQSYCDYVV
Sbjct  1    MAKHIVLVHGAWQGSWSFDLIKPWLQQKGWTVHAVDLPDNGWNSDTQITASQQSYCDYVV  60

Query  61   QMIHNIGEPVVLLGHSGGGLTISAVAEQIPELISHLVYLVGMMLPSNMSFLDFKKLCEQH  120
            QMIHNIGEPVVLLGHSGGGLTISAVAEQIPELISHLVYLVGMMLPSNMSFLDFKKLCEQH
Sbjct  61   QMIHNIGEPVVLLGHSGGGLTISAVAEQIPELISHLVYLVGMMLPSNMSFLDFKKLCEQH  120

Query  121  FPDEDFSGISPYLTFTDDGYSIVSSEGAKKIFLQDCEPALAEQLIEKLRPQPEAGRDLKP  180
            FPDEDFSGISPYLTFTDDGYSIVSSEGAKKIFLQDCEPALAEQLIEKLRPQPEAGRDLKP
Sbjct  121  FPDEDFSGISPYLTFTDDGYSIVSSEGAKKIFLQDCEPALAEQLIEKLRPQPEAGRDLKP  180

Query  181  VLTPERFGCVPRIYVEALNDQSLSINMQRLMQQLQPNKLQIIAMQTGHVPQAVQPDLLVE  240
            VLTPERFGCVPRIYVEALNDQSLSINMQRLMQQLQPNKLQIIAMQTGHVPQAVQPDLLVE
Sbjct  181  VLTPERFGCVPRIYVEALNDQSLSINMQRLMQQLQPNKLQIIAMQTGHVPQAVQPDLLVE  240

Query  241  KLNQILSPDKTKIQIDTGEKAAD  263
            KLNQILSPDKTKIQIDTGEKAAD
Sbjct  241  KLNQILSPDKTKIQIDTGEKAAD  263


> N9DCZ5 AB hydrolase-1 domain-containing protein [Acinetobacter 
ursingii ANC 3649]
Length=252

 Score =  427 bits (1097),  Expect = 8e-155
 Identities = 206/247 (83%), Positives = 226/247 (91%), Gaps = 0/247 (0%)

Query  1    MAKHIVLVHGAWQGSWSFDLIKPWLQQKGWTVHAVDLPDNGWNSDTQITASQQSYCDYVV  60
            MAKHIVLVHGAWQGSWSFDLIKP L+Q GW VHAVDLPDNGWNSDTQ+TA+Q +YCD+VV
Sbjct  1    MAKHIVLVHGAWQGSWSFDLIKPLLEQTGWQVHAVDLPDNGWNSDTQLTANQDNYCDFVV  60

Query  61   QMIHNIGEPVVLLGHSGGGLTISAVAEQIPELISHLVYLVGMMLPSNMSFLDFKKLCEQH  120
            Q I  IGEPVVLLGHSGGGLTISAVAE+IP+LIS+L+YLVGMMLPSNMSFLDFKKLCEQH
Sbjct  61   QTIQKIGEPVVLLGHSGGGLTISAVAEKIPDLISNLIYLVGMMLPSNMSFLDFKKLCEQH  120

Query  121  FPDEDFSGISPYLTFTDDGYSIVSSEGAKKIFLQDCEPALAEQLIEKLRPQPEAGRDLKP  180
            FPDEDF+GISPYL+FT +GYSIVS EGAKKIFLQDC+  LAE+LI KLRPQPE GRDLKP
Sbjct  121  FPDEDFAGISPYLSFTQEGYSIVSPEGAKKIFLQDCDAELAEKLIAKLRPQPETGRDLKP  180

Query  181  VLTPERFGCVPRIYVEALNDQSLSINMQRLMQQLQPNKLQIIAMQTGHVPQAVQPDLLVE  240
            VLTPE FG VPRIYVEAL DQSL INMQRLMQQLQP+ LQ+I+MQTGHVPQA+QP LLVE
Sbjct  181  VLTPECFGRVPRIYVEALYDQSLLINMQRLMQQLQPDHLQVISMQTGHVPQAIQPQLLVE  240

Query  241  KLNQILS  247
            KL Q+ +
Sbjct  241  KLTQLFT  247


> A0A009Y8F5 Alpha/beta hydrolase fold family protein [Acinetobacter 
sp. 479375]
Length=252

 Score =  425 bits (1093),  Expect = 3e-154
 Identities = 205/245 (84%), Positives = 225/245 (92%), Gaps = 0/245 (0%)

Query  1    MAKHIVLVHGAWQGSWSFDLIKPWLQQKGWTVHAVDLPDNGWNSDTQITASQQSYCDYVV  60
            MAKHIVLVHGAWQG WSFDLIKP L+Q GW VHAVDLP NGWNSDTQ++A+Q +YCD+VV
Sbjct  1    MAKHIVLVHGAWQGGWSFDLIKPLLEQTGWQVHAVDLPGNGWNSDTQLSANQDNYCDFVV  60

Query  61   QMIHNIGEPVVLLGHSGGGLTISAVAEQIPELISHLVYLVGMMLPSNMSFLDFKKLCEQH  120
            Q I  IGEPVVLLGHSGGGLTISAVAEQIP+LIS+L+YLVGMMLPSNMSFLDFK LCEQH
Sbjct  61   QTIQKIGEPVVLLGHSGGGLTISAVAEQIPDLISNLIYLVGMMLPSNMSFLDFKILCEQH  120

Query  121  FPDEDFSGISPYLTFTDDGYSIVSSEGAKKIFLQDCEPALAEQLIEKLRPQPEAGRDLKP  180
            FPDEDF+GISPYL+FT +GYSIVS EGAKKIFLQDC+  LAE+LI KLRPQPE GRDLKP
Sbjct  121  FPDEDFAGISPYLSFTQEGYSIVSPEGAKKIFLQDCDAELAEKLIAKLRPQPETGRDLKP  180

Query  181  VLTPERFGCVPRIYVEALNDQSLSINMQRLMQQLQPNKLQIIAMQTGHVPQAVQPDLLVE  240
            VLTPERFG VPRIYVEAL DQSLSINMQRLMQQLQP+ L++I+MQTGHVPQA+QP LLVE
Sbjct  181  VLTPERFGRVPRIYVEALYDQSLSINMQRLMQQLQPDHLKVISMQTGHVPQAIQPQLLVE  240

Query  241  KLNQI  245
            KLNQ+
Sbjct  241  KLNQL  245


> N9QLS4 AB hydrolase-1 domain-containing protein [Acinetobacter 
ursingii NIPH 706]
Length=252

 Score =  425 bits (1093),  Expect = 3e-154
 Identities = 205/245 (84%), Positives = 225/245 (92%), Gaps = 0/245 (0%)

Query  1    MAKHIVLVHGAWQGSWSFDLIKPWLQQKGWTVHAVDLPDNGWNSDTQITASQQSYCDYVV  60
            MAKHIVLVHGAWQG WSFDLIKP L+Q GW VHAVDLP NGWNSDTQ++A+Q +YCD+VV
Sbjct  1    MAKHIVLVHGAWQGGWSFDLIKPLLEQTGWQVHAVDLPGNGWNSDTQLSANQDNYCDFVV  60

Query  61   QMIHNIGEPVVLLGHSGGGLTISAVAEQIPELISHLVYLVGMMLPSNMSFLDFKKLCEQH  120
            Q I  IGEPVVLLGHSGGGLTISAVAEQIP+LIS+L+YLVGMMLPSNMSFLDFK LCEQH
Sbjct  61   QTIQKIGEPVVLLGHSGGGLTISAVAEQIPDLISNLIYLVGMMLPSNMSFLDFKILCEQH  120

Query  121  FPDEDFSGISPYLTFTDDGYSIVSSEGAKKIFLQDCEPALAEQLIEKLRPQPEAGRDLKP  180
            FPDEDF+GISPYL+FT +GYSIVS EGAKKIFLQDC+  LAE+LI KLRPQPE GRDLKP
Sbjct  121  FPDEDFAGISPYLSFTQEGYSIVSPEGAKKIFLQDCDAELAEKLIAKLRPQPETGRDLKP  180

Query  181  VLTPERFGCVPRIYVEALNDQSLSINMQRLMQQLQPNKLQIIAMQTGHVPQAVQPDLLVE  240
            VLTPERFG VPRIYVEAL DQSLSINMQRLMQQLQP+ L++I+MQTGHVPQA+QP LLVE
Sbjct  181  VLTPERFGRVPRIYVEALYDQSLSINMQRLMQQLQPDHLKVISMQTGHVPQAIQPQLLVE  240

Query  241  KLNQI  245
            KLNQ+
Sbjct  241  KLNQL  245


> A0A2N6VF56 AB hydrolase-1 domain-containing protein [Acinetobacter 
ursingii]
Length=252

 Score =  421 bits (1083),  Expect = 1e-152
 Identities = 205/245 (84%), Positives = 224/245 (91%), Gaps = 0/245 (0%)

Query  1    MAKHIVLVHGAWQGSWSFDLIKPWLQQKGWTVHAVDLPDNGWNSDTQITASQQSYCDYVV  60
            MAKHIVLVHGAWQGSWSFDLIK  L+Q GW VHAVDLPDNGWNSDTQ++A+Q +YCD+VV
Sbjct  1    MAKHIVLVHGAWQGSWSFDLIKLLLEQTGWQVHAVDLPDNGWNSDTQLSANQDNYCDFVV  60

Query  61   QMIHNIGEPVVLLGHSGGGLTISAVAEQIPELISHLVYLVGMMLPSNMSFLDFKKLCEQH  120
            Q I  IGEPVVLLGHSGGGLTISAVAEQIP+LI  L+YLVGMMLPSNMSFLDFK LCEQH
Sbjct  61   QTIQKIGEPVVLLGHSGGGLTISAVAEQIPDLIKSLIYLVGMMLPSNMSFLDFKILCEQH  120

Query  121  FPDEDFSGISPYLTFTDDGYSIVSSEGAKKIFLQDCEPALAEQLIEKLRPQPEAGRDLKP  180
            FPDEDF+GISPYL+FT +G SIVS EGAKKIFLQDC+  LAE+LI KLRPQPE GRDLKP
Sbjct  121  FPDEDFAGISPYLSFTQEGCSIVSPEGAKKIFLQDCDAELAEKLIAKLRPQPETGRDLKP  180

Query  181  VLTPERFGCVPRIYVEALNDQSLSINMQRLMQQLQPNKLQIIAMQTGHVPQAVQPDLLVE  240
            VLTPERFG VPRIYVEAL DQSLSINMQRLMQQLQP+ LQII+MQTGHVPQAVQP+LL+E
Sbjct  181  VLTPERFGRVPRIYVEALYDQSLSINMQRLMQQLQPDHLQIISMQTGHVPQAVQPELLIE  240

Query  241  KLNQI  245
            +LNQ+
Sbjct  241  RLNQL  245


> A0A1Z9YYW5 AB hydrolase-1 domain-containing protein [Acinetobacter 
populi]
Length=252

 Score =  278 bits (711),  Expect = 2e-96
 Identities = 143/245 (58%), Positives = 172/245 (70%), Gaps = 2/245 (1%)

Query  1    MAKHIVLVHGAWQGSWSFDLIKPWLQQKGWTVHAVDLPDNGWNSDTQITASQQSYCDYVV  60
            MAKHIVL+HGAWQGSWSFDLIKP L ++GW VHA+DLP NG + D  I  S +SY  YV 
Sbjct  1    MAKHIVLIHGAWQGSWSFDLIKPLLIERGWQVHALDLPGNGHHPDPTIEVSLRSYSQYVF  60

Query  61   QMIHNIGEPVVLLGHSGGGLTISAVAEQIPELISHLVYLVGMMLPSNMSFLDFKKLCEQH  120
              IH +GE V LLGHSGGG+TIS VAE IP+ I  L+YLVGMMLPS M+FL+ K+LCE  
Sbjct  61   DYIHALGEKVFLLGHSGGGITISQVAEMIPDRIHALIYLVGMMLPSGMTFLELKQLCEAR  120

Query  121  FPDEDFSGISPYLTFTDDG-YSIVSSEGAKKIFLQDCEPALAEQLIEKLRPQPEAGRDLK  179
            FP + F GISPYL F++ G  S V+ EG  KIFLQD     A  L      Q E GRDL+
Sbjct  121  FPGQSFEGISPYLKFSEAGKISEVTEEGVIKIFLQDYPMLEAAGLARNFTAQTETGRDLR  180

Query  180  PVLTPERFGCVPRIYVEALNDQSLSINMQRLMQQLQPNKLQIIAMQTGHVPQAVQPDLLV  239
              L+PE +G V RIY+EAL DQSL+I MQRLMQQL P   +I  + TGHVPQ + P+ +V
Sbjct  181  LSLSPEHYGRVQRIYIEALQDQSLNIKMQRLMQQLSPG-AEIYTVDTGHVPQVIVPEQVV  239

Query  240  EKLNQ  244
            E + +
Sbjct  240  EMIER  244


> A0A240ED26 Pimeloyl-ACP methyl ester carboxylesterase [Acinetobacter 
puyangensis]
Length=258

 Score =  274 bits (701),  Expect = 9e-95
 Identities = 138/245 (56%), Positives = 172/245 (70%), Gaps = 2/245 (1%)

Query  1    MAKHIVLVHGAWQGSWSFDLIKPWLQQKGWTVHAVDLPDNGWNSDTQITASQQSYCDYVV  60
            M KHIVL+HGAWQGSWSFDLI+P L ++GW VHA+DLP NG + D  +  S +SY  YV 
Sbjct  1    MDKHIVLIHGAWQGSWSFDLIRPLLIERGWQVHALDLPGNGHHPDPTVEVSLRSYSQYVA  60

Query  61   QMIHNIGEPVVLLGHSGGGLTISAVAEQIPELISHLVYLVGMMLPSNMSFLDFKKLCEQH  120
              IH++GE V LLGHSGGG+TIS VAE IP+ I  L+YLVGMMLP+ M+FL+ K+LCE  
Sbjct  61   DYIHDLGEKVFLLGHSGGGITISQVAEMIPDRIHALIYLVGMMLPNGMTFLELKQLCEAR  120

Query  121  FPDEDFSGISPYLTFTDDG-YSIVSSEGAKKIFLQDCEPALAEQLIEKLRPQPEAGRDLK  179
            FP + F GISPYL F++ G  S V+ EG  KIFLQD     A +L      Q E GRDL+
Sbjct  121  FPGQSFDGISPYLKFSEAGQISEVTEEGVIKIFLQDYPVLEAARLARNFTVQTETGRDLR  180

Query  180  PVLTPERFGCVPRIYVEALNDQSLSINMQRLMQQLQPNKLQIIAMQTGHVPQAVQPDLLV  239
              L+PE +G VPR Y+EAL DQSL+I MQRLMQ+L P   +I  + TGHVPQ + P  +V
Sbjct  181  LRLSPEHYGRVPRTYIEALQDQSLNIKMQRLMQELSPG-AEIYTVDTGHVPQVIAPGQVV  239

Query  240  EKLNQ  244
            E + +
Sbjct  240  EMIER  244


> A0A2U8HB47 Alpha/beta hydrolase [Azoarcus communis]
Length=247

 Score =  243 bits (621),  Expect = 7e-83
 Identities = 121/239 (51%), Positives = 158/239 (66%), Gaps = 2/239 (1%)

Query  5    IVLVHGAWQGSWSFDLIKPWLQQKGWTVHAVDLPDNGWNSDTQITASQQSYCDYVVQMIH  64
            ++L+HGAWQGSWSF   +P L ++GWT HAVDLP NGW  +T   AS  +Y ++V   I 
Sbjct  1    MILIHGAWQGSWSFASWRPLLARRGWTAHAVDLPGNGWGEETPDAASLDAYVEHVAACIE  60

Query  65   NIGEPVVLLGHSGGGLTISAVAEQIPELISHLVYLVGMMLPSNMSFLDFKKLCEQHFPDE  124
             IGEPVV+LGHSGGG+  S VAE IPE ++  VYL GMMLPS MS+    ++C+   P+ 
Sbjct  61   EIGEPVVVLGHSGGGIVASQVAEAIPERVACTVYLAGMMLPSGMSYASLVEVCKAEHPEL  120

Query  125  DFSGISPYLTFTDDG-YSIVSSEGAKKIFLQDCEPALAEQLIEKLRPQPEAGRDLKPVLT  183
            DF+G+ P+L ++ DG YS V  E A++IFL DC P+ A      LRPQ E GR + P L+
Sbjct  121  DFAGVGPHLEYSADGRYSAVPPEVAQRIFLHDCAPSDARYAASLLRPQAERGRIMAPSLS  180

Query  184  PERFGCVPRIYVEALNDQSLSINMQRLMQQLQPNKLQIIAMQTGHVPQAVQPDLLVEKL  242
            P R+G VPRIYVEA  D+SL    QR MQ L P  ++ +++  GHVPQ   P+ L E L
Sbjct  181  PNRYGKVPRIYVEATQDRSLLHASQRKMQALSPGAIR-VSLDCGHVPQLAAPERLTELL  238


> A0A2N2UQQ0 Alpha/beta hydrolase [Betaproteobacteria bacterium 
HGW-Betaproteobacteria-13]
Length=247

 Score =  243 bits (621),  Expect = 7e-83
 Identities = 121/239 (51%), Positives = 158/239 (66%), Gaps = 2/239 (1%)

Query  5    IVLVHGAWQGSWSFDLIKPWLQQKGWTVHAVDLPDNGWNSDTQITASQQSYCDYVVQMIH  64
            ++L+HGAWQGSWSF   +P L ++GWT HAVDLP NGW  +T   AS  +Y ++V   I 
Sbjct  1    MILIHGAWQGSWSFASWRPLLARRGWTAHAVDLPGNGWGEETPDAASLDAYVEHVAACIE  60

Query  65   NIGEPVVLLGHSGGGLTISAVAEQIPELISHLVYLVGMMLPSNMSFLDFKKLCEQHFPDE  124
             IGEPVV+LGHSGGG+  S VAE IPE ++  VYL GMMLPS MS+    ++C+   P+ 
Sbjct  61   EIGEPVVVLGHSGGGIVASQVAEAIPERVACTVYLAGMMLPSGMSYASLVEVCKAEHPEL  120

Query  125  DFSGISPYLTFTDDG-YSIVSSEGAKKIFLQDCEPALAEQLIEKLRPQPEAGRDLKPVLT  183
            DF+G+ P+L ++ DG YS V  E A++IFL DC P+ A      LRPQ E GR + P L+
Sbjct  121  DFAGVGPHLEYSADGRYSAVPPEVAQRIFLHDCAPSDARYAASLLRPQAERGRIMAPSLS  180

Query  184  PERFGCVPRIYVEALNDQSLSINMQRLMQQLQPNKLQIIAMQTGHVPQAVQPDLLVEKL  242
            P R+G VPRIYVEA  D+SL    QR MQ L P  ++ +++  GHVPQ   P+ L E L
Sbjct  181  PNRYGKVPRIYVEATQDRSLLHASQRKMQALSPGAIR-VSLDCGHVPQLAAPERLTELL  238


> A0A2W7G3M5 Pimeloyl-ACP methyl ester carboxylesterase [Paraburkholderia 
sp. PDC91]
Length=260

 Score =  240 bits (612),  Expect = 2e-81
 Identities = 122/250 (49%), Positives = 164/250 (66%), Gaps = 10/250 (4%)

Query  3    KHIVLVHGAWQGSWSFDLIKPWLQQKGWTVHAVDLPDNGWNSDTQITASQQSYCDYVVQM  62
            K IVL+HGAWQGSWSFD  +P L+  GW  HAVDLP NGW +     AS + Y  +V+  
Sbjct  8    KDIVLIHGAWQGSWSFDAWRPMLEAAGWRTHAVDLPGNGWGATAHECASLEHYTRHVIAA  67

Query  63   IHNIGEPVVLLGHSGGGLTISAVAEQIPELISHLVYLVGMMLPSNMSFLDFKKLCEQHFP  122
            +  +  P V+LGHSGGG+T S VAE++P+ +  +VYL GMMLPS +SF D  +   +  P
Sbjct  68   LDTLDGPAVVLGHSGGGVTASQVAEEVPDRVVAVVYLAGMMLPSALSFADLVRAVARMAP  127

Query  123  DEDFSGISPYLTFTDDGYSIVSS---EGAKKIFLQDCEPALAEQLIEKLRPQPEAGRDLK  179
            D   +GISPYL   +D  +  +S   EGA + FLQDCEP  A++ I  LRPQPE+GR + 
Sbjct  128  DAPVAGISPYL--DEDPVADTTSVRPEGALECFLQDCEPVAAQRAISMLRPQPESGRRMT  185

Query  180  PVLTPERFGCVPRIYVEALNDQSLSINMQRLMQQLQPNKLQIIAMQTGHVPQAVQPDLLV  239
              LTP RFGCVPR+YVE L D+S+++ +QR MQQ  P    +++++ GHVPQ V+P    
Sbjct  186  NRLTPARFGCVPRVYVECLEDRSVTLPLQRAMQQASPG-ATVVSLKCGHVPQLVRP----  240

Query  240  EKLNQILSPD  249
             +L  IL P+
Sbjct  241  AELTAILVPE  250


> A0A1N6QJA7 Pimeloyl-ACP methyl ester carboxylesterase [Pseudacidovorax 
sp. RU35E]
Length=251

 Score =  234 bits (598),  Expect = 2e-79
 Identities = 125/251 (50%), Positives = 161/251 (64%), Gaps = 6/251 (2%)

Query  1    MAKHIVLVHGAWQGSWSFDLIKPWLQQKGWTVHAVDLPDNGWNSDTQITASQQSYCDYVV  60
            M +HIVL+HGAWQG+W+FD   P L+++GW  HAVDLP NGW       AS  SY  +V 
Sbjct  1    MTRHIVLIHGAWQGAWAFDAWLPLLRERGWQPHAVDLPGNGWPPLGDAPASLDSYTAHVA  60

Query  61   QMIHNIGEPVVLLGHSGGGLTISAVAEQIPELISHLVYLVGMMLPSNMSFLDFKKLCEQH  120
             +I  +GEP V+LGHSGGGLT S VAE +PE ++ LVYL GMMLPS M F +  +  +  
Sbjct  61   GVIDALGEPAVVLGHSGGGLTASQVAEALPERVAALVYLAGMMLPSGMGFGELVRQVQAE  120

Query  121  FPDEDFSGISPYLTF-TDDGYSIVSSEGAKKIFLQDCEPALAEQLIEKLRPQPEAGRDLK  179
             P  DFSGI+P+L +  D   S V +EGA + F+ DCEPA A +    LRPQPE+GR + 
Sbjct  121  QPGRDFSGITPWLQWNADRSASSVPAEGALRCFVHDCEPAAAARAAALLRPQPESGRAMV  180

Query  180  PVLTPERFGCVPRIYVEALNDQSLSINMQRLMQQLQPNKLQIIAMQTGHVPQAVQP----  235
              L+ ERFG VPR YVE L+DQS+   +Q  MQQL P   + + +  GHVPQ   P    
Sbjct  181  NRLSAERFGRVPRFYVECLDDQSVYHPLQARMQQLSPGARR-LTLPCGHVPQLAAPQALT  239

Query  236  DLLVEKLNQIL  246
            DLL+ +L  +L
Sbjct  240  DLLMPELEALL  250


> Q60FX2 Putative alkyl salicylate esterase [Sphingomonas paucimobilis]
Length=243

 Score =  121 bits (304),  Expect = 6e-36
 Identities = 73/241 (30%), Positives = 114/241 (47%), Gaps = 9/241 (4%)

Query  6    VLVHGAWQGSWSFDLIKPWLQQKGWTVHAVDLPDNGWNSDTQITASQQSYCDYVVQMIHN  65
            +++HGAW G W F+ ++  L+ +G  + A DLP  G ++     A+   + D+ +     
Sbjct  5    LMIHGAWHGGWCFERLRRPLEARGHAMAAPDLPGMGGDARALAAATLDRWADFAIAQADT  64

Query  66   IGEPVVLLGHSGGGLTISAVAEQIPELISHLVYLVGMMLPSNMSFLDFKKLCEQHFPDED  125
            +  PV+L GHS GGL +S  AE+ PE  + LVY+  ++     S  D          +  
Sbjct  65   LPGPVILCGHSRGGLVVSRAAERAPEAFAALVYVAALLCEDGRSLYDM-------MGEPQ  117

Query  126  FSGISPYLTFTDDGYSI-VSSEGAKKIFLQDCEPALAEQLIEKLRPQPEAGRDLKPVLTP  184
              G S  L+   DG  + +S++ A  +F   CEP +      +L  +P         +TP
Sbjct  118  HGGFSDGLSPVADGLGVALSAQAAIPLFYSHCEPQVQAVSAARLVAEPVRPLGTPVRVTP  177

Query  185  ERFGCVPRIYVEALNDQSLSINMQRLMQQLQPNKLQIIAMQTGHVPQAVQPDLLVEKLNQ  244
            ERFG VPR YVE ++D+ L +  QR M    P    +  + + H P    PD L   L  
Sbjct  178  ERFGRVPRHYVECIHDRVLPLATQRAMTAALP-CASVTTLDSDHSPFLCVPDALAGALTT  236

Query  245  I  245
            I
Sbjct  237  I  237


> Q9RBI4 SalE [Acinetobacter baylyi (strain ATCC 33305 / BD413 
/ ADP1)]
Length=239

 Score = 94.4 bits (233),  Expect = 5e-26
 Identities = 68/243 (28%), Positives = 112/243 (46%), Gaps = 20/243 (8%)

Query  6    VLVHGAWQGSWSFDLIKPWLQQKGWTVHAVDLPDNGWNSDTQITASQ--QSYCDYVVQMI  63
            VLVHG+W     ++ +   L+ +G TVH   +  +G N+D  +T +Q  QS  DY+V+  
Sbjct  5    VLVHGSWHDGSLWEPVATHLRAQGHTVHCPTVAGHGPNADRNVTHAQCSQSIADYIVK--  62

Query  64   HNIGEPVVLLGHSGGGLTISAVAEQIPELISHLVYLVGMMLPSNMSFLDFKKLCEQHFPD  123
            H++ E +VLLGHS GG  IS VAE IPE I  L+Y    +L    +  D       + P+
Sbjct  63   HDLSE-IVLLGHSYGGTIISKVAEAIPERIQRLIYWNAFVLQDGENMFD-------NMPE  114

Query  124  EDFSGISPYLTFTDDGYSIVSSEGAKKIFLQDCEPALAEQLIEKLRPQP----EAGRDLK  179
              +   +     + D   ++  E  +  F+ D +  +AE+  + L P+P        DLK
Sbjct  115  AYYELFTSLAAASGDNTVLLPYEVWRHAFINDADDQMAEETYKMLTPEPCQPFHDRLDLK  174

Query  180  PVLTPERFGCVPRIYVEALNDQSLSINMQRLMQQLQPNKLQIIAMQTGHVPQAVQPDLLV  239
               T      +P+ Y+    DQ+L           +  + +++ M   H     +P  L 
Sbjct  175  KFYTLN----IPKSYLNCTEDQALPAGFWHPKMSNRLGEFKLVEMGGSHEAMFTRPQELA  230

Query  240  EKL  242
             K+
Sbjct  231  TKI  233


> Q9LAB8 Alpha/beta hydrolase fold family protein [Burkholderia 
gladioli]
Length=298

 Score = 88.6 bits (218),  Expect = 7e-24
 Identities = 81/275 (29%), Positives = 116/275 (42%), Gaps = 37/275 (13%)

Query  6    VLVHGAWQGSWSFDLIKPWLQQKGWTVHAVDLPDNG---------WNSDTQITASQQSYC  56
            VLVHGAW G+W+++ +   L  +G    A DLP +G         W  D Q  A + S  
Sbjct  20   VLVHGAWHGAWAYERLGAALAARGHASVAHDLPAHGINARYPAAFWQGDAQALAQEPSPV  79

Query  57   ------DYVVQMIHNI------GEP-VVLLGHSGGGLTISAVAEQIPELISHLVYLVGMM  103
                  DY  Q++  I      G P VVL+GHS GG+ I+A AE+ PE I+ LVYL   M
Sbjct  80   AATTLDDYTGQVLRAIDAACALGHPRVVLVGHSMGGVAITAAAERAPERIAALVYLAAFM  139

Query  104  LPSNMSFLDFKKLCEQHFPDEDFSGI---SP----YLTFTDDGYSIVSSEGAKKIFLQDC  156
              S +  LD+ +  E H   E  + +   SP     L               K+   +D 
Sbjct  140  PASGVPGLDYVRAPENH--GEMLASLICASPRAIGALRINPASRDAAYLATLKQALFEDV  197

Query  157  EPALAEQLIEKLRPQPEAGRDLKPV-LTPERFGCVPRIYVEALNDQSLSINMQRLM----  211
            + A    +   +           P+  T ER+G + R YV    D+ +   +QR      
Sbjct  198  DEATFRAVTRLMSSDVPTAPFATPIATTAERWGSIARHYVTCAEDRVILPALQRRFIAEA  257

Query  212  -QQLQPNKLQIIAMQTGHVPQAVQPDLLVEKLNQI  245
               L     ++ A+ + H P   QPD L E L  I
Sbjct  258  DAFLPERPTRVHALDSSHSPFLSQPDTLAELLTGI  292


> E0DBK6 Alpha/beta hydrolase fold superfamily [Gentiana pneumonanthe]
Length=259

 Score = 87.0 bits (214),  Expect = 2e-23
 Identities = 74/262 (28%), Positives = 117/262 (45%), Gaps = 31/262 (12%)

Query  3    KHIVLVHGAWQGSWSFDLIKPWLQQKGWTVHAVDLPDNGWN-SDTQITASQQSYCDYVVQ  61
            KH V VHG   G+W +  +KP ++  G+   A+DL   G N    +   S + YC  +  
Sbjct  5    KHFVAVHGVGHGAWVYYKLKPRIEAAGFKFTAIDLAAAGVNPKKLEEVNSLEEYCGPLFD  64

Query  62   MIHNI--GEPVVLLGHSGGGLTISAVAEQIPELISHLVYLVGMMLPSNMSFLDFKKLCEQ  119
            ++  +  GE V+L+GHSGGGL+ +   E+ P+ IS  V+L  +M P   +          
Sbjct  65   VLAAVPEGEKVILVGHSGGGLSAAVGMEKFPKKISVAVFLNAIM-PDTKN--------RP  115

Query  120  HFPDEDFSGISPYLTFTDDGYSIVSSEGAKKIFLQDCEPALAEQLIEKLRPQPE--AGRD  177
             +  E+++  +P   + D  +S   + G   I    C P      +  L P  +   G+ 
Sbjct  116  SYVMEEYTARTPIEAWKDTQFS---AYGEPPITALLCGPEFISTSLYHLSPVEDHTLGKL  172

Query  178  L-KP-------------VLTPERFGCVPRIYVEALNDQSLSINMQRLMQQLQPNKLQIIA  223
            L +P               T E FG VPR+YV A  D+++ +  QR M +  P       
Sbjct  173  LVRPGALFVEDLLKGAVKFTDEGFGSVPRVYVVATEDKTIPLEFQRWMIENNPAAEVKEI  232

Query  224  MQTGHVPQAVQPDLLVEKLNQI  245
                H+PQ  +PD L + L  I
Sbjct  233  QGADHLPQFSKPDELTQVLVDI  254


> E1CJH7 Alpha/beta hydrolase fold superfamily [Gentiana triflora]
Length=259

 Score = 84.7 bits (208),  Expect = 1e-22
 Identities = 74/262 (28%), Positives = 116/262 (44%), Gaps = 31/262 (12%)

Query  3    KHIVLVHGAWQGSWSFDLIKPWLQQKGWTVHAVDLPDNGWN-SDTQITASQQSYCDYVVQ  61
            KH V VHG   G+W +  +KP ++  G+   A+DL   G N    +   S + YC  +  
Sbjct  5    KHFVAVHGVGHGAWVYYKLKPRIEAAGFKFTAIDLAAAGVNPKKLEEVNSLEEYCGPLFD  64

Query  62   MIHNI--GEPVVLLGHSGGGLTISAVAEQIPELISHLVYLVGMMLPSNMSFLDFKKLCEQ  119
            ++  +  GE V+L+GHSGGGL+ +   E+ P+ IS  V+L  +M P   +          
Sbjct  65   VLAAVPEGEKVILVGHSGGGLSAAVGMEKFPKKISVAVFLNAIM-PDTKN--------RP  115

Query  120  HFPDEDFSGISPYLTFTDDGYSIVSSEGAKKIFLQDCEPALAEQLIEKLRPQPE--AGRD  177
             +  E+++  +P   + D  +S   + G   I    C P      +  L P  +   G+ 
Sbjct  116  SYVMEEYTARTPIEAWKDTQFS---AYGEPPITALLCGPEFISTSLYHLSPVEDHTLGKL  172

Query  178  L-KP-------------VLTPERFGCVPRIYVEALNDQSLSINMQRLMQQLQPNKLQIIA  223
            L +P               T E FG VPR+YV A  D+++    QR M +  P       
Sbjct  173  LVRPGALFVEDLLKGAVKFTDEGFGSVPRVYVVATEDKTIPPEFQRWMIENNPVAEVKEI  232

Query  224  MQTGHVPQAVQPDLLVEKLNQI  245
                H+PQ  +PD L + L  I
Sbjct  233  QGADHLPQFSKPDELTQVLVDI  254


> A5A7N5 Alpha/beta hydrolase fold superfamily [Gentiana triflora 
var. japonica]
Length=259

 Score = 84.0 bits (206),  Expect = 2e-22
 Identities = 74/262 (28%), Positives = 116/262 (44%), Gaps = 31/262 (12%)

Query  3    KHIVLVHGAWQGSWSFDLIKPWLQQKGWTVHAVDLPDNGWN-SDTQITASQQSYCDYVVQ  61
            KH V VHG   G+W +  +KP ++  G+   A+DL   G N    +   S + YC  +  
Sbjct  5    KHFVAVHGVGHGAWVYYKLKPRIEAAGFKFTAIDLAAAGVNPKKLEEVNSLEEYCGPLFD  64

Query  62   MIHNI--GEPVVLLGHSGGGLTISAVAEQIPELISHLVYLVGMMLPSNMSFLDFKKLCEQ  119
            ++  +  GE V+L+GHSGGGL+ +   E+ P+ IS  V+L  +M P   +          
Sbjct  65   VLAAVPEGEKVILVGHSGGGLSAAVGMEKFPKKISVAVFLNAIM-PDTKN--------RP  115

Query  120  HFPDEDFSGISPYLTFTDDGYSIVSSEGAKKIFLQDCEPALAEQLIEKLRPQPE--AGRD  177
             +  E+++  +P   + D  +S   + G   I    C P      +  L P  +   G+ 
Sbjct  116  SYVMEEYTARTPIEAWKDTQFS---AYGEPPITALLCGPEFISTSLYHLSPVEDHTLGKL  172

Query  178  L-KP-------------VLTPERFGCVPRIYVEALNDQSLSINMQRLMQQLQPNKLQIIA  223
            L +P               T E FG VPR+YV A  D+++    QR M +  P       
Sbjct  173  LVRPGALFVEDLLKGAVKFTDEGFGSVPRVYVVATEDKTIPPEFQRWMIENNPVAEVKEI  232

Query  224  MQTGHVPQAVQPDLLVEKLNQI  245
                H+PQ  +PD L + L  I
Sbjct  233  EGADHLPQFSKPDELTQVLVDI  254


> A5A7N4 Alpha/beta hydrolase fold superfamily [Gentiana triflora 
var. japonica]
Length=259

 Score = 83.2 bits (204),  Expect = 4e-22
 Identities = 74/262 (28%), Positives = 115/262 (44%), Gaps = 31/262 (12%)

Query  3    KHIVLVHGAWQGSWSFDLIKPWLQQKGWTVHAVDLPDNGWN-SDTQITASQQSYCDYVVQ  61
            KH V VHG   G+W +  +KP ++  G    A+DL   G N    +   S + YC  +  
Sbjct  5    KHFVAVHGVGHGAWVYYKLKPRIEAAGLKFTAIDLAAAGVNPKKLEEVNSLEEYCAPLFD  64

Query  62   MIHNI--GEPVVLLGHSGGGLTISAVAEQIPELISHLVYLVGMMLPSNMSFLDFKKLCEQ  119
            ++  +  GE V+L+GHSGGGL+ +   E+ P+ IS  V+L  +M P   +          
Sbjct  65   VLAAVPEGEKVILVGHSGGGLSAAVGMEKFPKKISVAVFLNAIM-PDTKN--------RP  115

Query  120  HFPDEDFSGISPYLTFTDDGYSIVSSEGAKKIFLQDCEPALAEQLIEKLRPQPE--AGRD  177
             +  E+++  +P   + D  +S   + G   I    C P      +  L P  +   G+ 
Sbjct  116  SYVMEEYTARTPIEAWKDTQFS---AYGEPPITALLCGPEFISTSLYHLSPVEDHTLGKL  172

Query  178  L-KP-------------VLTPERFGCVPRIYVEALNDQSLSINMQRLMQQLQPNKLQIIA  223
            L +P               T E FG VPR+YV A  D+++    QR M +  P       
Sbjct  173  LVRPGALFVEDLLKGAVKFTDEGFGSVPRVYVVATEDKTIPPEFQRWMIENNPVAEVKEI  232

Query  224  MQTGHVPQAVQPDLLVEKLNQI  245
                H+PQ  +PD L + L  I
Sbjct  233  QGADHLPQFSKPDELTQVLVDI  254


> E0DBK7 Alpha/beta hydrolase fold superfamily [Gentiana septemfida]
Length=259

 Score = 82.4 bits (202),  Expect = 7e-22
 Identities = 73/262 (28%), Positives = 116/262 (44%), Gaps = 31/262 (12%)

Query  3    KHIVLVHGAWQGSWSFDLIKPWLQQKGWTVHAVDLPDNGWN-SDTQITASQQSYCDYVVQ  61
            KH V VHG   G+W +  +KP ++  G+   A+DL   G N    +   S + YC  +  
Sbjct  5    KHFVAVHGVGHGAWVYYKLKPRIEAAGFKFTAIDLAAAGVNPKKLEEVNSLEEYCGPLFD  64

Query  62   MIHNI--GEPVVLLGHSGGGLTISAVAEQIPELISHLVYLVGMMLPSNMSFLDFKKLCEQ  119
            ++  +  GE V+L+GHSGGGL+ +   E+  + IS  V+L  +M P   +          
Sbjct  65   VLAAVPEGEKVILVGHSGGGLSAAVGMEKFQKKISVAVFLNAIM-PDTKN--------RP  115

Query  120  HFPDEDFSGISPYLTFTDDGYSIVSSEGAKKIFLQDCEPALAEQLIEKLRPQPE--AGRD  177
             +  E+++  +P  ++ D  +S   + G   I    C P      +  L P  +   G+ 
Sbjct  116  SYVMEEYTARTPIESWKDTQFS---AYGEPPITALLCGPEFISTSLYHLSPVEDHTLGKL  172

Query  178  L-KP-------------VLTPERFGCVPRIYVEALNDQSLSINMQRLMQQLQPNKLQIIA  223
            L +P               T E FG VPR+YV A  D+++    QR M +  P       
Sbjct  173  LVRPGALFVEDLLKGAVKFTDEGFGSVPRVYVVATEDKTIPPEFQRWMIENNPVAEVKEI  232

Query  224  MQTGHVPQAVQPDLLVEKLNQI  245
                H+PQ  +PD L + L  I
Sbjct  233  QGADHLPQFSKPDELAQALVDI  254


> E1CJH8 Alpha/beta hydrolase fold superfamily [Gentiana triflora]
Length=259

 Score = 82.4 bits (202),  Expect = 7e-22
 Identities = 74/262 (28%), Positives = 115/262 (44%), Gaps = 31/262 (12%)

Query  3    KHIVLVHGAWQGSWSFDLIKPWLQQKGWTVHAVDLPDNGWN-SDTQITASQQSYCDYVVQ  61
            KH V VHG   G+W +  +KP ++  G    A+DL   G N    +   S + YC  +  
Sbjct  5    KHFVAVHGVGHGAWVYYKLKPRIEAAGLKFTAIDLAAAGVNPKKLEEVNSLEEYCAPLFD  64

Query  62   MIHNI--GEPVVLLGHSGGGLTISAVAEQIPELISHLVYLVGMMLPSNMSFLDFKKLCEQ  119
            ++  +  GE V+L+GHSGGGL+ +   E+ P+ IS  V+L  +M P   +          
Sbjct  65   VLAAVPEGEKVILVGHSGGGLSAAVGMEKFPKKISVAVFLNAIM-PDTKN--------RP  115

Query  120  HFPDEDFSGISPYLTFTDDGYSIVSSEGAKKIFLQDCEPALAEQLIEKLRPQPE--AGRD  177
             +  E+++  +P   + D  +S   + G   I    C P      +  L P  +   G+ 
Sbjct  116  SYVMEEYTARTPIEAWKDTQFS---AYGEPPITALLCGPEFISTSLYHLSPVEDHTLGKL  172

Query  178  L-KP-------------VLTPERFGCVPRIYVEALNDQSLSINMQRLMQQLQPNKLQIIA  223
            L +P               T E FG VPR+YV A  D+++    QR M +  P       
Sbjct  173  LVRPGALFVEDLLKGAVKFTDEGFGSVPRVYVVATEDKTIPPEFQRWMIENNPVAEVKEI  232

Query  224  MQTGHVPQAVQPDLLVEKLNQI  245
                H+PQ  +PD L + L  I
Sbjct  233  EGADHLPQFSKPDELTQVLVDI  254


> Q5XLS1 Protein S [Catharanthus roseus]
Length=258

 Score = 80.5 bits (197),  Expect = 3e-21
 Identities = 77/254 (30%), Positives = 116/254 (46%), Gaps = 16/254 (6%)

Query  3    KHIVLVHGAWQGSWSFDLIKPWLQQKGWTVHAVDLPDNGWNSDT-QITASQQSYCDYVVQ  61
            KH V VHG   G+W +  +KP ++  G    AV+L  +G N    +   S   Y   +++
Sbjct  5    KHFVTVHGVGHGAWVYYKLKPRIEAAGHRCTAVNLAASGINEKKLEEVRSSIDYAAPLLE  64

Query  62   MIHNI--GEPVVLLGHSGGGLTISAVAEQIPELISHLVYLVGMM-----LPSNMSFLDFK  114
            ++ ++   E V+L+GHSGGG+T +   E+ P  IS  V+L  +M      PS +      
Sbjct  65   VLDSVPENEKVILVGHSGGGMTAAVGMEKFPNKISLAVFLNAIMPDTENRPSYVLEEYTA  124

Query  115  KLCEQHFPDEDFSGI-SPYLTFTDDGYSIVSSEGAKKIFLQDCEPALAEQLIEKLRPQPE  173
            K   + + D  FS    P +T    G   +SS       ++D   AL + L+   RP   
Sbjct  125  KTPPEAWKDCQFSAYGDPPITSLVCGPEFISSTLYHLSPIED--HALGKILV---RPGSL  179

Query  174  AGRDLKPV--LTPERFGCVPRIYVEALNDQSLSINMQRLMQQLQPNKLQIIAMQTGHVPQ  231
               DL      T E FG VPR+YV A  D+++    QR M +  P K         H+P 
Sbjct  180  FIEDLLKAEKFTEEGFGSVPRVYVIAAEDKTIPPEFQRWMIENNPVKEVKEIKGADHMPM  239

Query  232  AVQPDLLVEKLNQI  245
              +PD L + L  I
Sbjct  240  FSKPDELSQCLLDI  253



Lambda      K        H        a         alpha
   0.321    0.137    0.418    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 970827


  Database: 057b87d6e090aedf618525672ff7c1a2.TrEMBL.fasta
    Posted date:  Sep 26, 2020  8:26 PM
  Number of letters in database: 5,378
  Number of sequences in database:  21



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40