ACIAD0765 / SwissProt Alignments

BLASTP 2.2.28+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: d18069bc7a74bdb03d829eaaa26e369a.SwissProt.fasta
           10 sequences; 2,952 total letters



Query= ACIAD0765

Length=264
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  O80475 Methylesterase 8 [Arabidopsis thaliana]                      91.3    4e-25
  Q8S8S9 Methylesterase 1 [Arabidopsis thaliana]                      89.4    2e-24
  O80476 Methylesterase 2 [Arabidopsis thaliana]                      87.8    6e-24
  C0LA90 Pyrethroid hydrolase [Sphingobium wenxiniae (strain DSM ...  83.2    2e-22
  O80477 Methylesterase 3 [Arabidopsis thaliana]                      79.3    4e-21
  Q9FVW3 Putative methylesterase 14, chloroplastic [Arabidopsis t...  80.1    6e-21
  Q6RYA0 Salicylic acid-binding protein 2 [Nicotiana tabacum]         77.4    2e-20
  Q9SE93 Polyneuridine-aldehyde esterase [Rauvolfia serpentina]       75.9    7e-20
  Q9FW03 Putative methylesterase 11, chloroplastic [Arabidopsis t...  76.3    2e-19
  Q940H7 Putative methylesterase 12, chloroplastic [Arabidopsis t...  75.9    2e-19


> O80475 Methylesterase 8 [Arabidopsis thaliana]
Length=272

 Score = 91.3 bits (225),  Expect = 4e-25
 Identities = 79/251 (31%), Positives = 122/251 (49%), Gaps = 19/251 (8%)

Query  1    MAKHIVLVHGAWQGSWSFDLIKPWLQQKGWTVHAVDLPDNG--WNSDTQITASQQSYCDY  58
            M +H VLVHG+  G+W +  +KP L+  G  V A+DL   G    S T I+  +Q Y + 
Sbjct  24   MKQHFVLVHGSCLGAWCWYKVKPLLEASGHRVTALDLAACGIDTRSITDISTCEQ-YSEP  82

Query  59   VVQMIHNI--GEPVVLLGHSGGGLTISAVAEQIPELISHLVYLVGMMLPS-NMSFLDFKK  115
            ++Q++ ++   E VVL+GHS GGLT++   ++ P+ IS  V++   M  + N      +K
Sbjct  83   LIQLMTSLPNDEKVVLVGHSYGGLTLAIAMDKFPDKISVSVFVTSFMPDTKNSPSFVLEK  142

Query  116  LCEQHFPDEDFSG--ISPYLTFTDDGYSIVSSEGAKKIFLQDCEPALAEQLIEKLRPQPE  173
                  P ED+ G  + PY+ F        S+E  K   LQ       E  +   RP   
Sbjct  143  FASTMTP-EDWMGSELEPYVVF--------SAEFTKHRILQLSPIEDLELRLLLKRPGSL  193

Query  174  AGRDLKPV--LTPERFGCVPRIYVEALNDQSLSINMQRLMQQLQPNKLQIIAMQTGHVPQ  231
               DL  +   + + +G VPR Y+ + +D ++S   QR M    P  L I    T H+P 
Sbjct  194  FLNDLSRMKNFSEKGYGSVPRAYIVSKDDHTISEEYQRWMIDNYPPNLVIEMEGTDHLPL  253

Query  232  AVQPDLLVEKL  242
              +P LL + L
Sbjct  254  FCKPQLLSDHL  264


> Q8S8S9 Methylesterase 1 [Arabidopsis thaliana]
Length=263

 Score = 89.4 bits (220),  Expect = 2e-24
 Identities = 72/245 (29%), Positives = 118/245 (48%), Gaps = 10/245 (4%)

Query  3    KHIVLVHGAWQGSWSFDLIKPWLQQKGWTVHAVDLPDNGWNSDTQIT--ASQQSYCDYVV  60
            +H VLVHG+  G+W +  +KP L+  G  V AVDL  +G ++   IT   + + Y + + 
Sbjct  8    QHFVLVHGSCHGAWCWYKVKPLLEAVGHRVTAVDLAASGIDTTRSITDIPTCEQYSEPLT  67

Query  61   QMIHNI--GEPVVLLGHSGGGLTISAVAEQIPELISHLVYLVGMMLPSNMSFLDFKKLCE  118
            +++ ++   E VVL+GHS GGL ++   E+ PE IS  V+L   M  +  S         
Sbjct  68   KLLTSLPNDEKVVLVGHSFGGLNLAIAMEKFPEKISVAVFLTAFMPDTEHSPSFVLDKFG  127

Query  119  QHFPDEDFSG--ISPYLTFTDDGYSIVSSEGAKKIFLQDCEPALAEQL-IEKLRPQPEAG  175
             + P E + G    PY +  + G S+  S    K+ L    P    +L +  +RP     
Sbjct  128  SNMPQEAWMGTEFEPYGS-DNSGLSMFFSPDFMKLGLYQLSPVEDLELGLLLMRPGSLFI  186

Query  176  RDLKPV--LTPERFGCVPRIYVEALNDQSLSINMQRLMQQLQPNKLQIIAMQTGHVPQAV  233
             DL  +   + E +G VPR+++    D+++    QR M    P  L +   +T H+P   
Sbjct  187  NDLSKMKNFSDEGYGSVPRVFIVCKEDKAIPEERQRWMIDNFPVNLVMEMEETDHMPMFC  246

Query  234  QPDLL  238
            +P  L
Sbjct  247  KPQQL  251


> O80476 Methylesterase 2 [Arabidopsis thaliana]
Length=263

 Score = 87.8 bits (216),  Expect = 6e-24
 Identities = 73/249 (29%), Positives = 121/249 (49%), Gaps = 10/249 (4%)

Query  3    KHIVLVHGAWQGSWSFDLIKPWLQQKGWTVHAVDLPDNGWNSDTQIT--ASQQSYCDYVV  60
            +H VLVHGA  G+W +  +KP L+  G  V A+DL  +G ++   IT  ++ + Y + ++
Sbjct  8    QHFVLVHGACHGAWCWYKVKPLLEALGHRVTALDLAASGIDTTRSITDISTCEQYSEPLM  67

Query  61   QMIHNI--GEPVVLLGHSGGGLTISAVAEQIPELISHLVYLVGMMLPSNMSFLDFKKLCE  118
            Q++ ++   E VVL+GHS GGL+++   ++ P+ IS  V++   M  +  S    ++   
Sbjct  68   QLMTSLPNDEKVVLVGHSFGGLSLALAMDKFPDKISVSVFVTAFMPDTKHSPSFVEEKFA  127

Query  119  QHFPDEDFSGISPYLTFTDD--GYSIVSSEGAKKIFLQDCEPALAEQL-IEKLRPQPEAG  175
                 E + G S   T+  D  G S+  S    K  L    P    +L +   RP     
Sbjct  128  SSMTPEGWMG-SELETYGSDNSGLSVFFSTDFMKHRLYQLSPVEDLELGLLLKRPSSLFI  186

Query  176  RDLKPV--LTPERFGCVPRIYVEALNDQSLSINMQRLMQQLQPNKLQIIAMQTGHVPQAV  233
             +L  +   + + +G VPR Y+    D  +S + QR M    P  L I   +T H+P   
Sbjct  187  NELSKMENFSEKGYGSVPRAYIVCKEDNIISEDHQRWMIHNYPANLVIEMEETDHMPMFC  246

Query  234  QPDLLVEKL  242
            +P LL + L
Sbjct  247  KPQLLSDHL  255


> C0LA90 Pyrethroid hydrolase [Sphingobium wenxiniae (strain DSM 
21828 / JZ-1)]
Length=280

 Score = 83.2 bits (204),  Expect = 2e-22
 Identities = 67/255 (26%), Positives = 115/255 (45%), Gaps = 33/255 (13%)

Query  5    IVLVHGAWQGSWSFDLIKPWLQQKGWTVHAVDLPDNGWNSDTQITA-SQQSYCDYVVQMI  63
            I+L+HGA      +D + P L+ +G+ VHA DL  +       ++    + Y   V  ++
Sbjct  6    IILIHGALNRGACYDAVVPLLEARGYRVHAPDLTGHTPGDGGHLSVVDMEHYTRPVADIL  65

Query  64   HNIGEPVVLLGHSGGGLTISAVAEQIPELISHLVYLVGMMLPSNMSFLDFKKLCEQHFPD  123
                   +LLGHS GG +IS +A+  P+ ++ L+YL  ++    ++   F        P 
Sbjct  66   ARAEGQSILLGHSLGGASISWLAQHHPDKVAGLIYLTAVLTAPGITPETFV------LPG  119

Query  124  EDFSGISPYLTF---TDDGYSIVSS----EGAKKIFLQDCEPA---LAEQLIEKLR----  169
            E   G    L      D+G  + +     E  +++F+ D        AEQ I+       
Sbjct  120  EPNRGTPHALDLIQPVDEGRGLQADFSRLERLREVFMGDYPGEGMPPAEQFIQTQSTVPF  179

Query  170  --PQPEAGRDLKPVLTPERFGCVPRIYVEALNDQSLSINMQRLMQQLQPNKLQIIAMQTG  227
              P P  GR L+          +PR+Y+EAL+D  + I +QR MQ+  P  + ++++   
Sbjct  180  GTPNPMEGRALE----------IPRLYIEALDDVVIPIAVQRQMQKEFPGPVAVVSLPAS  229

Query  228  HVPQAVQPDLLVEKL  242
            H P    P+ L E +
Sbjct  230  HAPYYSMPERLAEAI  244


> O80477 Methylesterase 3 [Arabidopsis thaliana]
Length=263

 Score = 79.3 bits (194),  Expect = 4e-21
 Identities = 74/259 (29%), Positives = 122/259 (47%), Gaps = 24/259 (9%)

Query  3    KHIVLVHGAWQGSWSFDLIKPWLQQKGWTVHAVDLPDNGWNSDTQIT--ASQQSYCDYVV  60
            +H+VLVHGA  G+W +  +KP L+  G  V AVDL  +G +    IT  ++ + Y + ++
Sbjct  8    QHVVLVHGACHGAWCWYKVKPQLEASGHRVTAVDLAASGIDMTRSITDISTCEQYSEPLM  67

Query  61   QMIHNI--GEPVVLLGHSGGGLTISAVAEQIPELISHLVYLVGMMLPSNMSFLDF-----  113
            Q++ ++   E VVL+GHS GGL+++   +  P  IS  V++  MM P       F     
Sbjct  68   QLMTSLPDDEKVVLVGHSLGGLSLAMAMDMFPTKISVSVFVTAMM-PDTKHSPSFVWDKL  126

Query  114  -KKLCEQHFPDEDFSGISPYLTFTDDGYSIVSSEGAKKIF----LQDCEPALAEQLIEKL  168
             K+   + + D  F+   P   F  + +       AK ++    +QD E  LA+ L+   
Sbjct  127  RKETSREEWLDTVFTSEKP--DFPSEFWIFGPEFMAKNLYQLSPVQDLE--LAKMLV---  179

Query  169  RPQPEAGRDL--KPVLTPERFGCVPRIYVEALNDQSLSINMQRLMQQLQPNKLQIIAMQT  226
            R  P   +D+  +   + E +G V RI++    D     + QR M    P K  +     
Sbjct  180  RANPLIKKDMAERRSFSEEGYGSVTRIFIVCGKDLVSPEDYQRSMISNFPPKEVMEIKDA  239

Query  227  GHVPQAVQPDLLVEKLNQI  245
             H+P   +P  L   L +I
Sbjct  240  DHMPMFSKPQQLCALLLEI  258


> Q9FVW3 Putative methylesterase 14, chloroplastic [Arabidopsis 
thaliana]
Length=348

 Score = 80.1 bits (196),  Expect = 6e-21
 Identities = 72/255 (28%), Positives = 121/255 (47%), Gaps = 14/255 (5%)

Query  1    MAKHIVLVHGAWQGSWSFDLIKPWLQQKGWTVHAVDLPDNGWN-SDTQITASQQSYCDYV  59
            + K  VLVHG   G+W +  +   L++ G +   VDL   G+N +DT   ++ + Y   +
Sbjct  94   IVKKFVLVHGEGFGAWCWYKMVASLEESGLSPVTVDLTGCGFNMTDTNTVSTLEEYSKPL  153

Query  60   VQMIHNIGEP--VVLLGHSGGGLTISAVAEQIPELISHLVYLVGMMLPSNMSFLDFKKLC  117
            + ++ N+ E   V+L+GHS GG +IS   E+ PE IS  +++   M+        F    
Sbjct  154  IDLLENLPEEEKVILVGHSTGGASISYALERFPEKISKAIFVCATMVSDGQR--PFDVFS  211

Query  118  EQHFPDEDFSGISPYLTFTD------DGYSIVSSEGAKKIFLQDCEPALAEQLIEKLRPQ  171
            E+    E F   S +L + +       G+           F Q     +A  +I  +RP 
Sbjct  212  EELGSAERFMKESQFLIYGNGKDKPPTGFMFEKPHMKGLYFNQSPNKDIALAMI-SMRPV  270

Query  172  PEAGRDLKPVLTPERFGCVPRIYVEALNDQSLSINMQ-RLMQQLQPNKLQIIAMQTGHVP  230
            P      K  LT ER+G   R YV+ L+D++LS ++Q +L+++  P  +  I   + H P
Sbjct  271  PLGPMMEKVSLTAERYGKGRRFYVQTLDDRALSPDVQEKLVRENSPEGVFKI-KGSDHCP  329

Query  231  QAVQPDLLVEKLNQI  245
               +P  L + L +I
Sbjct  330  FFSKPQSLHKILLEI  344


> Q6RYA0 Salicylic acid-binding protein 2 [Nicotiana tabacum]
Length=260

 Score = 77.4 bits (189),  Expect = 2e-20
 Identities = 68/223 (30%), Positives = 102/223 (46%), Gaps = 24/223 (11%)

Query  3    KHIVLVHGAWQGSWSFDLIKPWLQQKGWTVHAVDLPDNGWNSDTQITASQQSYCDYVVQM  62
            KH VLVHGA  G WS+  +KP L+  G  V A+DL  +G  +D +     ++  DY + +
Sbjct  5    KHFVLVHGACHGGWSWYKLKPLLEAAGHKVTALDLAASG--TDLRKIEELRTLYDYTLPL  62

Query  63   IH-----NIGEPVVLLGHSGGGLTISAVAEQIPELISHLVYLVGMMLPS--NMSFLDFKK  115
            +      +  E V+L+GHS GG+ +    E+ P+ I   V+L   M  S  N SF+   +
Sbjct  63   MELMESLSADEKVILVGHSLGGMNLGLAMEKYPQKIYAAVFLAAFMPDSVHNSSFV--LE  120

Query  116  LCEQHFPDEDFSGISPYLTFTDDGYSIVSSEGAKKI----FLQDCEP---ALAEQLIEKL  168
               +  P E++   + +L +      + S     K       Q C P   ALA  L+   
Sbjct  121  QYNERTPAENWLD-TQFLPYGSPEEPLTSMFFGPKFLAHKLYQLCSPEDLALASSLV---  176

Query  169  RPQPEAGRDLKPV--LTPERFGCVPRIYVEALNDQSLSINMQR  209
            RP      DL      T ERFG V R+Y+    D+ +    QR
Sbjct  177  RPSSLFMEDLSKAKYFTDERFGSVKRVYIVCTEDKGIPEEFQR  219


> Q9SE93 Polyneuridine-aldehyde esterase [Rauvolfia serpentina]
Length=264

 Score = 75.9 bits (185),  Expect = 7e-20
 Identities = 75/243 (31%), Positives = 115/243 (47%), Gaps = 12/243 (5%)

Query  3    KHIVLVHGAWQGSWSFDLIKPWLQQKGWTVHAVDLPDNGWN-SDTQITASQQSYCDYVVQ  61
            KH VLVHG   G+W +  +KP L+  G  V AVDL   G N        + + Y + +++
Sbjct  11   KHFVLVHGGCLGAWIWYKLKPLLESAGHKVTAVDLSAAGINPRRLDEIHTFRDYSEPLME  70

Query  62   MIHNI--GEPVVLLGHSGGGLTISAVAEQIPELISHLVYLVGMMLPSNMSF-LDFKKLCE  118
            ++ +I   E VVLLGHS GG+++    E  PE IS  V++  MM   N S    F+K  E
Sbjct  71   VMASIPPDEKVVLLGHSFGGMSLGLAMETYPEKISVAVFMSAMMPDPNHSLTYPFEKYNE  130

Query  119  QHFPDEDF-SGISPYLTFTDDGYSIVSSEG--AKKIFLQDCEPALAEQLIEKLRPQPEAG  175
            +   D    S  S Y    + G S++      A K+F Q+C     E      RP     
Sbjct  131  KCPADMMLDSQFSTYGNPENPGMSMILGPQFMALKMF-QNCSVEDLELAKMLTRPGSLFF  189

Query  176  RDLKPV--LTPERFGCVPRIYVEALNDQSLSINMQR-LMQQLQPNKLQIIAMQTGHVPQA  232
            +DL      + ER+G V R Y+    D+S  +  Q+  ++ +  +K++ I  +  H+   
Sbjct  190  QDLAKAKKFSTERYGSVKRAYIFCNEDKSFPVEFQKWFVESVGADKVKEI-KEADHMGML  248

Query  233  VQP  235
             QP
Sbjct  249  SQP  251


> Q9FW03 Putative methylesterase 11, chloroplastic [Arabidopsis 
thaliana]
Length=390

 Score = 76.3 bits (186),  Expect = 2e-19
 Identities = 72/253 (28%), Positives = 106/253 (42%), Gaps = 17/253 (7%)

Query  4    HIVLVHGAWQGSWSFDLIKPWLQQKGWTVHAVDLPDNGWNS-DTQITASQQSYCDYVVQM  62
            H VLVHG   G+W +      L++ G+ V A+DL   G NS +    AS   Y   +  +
Sbjct  138  HFVLVHGGSFGAWCWYKTIALLEEDGFKVTAIDLAGCGINSININGIASLSQYVKPLTDI  197

Query  63   IHN--IGEPVVLLGHSGGGLTISAVAEQIPELISHLVYLVGMMLPSNMSFLDFKKLCEQH  120
            +    IGE V+L+GH  GG  IS   E  P  IS  V+L   ML +  S LD   L    
Sbjct  198  LEKLPIGEKVILVGHDFGGACISYAMELFPSKISKAVFLAAAMLTNGQSTLDMFSL---K  254

Query  121  FPDEDFSGISPYLTFTDDGYSIVSSEGAKKIFLQDC--------EPALAEQLIEKLRPQP  172
                D    +    +T+   +  ++    K  L+D         + ALA      +R  P
Sbjct  255  AGQNDLMRKAQIFIYTNGNENPPTAIDLDKSLLKDLLFNQSPSKDVALAS---VSMRSIP  311

Query  173  EAGRDLKPVLTPERFGCVPRIYVEALNDQSLSINMQRLMQQLQPNKLQIIAMQTGHVPQA  232
             A    K  L+   +G V R Y+E L D ++ + +Q  M    P +         H P  
Sbjct  312  FAPVLEKLSLSDANYGSVRRYYIETLEDNAIPVTLQENMINSSPPEKVYRLKGADHAPFF  371

Query  233  VQPDLLVEKLNQI  245
             +P  L + L +I
Sbjct  372  SKPQALHKLLLEI  384


> Q940H7 Putative methylesterase 12, chloroplastic [Arabidopsis 
thaliana]
Length=349

 Score = 75.9 bits (185),  Expect = 2e-19
 Identities = 69/253 (27%), Positives = 118/253 (47%), Gaps = 14/253 (6%)

Query  3    KHIVLVHGAWQGSWSFDLIKPWLQQKGWTVHAVDLPDNGWN-SDTQITASQQSYCDYVVQ  61
            K  VLVHG   G+W +      L++ G +   VDL  +G+N +D    ++ + Y   +++
Sbjct  97   KKFVLVHGEGFGAWCWYKTIASLEESGLSPVTVDLAGSGFNMTDANSVSTLEEYSKPLIE  156

Query  62   MIHNIG--EPVVLLGHSGGGLTISAVAEQIPELISHLVYLVGMMLPSNMSFLDFKKLCEQ  119
            +I N+   E V+L+GHS GG  +S   E+ PE IS  +++   M+        F    ++
Sbjct  157  LIQNLPAEEKVILVGHSTGGACVSYALERFPEKISKAIFICATMVTDGQR--PFDVFADE  214

Query  120  HFPDEDFSGISPYLTFTD------DGYSIVSSEGAKKIFLQDCEPALAEQLIEKLRPQPE  173
                E F   S +L + +       G+           F Q     +A  +I  +RP P 
Sbjct  215  LGSAERFMKESQFLIYGNGKDNPATGFMFEKQHMKGLYFNQSPNKDIALSMI-SMRPVPL  273

Query  174  AGRDLKPVLTPERFGCVPRIYVEALNDQSLSINMQ-RLMQQLQPNKLQIIAMQTGHVPQA  232
                 K  L+ ER+G   R YV+ L+D +LS ++Q +L+++  P  +  I   + H P  
Sbjct  274  GPMMEKLSLSAERYGKGRRFYVQTLDDLALSPDVQEKLVRENSPEAVFKI-KGSDHCPFF  332

Query  233  VQPDLLVEKLNQI  245
             +P  L + L +I
Sbjct  333  SKPQSLHKILLEI  345



Lambda      K        H        a         alpha
   0.321    0.137    0.418    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 566866


  Database: d18069bc7a74bdb03d829eaaa26e369a.SwissProt.fasta
    Posted date:  Sep 18, 2020  4:07 PM
  Number of letters in database: 2,952
  Number of sequences in database:  10



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40