ACIAD0764 / TrEMBL Alignments

BLASTP 2.2.28+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: 021397cc2c407b864583220cf11f9e76.TrEMBL.fasta
           23 sequences; 7,459 total letters



Query= ACIAD0764

Length=317
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  Q6FE40 Putative oxidoreductase [Acinetobacter baylyi (strain AT...   660    0.0   
  A0A009ZIH8 2OG-Fe(II) oxygenase superfamily protein [Acinetobac...   563    0.0   
  N9S6U8 Fe2OG dioxygenase domain-containing protein [Acinetobact...   563    0.0   
  N9BZB9 Fe2OG dioxygenase domain-containing protein [Acinetobact...   563    0.0   
  A0A1Z9YZ22 Oxidoreductase [Acinetobacter populi]                     444    9e-160
  A0A240EAT5 Isopenicillin N synthase [Acinetobacter puyangensis]      444    2e-159
  A0A2N8T1X5 Isopenicillin N synthase family oxygenase [Pseudomon...   410    3e-146
  A0A1G3DCT0 Oxidoreductase [Pseudomonadales bacterium RIFCSPHIGH...   410    4e-146
  A0A0H3YXG4 Oxidoreductase [Pseudomonas stutzeri]                     410    4e-146
  F8H7H2 Oxidoreductase [Pseudomonas stutzeri (strain ATCC 17588 ...   409    8e-146
  A0A2U8SZE4 Isopenicillin N synthase family oxygenase [Pseudomon...   409    2e-145
  A4VNJ2 Probable oxidoreductase [Pseudomonas stutzeri (strain A1...   409    2e-145
  A0A023WR47 Oxidoreductase [Pseudomonas stutzeri]                     409    2e-145
  Q9M3R8 Fe2OG dioxygenase domain-containing protein [Arabidopsis...   206    1e-66 
  Q9M3R7 AT4g16770 [Arabidopsis thaliana]                              196    1e-62 
  Q9LEM4 Fe2OG dioxygenase domain-containing protein [Capsella ru...   188    1e-59 
  Q9LEM3 Fe2OG dioxygenase domain-containing protein [Capsella ru...   187    2e-59 
  A0A2U8U2L3 2-oxoglutarate-dependent dioxygenase asL3 [Sarocladi...   172    3e-53 
  A3QRM2 Senescence-associated nodulin 1B [Glycine max]                162    2e-49 
  A3QRM3 Senescence-associated nodulin 1A [Glycine max]                160    6e-49 
  Q7RYZ9 Thymine dioxygenase [Neurospora crassa (strain ATCC 2469...   159    2e-48 
  C5I496 Thymine dioxygenase [Rhodotorula glutinis]                    154    2e-46 
  A0A1X9PXY3 2-oxoglutarate/FeII oxygenase [Phyllosticta cirsii]       151    1e-45 


> Q6FE40 Putative oxidoreductase [Acinetobacter baylyi (strain 
ATCC 33305 / BD413 / ADP1)]
Length=316

 Score =  660 bits (1704),  Expect = 0.0
 Identities = 315/316 (99%), Positives = 316/316 (100%), Gaps = 0/316 (0%)

Query  1    VTQHIPIISISGLFSPLLEDRLQVAMQMKQACEDNGFFYIADHGVSKNLQQKVFEQSRQF  60
            +TQHIPIISISGLFSPLLEDRLQVAMQMKQACEDNGFFYIADHGVSKNLQQKVFEQSRQF
Sbjct  1    MTQHIPIISISGLFSPLLEDRLQVAMQMKQACEDNGFFYIADHGVSKNLQQKVFEQSRQF  60

Query  61   FDLPTNEKEKIHKKNSIANRGYEPLKNQTLEAGTPADLKEGFYAGREYALDSQAVLNKRF  120
            FDLPTNEKEKIHKKNSIANRGYEPLKNQTLEAGTPADLKEGFYAGREYALDSQAVLNKRF
Sbjct  61   FDLPTNEKEKIHKKNSIANRGYEPLKNQTLEAGTPADLKEGFYAGREYALDSQAVLNKRF  120

Query  121  NHGPNQWPEQFPEFESTMQHYQAELEVLAKHLMRGLALSLNLDENYFDDFCQDSLVTLRL  180
            NHGPNQWPEQFPEFESTMQHYQAELEVLAKHLMRGLALSLNLDENYFDDFCQDSLVTLRL
Sbjct  121  NHGPNQWPEQFPEFESTMQHYQAELEVLAKHLMRGLALSLNLDENYFDDFCQDSLVTLRL  180

Query  181  LHYPPQPANPEPNEKGCGAHTDFGALTLLLQDQQGGLQVWDKHTESWIDAPPIEGTYVIN  240
            LHYPPQPANPEPNEKGCGAHTDFGALTLLLQDQQGGLQVWDKHTESWIDAPPIEGTYVIN
Sbjct  181  LHYPPQPANPEPNEKGCGAHTDFGALTLLLQDQQGGLQVWDKHTESWIDAPPIEGTYVIN  240

Query  241  LGDLIARWTNNHYKSTVHRVINKSGKQRYSVPFFFGGNPDYLVKCLPDCMSESEPSLFVP  300
            LGDLIARWTNNHYKSTVHRVINKSGKQRYSVPFFFGGNPDYLVKCLPDCMSESEPSLFVP
Sbjct  241  LGDLIARWTNNHYKSTVHRVINKSGKQRYSVPFFFGGNPDYLVKCLPDCMSESEPSLFVP  300

Query  301  TTVEQHHIEMYRRTYG  316
            TTVEQHHIEMYRRTYG
Sbjct  301  TTVEQHHIEMYRRTYG  316


> A0A009ZIH8 2OG-Fe(II) oxygenase superfamily protein [Acinetobacter 
sp. 479375]
Length=316

 Score =  563 bits (1452),  Expect = 0.0
 Identities = 262/312 (84%), Positives = 291/312 (93%), Gaps = 0/312 (0%)

Query  5    IPIISISGLFSPLLEDRLQVAMQMKQACEDNGFFYIADHGVSKNLQQKVFEQSRQFFDLP  64
            IP+I ISGLFS  +++R  VA QMKQACED GFFYI++HG++  LQQ VF+QS+QFFDLP
Sbjct  5    IPVIDISGLFSSDVKERQMVAQQMKQACEDKGFFYISNHGIATELQQAVFKQSKQFFDLP  64

Query  65   TNEKEKIHKKNSIANRGYEPLKNQTLEAGTPADLKEGFYAGREYALDSQAVLNKRFNHGP  124
             NEKEK+HKKNSIANRGYEPLKNQTLEAGTPADLKEGFY+GREYAL+S+ VL +RFNHGP
Sbjct  65   MNEKEKVHKKNSIANRGYEPLKNQTLEAGTPADLKEGFYSGREYALESKEVLAQRFNHGP  124

Query  125  NQWPEQFPEFESTMQHYQAELEVLAKHLMRGLALSLNLDENYFDDFCQDSLVTLRLLHYP  184
            NQWP QFPEFESTMQ YQAELEVLAK+LMRGLALSL+L ENYFDDFC DSLVTLRLLHYP
Sbjct  125  NQWPTQFPEFESTMQRYQAELEVLAKYLMRGLALSLSLSENYFDDFCHDSLVTLRLLHYP  184

Query  185  PQPANPEPNEKGCGAHTDFGALTLLLQDQQGGLQVWDKHTESWIDAPPIEGTYVINLGDL  244
            PQPANPEPNEKGCGAHTDFGALTLLLQDQQGGLQVWD+++ESW+DAPPIEGTYVINLGDL
Sbjct  185  PQPANPEPNEKGCGAHTDFGALTLLLQDQQGGLQVWDQNSESWMDAPPIEGTYVINLGDL  244

Query  245  IARWTNNHYKSTVHRVINKSGKQRYSVPFFFGGNPDYLVKCLPDCMSESEPSLFVPTTVE  304
            IARWTNN +KST+HRVINKSGKQRYSVPFFFGGNPDY V+CLP+C +E+EP+LF PTTVE
Sbjct  245  IARWTNNRFKSTLHRVINKSGKQRYSVPFFFGGNPDYQVQCLPNCKTENEPALFAPTTVE  304

Query  305  QHHIEMYRRTYG  316
            +HHIEMYRRTYG
Sbjct  305  KHHIEMYRRTYG  316


> N9S6U8 Fe2OG dioxygenase domain-containing protein [Acinetobacter 
ursingii NIPH 706]
Length=316

 Score =  563 bits (1452),  Expect = 0.0
 Identities = 262/312 (84%), Positives = 291/312 (93%), Gaps = 0/312 (0%)

Query  5    IPIISISGLFSPLLEDRLQVAMQMKQACEDNGFFYIADHGVSKNLQQKVFEQSRQFFDLP  64
            IP+I ISGLFS  +++R  VA QMKQACED GFFYI++HG++  LQQ VF+QS+QFFDLP
Sbjct  5    IPVIDISGLFSSDVKERQMVAQQMKQACEDKGFFYISNHGIATELQQAVFKQSKQFFDLP  64

Query  65   TNEKEKIHKKNSIANRGYEPLKNQTLEAGTPADLKEGFYAGREYALDSQAVLNKRFNHGP  124
             NEKEK+HKKNSIANRGYEPLKNQTLEAGTPADLKEGFY+GREYAL+S+ VL +RFNHGP
Sbjct  65   MNEKEKVHKKNSIANRGYEPLKNQTLEAGTPADLKEGFYSGREYALESKEVLAQRFNHGP  124

Query  125  NQWPEQFPEFESTMQHYQAELEVLAKHLMRGLALSLNLDENYFDDFCQDSLVTLRLLHYP  184
            NQWP QFPEFESTMQ YQAELEVLAK+LMRGLALSL+L ENYFDDFC DSLVTLRLLHYP
Sbjct  125  NQWPTQFPEFESTMQRYQAELEVLAKYLMRGLALSLSLSENYFDDFCHDSLVTLRLLHYP  184

Query  185  PQPANPEPNEKGCGAHTDFGALTLLLQDQQGGLQVWDKHTESWIDAPPIEGTYVINLGDL  244
            PQPANPEPNEKGCGAHTDFGALTLLLQDQQGGLQVWD+++ESW+DAPPIEGTYVINLGDL
Sbjct  185  PQPANPEPNEKGCGAHTDFGALTLLLQDQQGGLQVWDQNSESWMDAPPIEGTYVINLGDL  244

Query  245  IARWTNNHYKSTVHRVINKSGKQRYSVPFFFGGNPDYLVKCLPDCMSESEPSLFVPTTVE  304
            IARWTNN +KST+HRVINKSGKQRYSVPFFFGGNPDY V+CLP+C +E+EP+LF PTTVE
Sbjct  245  IARWTNNRFKSTLHRVINKSGKQRYSVPFFFGGNPDYQVQCLPNCKTENEPALFAPTTVE  304

Query  305  QHHIEMYRRTYG  316
            +HHIEMYRRTYG
Sbjct  305  KHHIEMYRRTYG  316


> N9BZB9 Fe2OG dioxygenase domain-containing protein [Acinetobacter 
ursingii ANC 3649]
Length=316

 Score =  563 bits (1450),  Expect = 0.0
 Identities = 262/312 (84%), Positives = 290/312 (93%), Gaps = 0/312 (0%)

Query  5    IPIISISGLFSPLLEDRLQVAMQMKQACEDNGFFYIADHGVSKNLQQKVFEQSRQFFDLP  64
            IP+I ISGLFS  +++R  VA QMKQACED GFFYI++HG++  LQQ VF+QS+QFFDLP
Sbjct  5    IPVIDISGLFSADVKERQMVAQQMKQACEDKGFFYISNHGIATELQQAVFKQSKQFFDLP  64

Query  65   TNEKEKIHKKNSIANRGYEPLKNQTLEAGTPADLKEGFYAGREYALDSQAVLNKRFNHGP  124
             NEKEK+HKKNSIANRGYEPLKNQTLEAGTPADLKEGFY+GREYA +S+ VL +RFNHGP
Sbjct  65   MNEKEKVHKKNSIANRGYEPLKNQTLEAGTPADLKEGFYSGREYAQESKEVLAQRFNHGP  124

Query  125  NQWPEQFPEFESTMQHYQAELEVLAKHLMRGLALSLNLDENYFDDFCQDSLVTLRLLHYP  184
            NQWP QFPEFESTMQ YQAELEVLAKHLMRGLALSL+L ENYFDDFC DSLVTLRLLHYP
Sbjct  125  NQWPTQFPEFESTMQRYQAELEVLAKHLMRGLALSLSLAENYFDDFCHDSLVTLRLLHYP  184

Query  185  PQPANPEPNEKGCGAHTDFGALTLLLQDQQGGLQVWDKHTESWIDAPPIEGTYVINLGDL  244
            PQPANPEPNEKGCGAHTDFGALTLLLQDQQGGLQVWD+++ESW+DAPPIEGTYVINLGDL
Sbjct  185  PQPANPEPNEKGCGAHTDFGALTLLLQDQQGGLQVWDQNSESWMDAPPIEGTYVINLGDL  244

Query  245  IARWTNNHYKSTVHRVINKSGKQRYSVPFFFGGNPDYLVKCLPDCMSESEPSLFVPTTVE  304
            IARWTNN +KST+HRVINKSGKQRYSVPFFFGGNPDY V+CLP+C +E+EP+LF PTTVE
Sbjct  245  IARWTNNRFKSTLHRVINKSGKQRYSVPFFFGGNPDYQVQCLPNCKTENEPALFAPTTVE  304

Query  305  QHHIEMYRRTYG  316
            +HHIEMYRRTYG
Sbjct  305  KHHIEMYRRTYG  316


> A0A1Z9YZ22 Oxidoreductase [Acinetobacter populi]
Length=316

 Score =  444 bits (1143),  Expect = 9e-160
 Identities = 206/316 (65%), Positives = 253/316 (80%), Gaps = 0/316 (0%)

Query  1    VTQHIPIISISGLFSPLLEDRLQVAMQMKQACEDNGFFYIADHGVSKNLQQKVFEQSRQF  60
            +T  +P+I ++ L S   EDRL VA Q++QAC D GFFYI +HG+S +LQQ+VF+ S+QF
Sbjct  1    MTLTLPLIDVAALSSTNFEDRLAVAKQIRQACLDKGFFYIINHGISADLQQQVFQYSQQF  60

Query  61   FDLPTNEKEKIHKKNSIANRGYEPLKNQTLEAGTPADLKEGFYAGREYALDSQAVLNKRF  120
            F+LP   KE+I+K  SIANRGYEPLKNQTLEA  P DLKEGFY GREYALDS+ V NKRF
Sbjct  61   FNLPLPAKEQINKNKSIANRGYEPLKNQTLEADAPPDLKEGFYVGREYALDSEEVKNKRF  120

Query  121  NHGPNQWPEQFPEFESTMQHYQAELEVLAKHLMRGLALSLNLDENYFDDFCQDSLVTLRL  180
            N+GPNQWPE  PEF+  M  YQ E+E L+  LMR LALSL+L+E+YF+ + Q +++TLRL
Sbjct  121  NYGPNQWPEDLPEFKQVMMQYQQEVEALSIRLMRALALSLDLNEDYFNQYNQQAMITLRL  180

Query  181  LHYPPQPANPEPNEKGCGAHTDFGALTLLLQDQQGGLQVWDKHTESWIDAPPIEGTYVIN  240
            LHYPPQPANP PNEKGCGAHTDFG LTLLLQD  GGLQVWD     W+DA PI G+YV+N
Sbjct  181  LHYPPQPANPLPNEKGCGAHTDFGGLTLLLQDMNGGLQVWDHQQHIWLDAQPIAGSYVVN  240

Query  241  LGDLIARWTNNHYKSTVHRVINKSGKQRYSVPFFFGGNPDYLVKCLPDCMSESEPSLFVP  300
            LGDLIARWTN+ Y+ST HRVIN+SG +RYSVPFFFGGNP++ ++C+  C++E + + +  
Sbjct  241  LGDLIARWTNDLYQSTRHRVINRSGVERYSVPFFFGGNPEHEIRCIETCLNEGDIAKYPV  300

Query  301  TTVEQHHIEMYRRTYG  316
            TTVE+HH EMYRRTYG
Sbjct  301  TTVEKHHQEMYRRTYG  316


> A0A240EAT5 Isopenicillin N synthase [Acinetobacter puyangensis]
Length=316

 Score =  444 bits (1141),  Expect = 2e-159
 Identities = 205/316 (65%), Positives = 252/316 (80%), Gaps = 0/316 (0%)

Query  1    VTQHIPIISISGLFSPLLEDRLQVAMQMKQACEDNGFFYIADHGVSKNLQQKVFEQSRQF  60
            +T  +P+I ++ L S   EDR+ VA Q++QAC D GFFYI +HG+S +LQQ+VF+ S+QF
Sbjct  1    MTLTLPLIDVAALSSTNFEDRIAVAKQIRQACLDKGFFYIINHGISADLQQQVFQYSQQF  60

Query  61   FDLPTNEKEKIHKKNSIANRGYEPLKNQTLEAGTPADLKEGFYAGREYALDSQAVLNKRF  120
            F+LP   KE+I+K  SIANRGYEPLKNQTLEA  P DLKEGFYAGREYA+DS+ V NKRF
Sbjct  61   FNLPLPAKEQINKNKSIANRGYEPLKNQTLEADAPPDLKEGFYAGREYAMDSEEVKNKRF  120

Query  121  NHGPNQWPEQFPEFESTMQHYQAELEVLAKHLMRGLALSLNLDENYFDDFCQDSLVTLRL  180
            N+GPNQWPE  P+F+  M  YQ E+E L+  LMR LALSL+L+E+YFD + Q +++TLRL
Sbjct  121  NYGPNQWPEDLPQFKQVMMQYQQEVEALSIRLMRALALSLDLNEDYFDQYNQQAMITLRL  180

Query  181  LHYPPQPANPEPNEKGCGAHTDFGALTLLLQDQQGGLQVWDKHTESWIDAPPIEGTYVIN  240
            LHYPPQPANP PNEKGCGAHTDFG LTLLLQD  GGLQVWD     W+DA PI G+YV+N
Sbjct  181  LHYPPQPANPLPNEKGCGAHTDFGGLTLLLQDMNGGLQVWDHQQHIWLDAQPIAGSYVVN  240

Query  241  LGDLIARWTNNHYKSTVHRVINKSGKQRYSVPFFFGGNPDYLVKCLPDCMSESEPSLFVP  300
            LGDLIARWTN+ Y+ST HRVIN+SG +RYSVPFFFGGNP + ++C+  C++E   + +  
Sbjct  241  LGDLIARWTNDLYQSTRHRVINRSGVERYSVPFFFGGNPQHEIRCIETCLNEDNLAKYPV  300

Query  301  TTVEQHHIEMYRRTYG  316
            TTVE+HH EMYRRTYG
Sbjct  301  TTVEKHHQEMYRRTYG  316


> A0A2N8T1X5 Isopenicillin N synthase family oxygenase [Pseudomonas 
stutzeri]
Length=326

 Score =  410 bits (1055),  Expect = 3e-146
 Identities = 191/312 (61%), Positives = 233/312 (75%), Gaps = 0/312 (0%)

Query  5    IPIISISGLFSPLLEDRLQVAMQMKQACEDNGFFYIADHGVSKNLQQKVFEQSRQFFDLP  64
            +P+I I+GLFSP L++R+ VA ++  AC + GFF IA+HGV   LQQ VF Q+R FFD P
Sbjct  15   LPLIDIAGLFSPDLDERVAVAERIGAACREVGFFCIANHGVDPALQQAVFAQARAFFDQP  74

Query  65   TNEKEKIHKKNSIANRGYEPLKNQTLEAGTPADLKEGFYAGREYALDSQAVLNKRFNHGP  124
               K  + K NS ANRGYEPL+ Q LEAG PADLKEGFY G E A D   VL  RFNHG 
Sbjct  75   DTTKRTLDKANSRANRGYEPLRGQVLEAGAPADLKEGFYIGEELAEDDPRVLAGRFNHGA  134

Query  125  NQWPEQFPEFESTMQHYQAELEVLAKHLMRGLALSLNLDENYFDDFCQDSLVTLRLLHYP  184
            NQWP +   F  TM+ Y+  +  LA  LM  +ALSL L E++F  FC+DS+ TLRLLHYP
Sbjct  135  NQWPSELAAFRPTMERYRDAMNALANRLMGAIALSLQLPEDHFAGFCRDSMSTLRLLHYP  194

Query  185  PQPANPEPNEKGCGAHTDFGALTLLLQDQQGGLQVWDKHTESWIDAPPIEGTYVINLGDL  244
            PQPAN  P EKGCGAHTDFG LTLLLQD+  GLQVWD+H++SWI A P+ GTYV+NLGD+
Sbjct  195  PQPANSAPGEKGCGAHTDFGGLTLLLQDENPGLQVWDRHSKSWIHAVPVPGTYVVNLGDM  254

Query  245  IARWTNNHYKSTVHRVINKSGKQRYSVPFFFGGNPDYLVKCLPDCMSESEPSLFVPTTVE  304
            IARWTN+ Y+ST+HRV+N SG++RYSVPFFF GNPD++V+CLP C++  E   +   TVE
Sbjct  255  IARWTNDQYRSTLHRVVNMSGRERYSVPFFFSGNPDHVVECLPTCLAPGEAPRYPAVTVE  314

Query  305  QHHIEMYRRTYG  316
            +HH EMYRRTYG
Sbjct  315  EHHREMYRRTYG  326


> A0A1G3DCT0 Oxidoreductase [Pseudomonadales bacterium RIFCSPHIGHO2_01_FULL_64_12]
Length=326

 Score =  410 bits (1054),  Expect = 4e-146
 Identities = 193/312 (62%), Positives = 233/312 (75%), Gaps = 0/312 (0%)

Query  5    IPIISISGLFSPLLEDRLQVAMQMKQACEDNGFFYIADHGVSKNLQQKVFEQSRQFFDLP  64
            +P+I I+GLFSP L++R  VA ++  AC + GFF IA+HGV   LQQ VFEQ+R FF LP
Sbjct  15   LPLIDIAGLFSPDLDERAAVAKRIGAACREVGFFCIANHGVDAALQQAVFEQARAFFALP  74

Query  65   TNEKEKIHKKNSIANRGYEPLKNQTLEAGTPADLKEGFYAGREYALDSQAVLNKRFNHGP  124
               K  + K  S ANRGYEPL+ Q LEAG PADLKEGFY G E A D   VL  RFNHG 
Sbjct  75   EPGKRALDKVFSKANRGYEPLRGQVLEAGAPADLKEGFYIGEELAEDDPRVLAGRFNHGA  134

Query  125  NQWPEQFPEFESTMQHYQAELEVLAKHLMRGLALSLNLDENYFDDFCQDSLVTLRLLHYP  184
            NQWP +  EF  TM+ Y+  +  LA  LMR +ALSL L E +F  FC+DS+ TLRLLHYP
Sbjct  135  NQWPIELAEFRPTMERYRDAMNALANRLMRAIALSLQLPEEHFAGFCRDSMSTLRLLHYP  194

Query  185  PQPANPEPNEKGCGAHTDFGALTLLLQDQQGGLQVWDKHTESWIDAPPIEGTYVINLGDL  244
            PQPAN  P EKGCGAHTDFG LTLLLQD+  GLQVWD+H++SWI A P+ GTYV+NLGD+
Sbjct  195  PQPANAAPGEKGCGAHTDFGGLTLLLQDENPGLQVWDRHSKSWIHAVPVPGTYVVNLGDM  254

Query  245  IARWTNNHYKSTVHRVINKSGKQRYSVPFFFGGNPDYLVKCLPDCMSESEPSLFVPTTVE  304
            IARWTN+ Y+ST+HRV+N SG++RYSVPFFF GNPD++V+CLP C++  E   +   TVE
Sbjct  255  IARWTNDQYRSTLHRVVNMSGRERYSVPFFFSGNPDHVVECLPTCLAPGEAPRYPAVTVE  314

Query  305  QHHIEMYRRTYG  316
            +HH EMYRRTYG
Sbjct  315  EHHREMYRRTYG  326


> A0A0H3YXG4 Oxidoreductase [Pseudomonas stutzeri]
Length=326

 Score =  410 bits (1054),  Expect = 4e-146
 Identities = 193/312 (62%), Positives = 234/312 (75%), Gaps = 0/312 (0%)

Query  5    IPIISISGLFSPLLEDRLQVAMQMKQACEDNGFFYIADHGVSKNLQQKVFEQSRQFFDLP  64
            +P+I I+GLFSP L++R  VA ++  AC + GFF IA+HGV   LQQ VFEQ+R FF LP
Sbjct  15   LPLIDIAGLFSPDLDERAAVAERIGAACREVGFFCIANHGVDAALQQAVFEQARAFFALP  74

Query  65   TNEKEKIHKKNSIANRGYEPLKNQTLEAGTPADLKEGFYAGREYALDSQAVLNKRFNHGP  124
               K  + K  S ANRGYEPL+ Q LEAG PADLKEGFY G E A D   VL  RFNHG 
Sbjct  75   EAGKRALDKVFSKANRGYEPLRGQVLEAGAPADLKEGFYIGEELAEDDPRVLAGRFNHGA  134

Query  125  NQWPEQFPEFESTMQHYQAELEVLAKHLMRGLALSLNLDENYFDDFCQDSLVTLRLLHYP  184
            NQWP +  EF  TM+ Y+  +  LA  LMR +ALSL L E++F  FC+DS+ TLRLLHYP
Sbjct  135  NQWPIELAEFRPTMERYRDAMNALANRLMRAIALSLQLPEDHFAGFCRDSMSTLRLLHYP  194

Query  185  PQPANPEPNEKGCGAHTDFGALTLLLQDQQGGLQVWDKHTESWIDAPPIEGTYVINLGDL  244
            PQPAN  P EKGCGAHTDFG LTLLLQD+  GLQVWD+H++SWI A P+ GTYV+NLGD+
Sbjct  195  PQPANAAPGEKGCGAHTDFGGLTLLLQDENPGLQVWDRHSKSWIHAVPVPGTYVVNLGDM  254

Query  245  IARWTNNHYKSTVHRVINKSGKQRYSVPFFFGGNPDYLVKCLPDCMSESEPSLFVPTTVE  304
            IARWTN+ Y+ST+HRV+N SG++RYSVPFFF GNPD++V+CLP C++  E   +   TVE
Sbjct  255  IARWTNDQYRSTLHRVVNMSGRERYSVPFFFSGNPDHVVECLPTCLAPGEAPRYPAVTVE  314

Query  305  QHHIEMYRRTYG  316
            +HH EMYRRTYG
Sbjct  315  EHHREMYRRTYG  326


> F8H7H2 Oxidoreductase [Pseudomonas stutzeri (strain ATCC 17588 
/ DSM 5190 / CCUG 11256 / JCM 5965 / LMG 11199 / NCIMB 11358 
/ Stanier 221)]
Length=326

 Score =  409 bits (1052),  Expect = 8e-146
 Identities = 192/312 (62%), Positives = 233/312 (75%), Gaps = 0/312 (0%)

Query  5    IPIISISGLFSPLLEDRLQVAMQMKQACEDNGFFYIADHGVSKNLQQKVFEQSRQFFDLP  64
            +P+I I+GLFSP L++R  VA ++  AC + GFF IA+HGV   LQQ VFEQ+R FF LP
Sbjct  15   LPLIDIAGLFSPDLDERAAVAKRIGAACREVGFFCIANHGVDAALQQAVFEQARAFFALP  74

Query  65   TNEKEKIHKKNSIANRGYEPLKNQTLEAGTPADLKEGFYAGREYALDSQAVLNKRFNHGP  124
               K  + K  S ANRGYEPL+ Q LEAG PADLKEGFY G E A D   VL  RFNHG 
Sbjct  75   EPGKRALDKVFSKANRGYEPLRGQVLEAGAPADLKEGFYIGEELAEDDPRVLAGRFNHGA  134

Query  125  NQWPEQFPEFESTMQHYQAELEVLAKHLMRGLALSLNLDENYFDDFCQDSLVTLRLLHYP  184
            NQWP +  EF  TM+ Y+  +  LA  LM  +ALSL L E++F  FC+DS+ TLRLLHYP
Sbjct  135  NQWPSELAEFRPTMERYRDAMNALANRLMAAIALSLQLPEDHFAGFCRDSMSTLRLLHYP  194

Query  185  PQPANPEPNEKGCGAHTDFGALTLLLQDQQGGLQVWDKHTESWIDAPPIEGTYVINLGDL  244
            PQPAN  P EKGCGAHTDFG LTLLLQD+  GLQVWD+H++SWI A P+ GTYV+NLGD+
Sbjct  195  PQPANAAPGEKGCGAHTDFGGLTLLLQDENPGLQVWDRHSKSWIHAVPVPGTYVVNLGDM  254

Query  245  IARWTNNHYKSTVHRVINKSGKQRYSVPFFFGGNPDYLVKCLPDCMSESEPSLFVPTTVE  304
            IARWTN+ Y+ST+HRV+N SG++RYSVPFFF GNPD++V+CLP C++  E   +   TVE
Sbjct  255  IARWTNDQYRSTLHRVVNMSGRERYSVPFFFSGNPDHVVECLPTCLAPGEAPRYPAVTVE  314

Query  305  QHHIEMYRRTYG  316
            +HH EMYRRTYG
Sbjct  315  EHHREMYRRTYG  326


> A0A2U8SZE4 Isopenicillin N synthase family oxygenase [Pseudomonas 
stutzeri]
Length=326

 Score =  409 bits (1050),  Expect = 2e-145
 Identities = 192/312 (62%), Positives = 232/312 (74%), Gaps = 0/312 (0%)

Query  5    IPIISISGLFSPLLEDRLQVAMQMKQACEDNGFFYIADHGVSKNLQQKVFEQSRQFFDLP  64
            +P+I I+GLFSP L +R  VA ++  AC + GFF IA+HGV   LQQ VFEQ+R FF LP
Sbjct  15   LPLIDIAGLFSPDLAERTAVAERIGAACREVGFFCIANHGVDAALQQAVFEQARAFFALP  74

Query  65   TNEKEKIHKKNSIANRGYEPLKNQTLEAGTPADLKEGFYAGREYALDSQAVLNKRFNHGP  124
              +K  + K  S ANRGYEPL+ Q LEAG PADLKEGFY G E A D   VL  RFNHG 
Sbjct  75   AADKRALDKVFSKANRGYEPLRGQVLEAGAPADLKEGFYIGEELAEDDPRVLAGRFNHGA  134

Query  125  NQWPEQFPEFESTMQHYQAELEVLAKHLMRGLALSLNLDENYFDDFCQDSLVTLRLLHYP  184
            NQWP +  +F  TM+ Y+  +  LA  LM  +ALSL L E +F  FC+DS+ TLRLLHYP
Sbjct  135  NQWPSELADFRPTMERYRDAMNALAARLMGAIALSLQLPEEHFASFCRDSMSTLRLLHYP  194

Query  185  PQPANPEPNEKGCGAHTDFGALTLLLQDQQGGLQVWDKHTESWIDAPPIEGTYVINLGDL  244
            PQPAN  P EKGCGAHTDFG LTLLLQD+  GLQVWD+H++SWI A P+ GTYV+NLGD+
Sbjct  195  PQPANAAPGEKGCGAHTDFGGLTLLLQDENPGLQVWDRHSKSWIHAAPVPGTYVVNLGDM  254

Query  245  IARWTNNHYKSTVHRVINKSGKQRYSVPFFFGGNPDYLVKCLPDCMSESEPSLFVPTTVE  304
            IARWTN+ Y+ST+HRV+N SG++RYSVPFFF GNPD+LV+CLP C++  E   +   TVE
Sbjct  255  IARWTNDQYRSTLHRVVNISGRERYSVPFFFSGNPDHLVECLPTCLAAGEAPRYPAVTVE  314

Query  305  QHHIEMYRRTYG  316
            +HH EMYRRTYG
Sbjct  315  EHHREMYRRTYG  326


> A4VNJ2 Probable oxidoreductase [Pseudomonas stutzeri (strain 
A1501)]
Length=326

 Score =  409 bits (1050),  Expect = 2e-145
 Identities = 192/312 (62%), Positives = 232/312 (74%), Gaps = 0/312 (0%)

Query  5    IPIISISGLFSPLLEDRLQVAMQMKQACEDNGFFYIADHGVSKNLQQKVFEQSRQFFDLP  64
            +P+I I+GLFSP L++R  VA ++  AC + GFF IA+HGV   LQQ VFEQ+R FF LP
Sbjct  15   LPLIDIAGLFSPDLDERAAVAERIGAACREVGFFCIANHGVDAALQQAVFEQARAFFALP  74

Query  65   TNEKEKIHKKNSIANRGYEPLKNQTLEAGTPADLKEGFYAGREYALDSQAVLNKRFNHGP  124
               K  + K  S ANRGYEPL+ Q LEAG PADLKEGFY G E A D   VL  RFNHG 
Sbjct  75   EPGKRALDKLFSKANRGYEPLRGQVLEAGAPADLKEGFYIGEELAEDDPRVLAGRFNHGA  134

Query  125  NQWPEQFPEFESTMQHYQAELEVLAKHLMRGLALSLNLDENYFDDFCQDSLVTLRLLHYP  184
            NQWP +  EF  TM+ Y+  +  LA  LM  +ALSL L E +F  FC+DS+ TLRLLHYP
Sbjct  135  NQWPSELAEFRPTMERYRDAMNALANRLMGAIALSLQLPEEHFAGFCRDSMSTLRLLHYP  194

Query  185  PQPANPEPNEKGCGAHTDFGALTLLLQDQQGGLQVWDKHTESWIDAPPIEGTYVINLGDL  244
            PQPAN  P EKGCGAHTDFG LTLLLQD+  GLQVWD+H++SWI A P+ GTYV+NLGD+
Sbjct  195  PQPANSAPGEKGCGAHTDFGGLTLLLQDENPGLQVWDRHSKSWIHAAPVPGTYVVNLGDM  254

Query  245  IARWTNNHYKSTVHRVINKSGKQRYSVPFFFGGNPDYLVKCLPDCMSESEPSLFVPTTVE  304
            IARWTN+ Y+ST+HRV+N SG++RYSVPFFF GNPD++V+CLP C++  E   +   TVE
Sbjct  255  IARWTNDQYRSTLHRVVNMSGRERYSVPFFFSGNPDHVVECLPTCLAPGEAPRYPAVTVE  314

Query  305  QHHIEMYRRTYG  316
            +HH EMYRRTYG
Sbjct  315  EHHREMYRRTYG  326


> A0A023WR47 Oxidoreductase [Pseudomonas stutzeri]
Length=326

 Score =  409 bits (1050),  Expect = 2e-145
 Identities = 193/312 (62%), Positives = 232/312 (74%), Gaps = 0/312 (0%)

Query  5    IPIISISGLFSPLLEDRLQVAMQMKQACEDNGFFYIADHGVSKNLQQKVFEQSRQFFDLP  64
            +P+I I+GLFSP L +R  VA ++  AC + GFF IA+HGV   LQQ VFEQ+R FF  P
Sbjct  15   LPLIDIAGLFSPDLAERTAVAERIGAACREVGFFCIANHGVDPVLQQAVFEQARAFFAQP  74

Query  65   TNEKEKIHKKNSIANRGYEPLKNQTLEAGTPADLKEGFYAGREYALDSQAVLNKRFNHGP  124
               K  + K  S ANRGYEPL+ Q LEAGTPADLKEGFY G E A D   VL  RFNHG 
Sbjct  75   EASKRALDKAFSKANRGYEPLRGQVLEAGTPADLKEGFYIGEELAEDDPRVLAGRFNHGA  134

Query  125  NQWPEQFPEFESTMQHYQAELEVLAKHLMRGLALSLNLDENYFDDFCQDSLVTLRLLHYP  184
            NQWP +  +F  TM+ Y+ E+  LA  LM  +ALSL L E +F  FC+DS+ TLRLLHYP
Sbjct  135  NQWPAELADFRPTMERYRDEMNALAARLMGAIALSLQLPEEHFAGFCRDSMSTLRLLHYP  194

Query  185  PQPANPEPNEKGCGAHTDFGALTLLLQDQQGGLQVWDKHTESWIDAPPIEGTYVINLGDL  244
            PQPAN  P EKGCGAHTDFG LTLLLQD+  GLQVWD+H++SWI A P+ GTYV+NLGD+
Sbjct  195  PQPANAAPGEKGCGAHTDFGGLTLLLQDENPGLQVWDRHSKSWIHAAPVPGTYVVNLGDM  254

Query  245  IARWTNNHYKSTVHRVINKSGKQRYSVPFFFGGNPDYLVKCLPDCMSESEPSLFVPTTVE  304
            IARWTN+ Y+ST+HRV+N SG++RYSVPFFF GNPD+LV+CLP C++  E   +   TVE
Sbjct  255  IARWTNDQYRSTLHRVVNISGRERYSVPFFFSGNPDHLVECLPTCLAPGEAPRYPAVTVE  314

Query  305  QHHIEMYRRTYG  316
            +HH EMYRRTYG
Sbjct  315  EHHREMYRRTYG  326


> Q9M3R8 Fe2OG dioxygenase domain-containing protein [Arabidopsis 
thaliana]
Length=305

 Score =  206 bits (524),  Expect = 1e-66
 Identities = 121/320 (38%), Positives = 184/320 (58%), Gaps = 27/320 (8%)

Query  5    IPIISISGLFSPLLEDRLQVAMQMKQACEDNGFFYIADHGVSKNLQQKVFEQSRQFFDLP  64
            +PII +S   SP    ++  A  ++QAC ++GFFY+ +HG+S+ L + VF++S+ FF+LP
Sbjct  1    LPIIDLS---SP---GKISTAKLIRQACLEHGFFYVKNHGISEELMEGVFKESKGFFNLP  54

Query  65   TNEKEKIHKKNSIANRGYEPLKNQTLEAGTPA--DLKEGFYAGREYALDSQAVLNKRFNH  122
              EK  + +++ +   GY PL  + L+    +  D KE FY G       + VL +R+  
Sbjct  55   LEEKMALLRRDLL---GYTPLYAEKLDPSLSSIGDSKESFYFG-----SLEGVLAQRY--  104

Query  123  GPNQWPEQ--FPEFESTMQHYQAELEVLAKHLMRGLALSLNLDENYFDDF--CQDSLVTL  178
             PNQWP +   P +  TM+ Y   +  + + L+  +AL+L+LDE++F+      D    +
Sbjct  105  -PNQWPSEGILPSWRQTMETYYKNVLSVGRKLLGLIALALDLDEDFFEKVGALNDPTAVV  163

Query  179  RLLHYPPQPANPEPNEKGCGAHTDFGALTLLLQDQQGGLQVW---DKHTESWIDAPPIEG  235
            RLL YP +  + +    G  AH+D+G +TLLL D   GLQV     K    W D P I+G
Sbjct  164  RLLRYPGEVISSDVETYGASAHSDYGMVTLLLTDGVPGLQVCRDKSKQPHIWEDVPGIKG  223

Query  236  TYVINLGDLIARWTNNHYKSTVHRVINKSGKQRYSVPFFFGGNPDYLVKCLPDCMSESEP  295
             +++N+GD++ RWTN  ++ST+HRV+   GK+RYSV FF   NPD  VKCL  C SE+ P
Sbjct  224  AFIVNIGDMMERWTNGLFRSTLHRVM-PVGKERYSVVFFLDPNPDCNVKCLESCCSETCP  282

Query  296  SLFVPTTVEQHHIEMYRRTY  315
              F P     +  E +R TY
Sbjct  283  PRFPPILAGDYIKERFRLTY  302


> Q9M3R7 AT4g16770 [Arabidopsis thaliana]
Length=315

 Score =  196 bits (497),  Expect = 1e-62
 Identities = 120/319 (38%), Positives = 181/319 (57%), Gaps = 27/319 (8%)

Query  5    IPIISISGLFSPLLEDRLQVAMQMKQACEDNGFFYIADHGVSKNLQQKVFEQSRQFFDLP  64
            +PII +S   SP   ++L  +  ++QAC D+GFFY+ +HGVS+ L + V  +S++ F LP
Sbjct  7    LPIIDLS---SP---EKLSTSRLIRQACLDHGFFYLTNHGVSEELMEGVLIESKKLFSLP  60

Query  65   TNEKEKIHKKNSIANRGYEPLKNQTLEAGTPA--DLKEGFYAGREYALDSQAVLNKRFNH  122
             +EK  + +      RGY PL ++ LE+ + +  D KE F  G      S+ VL + +  
Sbjct  61   LDEKMVMARHGF---RGYSPLYDEKLESSSTSIGDSKEMFTFG-----SSEGVLGQLY--  110

Query  123  GPNQWP--EQFPEFESTMQHYQAELEVLAKHLMRGLALSLNLDENYFDDF--CQDSLVTL  178
             PN+WP  E  P +  TM+ Y   +  + K L   +AL+LNL+ENYF+      D    +
Sbjct  111  -PNKWPLEELLPLWRPTMECYYKNVMDVGKKLFGLVALALNLEENYFEQVGAFNDQAAVV  169

Query  179  RLLHYPPQPANPEPNEKGCGAHTDFGALTLLLQDQQGGLQVW---DKHTESWIDAPPIEG  235
            RLL Y  +  +      G  AH+DFG +TLL  D   GLQV    DK  + W D   I+G
Sbjct  170  RLLRYSGESNSSGEETCGASAHSDFGMITLLATDGVAGLQVCRDKDKEPKVWEDVAGIKG  229

Query  236  TYVINLGDLIARWTNNHYKSTVHRVINKSGKQRYSVPFFFGGNPDYLVKCLPDCMSESEP  295
            T+V+N+GDL+ RWTN  ++ST+HRV++  GK+R+SV  F   +P+ +V+CL  C SE+ P
Sbjct  230  TFVVNIGDLMERWTNGLFRSTLHRVVS-VGKERFSVAVFVDPDPNCVVECLESCCSETSP  288

Query  296  SLFVPTTVEQHHIEMYRRT  314
              F P     +  E + +T
Sbjct  289  PKFPPVRARDYFHERFSQT  307


> Q9LEM4 Fe2OG dioxygenase domain-containing protein [Capsella 
rubella]
Length=315

 Score =  188 bits (477),  Expect = 1e-59
 Identities = 117/319 (37%), Positives = 180/319 (56%), Gaps = 27/319 (8%)

Query  5    IPIISISGLFSPLLEDRLQVAMQMKQACEDNGFFYIADHGVSKNLQQKVFEQSRQFFDLP  64
            +PII +S   SP   ++L  +  ++QAC D+GFFY+ +HGVS+ L + V  +S++ F LP
Sbjct  7    LPIIDLS---SP---EKLSTSSLIRQACLDHGFFYLTNHGVSEELMEGVLMESKKLFSLP  60

Query  65   TNEKEKIHKKNSIANRGYEPLKNQTLEAGTPA--DLKEGFYAGREYALDSQAVLNKRFNH  122
             +EK  + ++     RGY PL  +   + T A  D KE F  G      S+ VL + +  
Sbjct  61   LDEKMVMARRGF---RGYSPLYEEKPHSSTLAKGDSKEMFTFG-----SSEGVLAQIY--  110

Query  123  GPNQWP--EQFPEFESTMQHYQAELEVLAKHLMRGLALSLNLDENYFDDF--CQDSLVTL  178
             PN+WP  E  P +  TM+ Y   +  + K L+  +AL+LNL+EN+F+           +
Sbjct  111  -PNEWPREELLPLWRPTMECYYKTVMDVGKKLLGLVALALNLEENFFEQVGGFNAQAAVV  169

Query  179  RLLHYPPQPANPEPNEKGCGAHTDFGALTLLLQDQQGGLQVW---DKHTESWIDAPPIEG  235
            RLL YP +  +      G  AH+D+G +TLL  D   GLQV    DK  + W D   ++G
Sbjct  170  RLLRYPGELNSSGEVTCGASAHSDYGMITLLATDGVPGLQVCRDKDKEPKVWEDVAGVKG  229

Query  236  TYVINLGDLIARWTNNHYKSTVHRVINKSGKQRYSVPFFFGGNPDYLVKCLPDCMSESEP  295
             +V+N+GDL+ RWTN  ++ST+HRV++  GK+RYSV  F   +P+ +V+CL  C SE+ P
Sbjct  230  AFVVNIGDLMERWTNGLFRSTMHRVVS-VGKERYSVAVFVDPDPNCVVECLESCCSETSP  288

Query  296  SLFVPTTVEQHHIEMYRRT  314
              F P   + +  E + +T
Sbjct  289  PRFPPVRTKDYFHERFSQT  307


> Q9LEM3 Fe2OG dioxygenase domain-containing protein [Capsella 
rubella]
Length=315

 Score =  187 bits (475),  Expect = 2e-59
 Identities = 116/320 (36%), Positives = 181/320 (57%), Gaps = 27/320 (8%)

Query  5    IPIISISGLFSPLLEDRLQVAMQMKQACEDNGFFYIADHGVSKNLQQKVFEQSRQFFDLP  64
            +PII +S   SP   +++  +  ++QAC D+GFFY+ +HGVS+ L + V  +S++ F LP
Sbjct  7    LPIIDLS---SP---EKISTSRLIRQACLDHGFFYLTNHGVSEELMEGVLMESKKLFSLP  60

Query  65   TNEKEKIHKKNSIANRGYEPLKNQTLE--AGTPADLKEGFYAGREYALDSQAVLNKRFNH  122
             +EK  + ++     RGY PL ++ L+  A +  D KE F  G      S+ VL + +  
Sbjct  61   LDEKMVMARRGF---RGYSPLYDEKLDPSATSKGDSKEIFTFG-----SSEGVLAQIY--  110

Query  123  GPNQWP--EQFPEFESTMQHYQAELEVLAKHLMRGLALSLNLDENYFDDF--CQDSLVTL  178
             PN+WP  E  P +  TM+ Y   +  + K L+  +AL+L+L+E +F+           +
Sbjct  111  -PNEWPLEELLPLWRPTMECYYKSVMDVGKKLLGLVALALDLEEKFFEQVEGFNVQAAVV  169

Query  179  RLLHYPPQPANPEPNEKGCGAHTDFGALTLLLQDQQGGLQVW---DKHTESWIDAPPIEG  235
            RLL YP +  +      G  AH+D+G LTLL  D   GLQV    DK    W D   I+G
Sbjct  170  RLLRYPGELNSSGEVTCGASAHSDYGMLTLLATDGVPGLQVCRDKDKEPRVWEDVAGIKG  229

Query  236  TYVINLGDLIARWTNNHYKSTVHRVINKSGKQRYSVPFFFGGNPDYLVKCLPDCMSESEP  295
             +++N+GDL+ RWTN  ++ST+HRV++  GK+RYSV  FF  +P+ +V+CL  C SE+ P
Sbjct  230  AFLVNIGDLMERWTNGLFRSTMHRVVS-VGKERYSVAVFFDPDPNSVVECLESCCSETSP  288

Query  296  SLFVPTTVEQHHIEMYRRTY  315
              F P     +  E + +T+
Sbjct  289  PRFPPIRTRDYFHERFSQTF  308


> A0A2U8U2L3 2-oxoglutarate-dependent dioxygenase asL3 [Sarocladium 
schorii]
Length=340

 Score =  172 bits (435),  Expect = 3e-53
 Identities = 105/301 (35%), Positives = 151/301 (50%), Gaps = 14/301 (5%)

Query  5    IPIISISGLFSPLL--EDRLQVAMQMKQACEDNGFFYIADHGVSKNLQQKVFEQSRQFFD  62
            IP + IS    P    E R  V   M  AC   GFF +A HG+ +   ++ FE ++ FF 
Sbjct  10   IPTVDISAFLDPNASQEARQDVVNAMSNACHVYGFFNLAGHGIPQETLREAFELNKMFFA  69

Query  63   LPTNEKEKIHKKNSIAN--RGYEPLKNQTLEAGTPADLKEGFYAGREYALDSQAVLNKRF  120
            LP   K+++    SI    RGYEP   QT   G   D+KE F  GRE  LD        F
Sbjct  70   LPEESKKEVLISKSIGQSFRGYEPPGIQTHHKGLLPDIKETFMVGREVPLDDPDC--GTF  127

Query  121  NHGPNQWPEQFPE--FESTMQHYQAELEVLAKHLM----RGLALSLNLDENYFDDFCQDS  174
            + GPN WP   P+  F+  +  YQ  +  L K+++    +GL          F+      
Sbjct  128  STGPNLWPSSLPKEKFQDRIMAYQGSMLELVKNILAILAQGLPKEWGCSPTVFNSLLDKP  187

Query  175  LVTLRLLHYPPQPANPEP-NEKGCGAHTDFGALTLLLQDQ-QGGLQVWDKHTESWIDAPP  232
             + +R LHY P P+  E   + G   HTDFG +++LLQ+    GL+V+   ++SWI  P 
Sbjct  188  SIPMRFLHYAPVPSQLEDVRQFGVADHTDFGCVSILLQEPGTSGLEVYYPPSDSWIPVPV  247

Query  233  IEGTYVINLGDLIARWTNNHYKSTVHRVINKSGKQRYSVPFFFGGNPDYLVKCLPDCMSE  292
            I+  +VIN+GD++ R+T  +Y+S  HRV+    K R+SV FF  GN     K L    +E
Sbjct  248  IDDGFVINMGDMMQRYTGGYYRSARHRVLTNREKHRHSVAFFLNGNLGLKAKALDGSETE  307

Query  293  S  293
            +
Sbjct  308  T  308


> A3QRM2 Senescence-associated nodulin 1B [Glycine max]
Length=353

 Score =  162 bits (409),  Expect = 2e-49
 Identities = 105/306 (34%), Positives = 161/306 (53%), Gaps = 16/306 (5%)

Query  3    QHIPIISISGLFSPLLEDRLQVAMQMKQ---ACEDNGFFYIADHGVSKNLQQKVFEQSRQ  59
            +HIPII +S + +  +     +   +K+   AC++ GFF + +HGVS  L+Q + + S+ 
Sbjct  24   EHIPIIDLSPITNHTVSHPSPIEGLVKEIGNACKEWGFFQVINHGVSLTLRQNIEKASKL  83

Query  60   FFDLPTNEKEKIHKKNSIANRGYEPLKNQTLEAGTPADLKEGF-YAGRE--YALDSQAVL  116
            FF     EK K+ +  S     Y+    + +      D KE F +  ++  +   +    
Sbjct  84   FFAQSLEEKRKVSRDESSPMGYYDTEHTKNIR-----DWKEVFDFLAKDPTFVPLTSDEH  138

Query  117  NKRFNHGPNQWPEQFPEFESTMQHYQAELEVLAKHLMRGLALSLNLDENYFDDF-CQDSL  175
            + R     N  P+  P F   ++ Y  E+E L+  LM  +AL+L L+   F++F  +D  
Sbjct  139  DNRLTQWTNPSPQYPPHFRDIIKEYVEEMEKLSFKLMELIALNLGLEAKRFEEFFIKDQT  198

Query  176  VTLRLLHYPPQPANPEPN-EKGCGAHTDFGALTLLLQDQQGGLQVWDKHTESWIDAPPIE  234
              LRL +YPP P    P+   G G H D G LT+L QD+ GGL+V  K  + WI   PI 
Sbjct  199  SFLRLNYYPPCPY---PHLALGVGRHKDSGPLTILAQDEVGGLEVRPKADQDWIRVKPIP  255

Query  235  GTYVINLGDLIARWTNNHYKSTVHRVINKSGKQRYSVPFFFGGNPDYLVKCLPDCMSESE  294
              Y+INLGD+I  W+N+ Y+S  HRV+  S K R+S+PFF     D +VK L + ++E  
Sbjct  256  NAYIINLGDMIQVWSNDAYESVEHRVVVNSEKARFSIPFFLFPAHDTVVKPLEELINEQN  315

Query  295  PSLFVP  300
            PS F P
Sbjct  316  PSKFRP  321


> A3QRM3 Senescence-associated nodulin 1A [Glycine max]
Length=352

 Score =  160 bits (406),  Expect = 6e-49
 Identities = 105/304 (35%), Positives = 159/304 (52%), Gaps = 16/304 (5%)

Query  5    IPIISISGLFSPLLEDRLQVAMQMKQ---ACEDNGFFYIADHGVSKNLQQKVFEQSRQFF  61
            IPII +S + +  + D   +   +K+   AC++ GFF + +HGV   L+Q + + S+ FF
Sbjct  26   IPIIDLSPITNHTVSDPSAIESLVKEIGRACQEWGFFQVTNHGVPLTLRQNIEKASKLFF  85

Query  62   DLPTNEKEKIHKKNSIANRGYEPLKNQTLEAGTPADLKEGF-YAGRE--YALDSQAVLNK  118
                 EK K+ +  S     Y+    + +      D KE F +  ++  +   +    + 
Sbjct  86   AQTLEEKRKVSRNESSPMGYYDTEHTKNVR-----DWKEVFDFLAKDPTFIPLTSDEHDD  140

Query  119  RFNHGPNQWPEQFPEFESTMQHYQAELEVLAKHLMRGLALSLNLDENYFDDF-CQDSLVT  177
            R N   NQ P+  P F    Q Y  E+E L+  L+  +ALSL L+   F++F  +D    
Sbjct  141  RVNQWTNQSPQYPPLFRVVTQEYIQEMEKLSFKLLELIALSLGLEAKRFEEFFIKDQTSF  200

Query  178  LRLLHYPPQPANPEPN-EKGCGAHTDFGALTLLLQDQQGGLQVWDKHTESWIDAPPIEGT  236
            +RL HYPP P    P+   G G H D GALT+L QD+ GGL+V  K  + WI   P    
Sbjct  201  IRLNHYPPCPY---PDLALGVGRHKDPGALTILAQDEVGGLEVRRKRDQEWIRVKPTPNA  257

Query  237  YVINLGDLIARWTNNHYKSTVHRVINKSGKQRYSVPFFFGGNPDYLVKCLPDCMSESEPS  296
            Y+IN+GD +  W+N+ Y+S  HRV+  S K+R S+PFFF    D  VK L + ++E  PS
Sbjct  258  YIINIGDTVQVWSNDAYESVDHRVVVNSEKERLSIPFFFFPAHDTKVKPLEELINEQNPS  317

Query  297  LFVP  300
             + P
Sbjct  318  KYRP  321


> Q7RYZ9 Thymine dioxygenase [Neurospora crassa (strain ATCC 24698 
/ 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)]
Length=333

 Score =  159 bits (401),  Expect = 2e-48
 Identities = 101/306 (33%), Positives = 156/306 (51%), Gaps = 36/306 (12%)

Query  5    IPIISISGLFSPLLEDRLQVAMQMKQACEDNGFFYIADHGVSKNLQQKVFEQSRQFFDLP  64
            IP+I  S         +L+ A  +    +  GF Y+ +  +  + ++ VF  S +FF LP
Sbjct  13   IPLIDFSKFLEGDETLKLETAKAILHGFQTAGFIYLKNIPIQPDFREHVFNTSAKFFKLP  72

Query  65   TNEKEKIHKKNSIANRGY------------EPLKNQTLEAGTPADLKEGFYAGREYALDS  112
              +K ++      ANRGY            +P + + + +  P D+KE +  GRE     
Sbjct  73   KEKKLEVGWTTPEANRGYSAPGREKVTQLTDPAEIEKIRSAAP-DIKESYEIGRE-----  126

Query  113  QAVLNKRFNHGPNQWPEQFPE---FESTMQHYQAELEVLAKHLMRGLALSLNLDENYFDD  169
                     H PN WP +  +   F+STM ++  + + L   +MR +A+ + +D NYFD 
Sbjct  127  -----DEPGH-PNPWPAEQDDLVGFKSTMNNFFDQCKALHIEVMRAIAVGMGIDANYFDS  180

Query  170  FCQDSLVTLRLLHYPPQPANP---EPNEKGCGAHTDFGALTLLLQDQQGGLQVWDKHTES  226
            F       LRLLHYP   +      P +   G HTD+G++TLL QD +GGLQV   + + 
Sbjct  181  FVDVGDNILRLLHYPAVKSEVFKINPGQVRAGEHTDYGSITLLFQDSRGGLQVKSPNGQ-  239

Query  227  WIDAPPIEGTYVINLGDLIARWTNNHYKSTVHRVINKSGKQ-----RYSVPFFFGGNPDY  281
            +IDA PIE T V+N GDL+ARW+N+  KSTVHRV+    ++     RYS+ +F   N   
Sbjct  240  FIDATPIENTVVVNAGDLLARWSNDTIKSTVHRVVEPPKQEDVHPPRYSIAYFCNPNHKS  299

Query  282  LVKCLP  287
             ++ +P
Sbjct  300  YIEAIP  305


> C5I496 Thymine dioxygenase [Rhodotorula glutinis]
Length=331

 Score =  154 bits (388),  Expect = 2e-46
 Identities = 108/332 (33%), Positives = 173/332 (52%), Gaps = 31/332 (9%)

Query  5    IPIISISGLFSPLLEDRLQVAMQMKQACEDNGFFYIA--DHGVSKNLQQKVFEQSRQFFD  62
            +P+I+     S   ED+L  A ++ +A ++ GF  +   D  V K    + F++++QFFD
Sbjct  7    VPVINFEPFLSGTPEDKLATAQELLKAAKEVGFLMLCNVDAVVDKATVAEAFKKTQQFFD  66

Query  63   LPTNEKEKIHKKNSIANRGY--EPLKNQTLEAGTPADLKEGFYAGREYALDSQAVLN--K  118
            LP   KE++  + + +NRGY  E  +  T E    A  K      R+ A D +  +   K
Sbjct  67   LPMEVKERLEWECAESNRGYVAEGRERVTQETDPEAIAKL-----RQQAPDFKETMEIGK  121

Query  119  RFNHGP------NQWPE-QFPEFESTMQHYQAELEVLAKHLMRGLALSLNLDENYFDDFC  171
             +  GP      N+WPE +FP+F++ M  +  +   L   +MR LAL++ + E++FDD  
Sbjct  122  DYREGPDDSPFENRWPEAEFPDFKAFMNDFFEKNHQLHLEIMRALALAMGIGESFFDDKV  181

Query  172  QDSLVTLRLLHYPP-QPANPEPNEKGCGAHTDFGALTLLLQDQQGGLQVWDKHTESWIDA  230
                  LRLL+YPP + A         GAH+D+G++TLL QD  GGL+V DK    ++ A
Sbjct  182  AQRSHNLRLLNYPPIEKAKILNGGNRAGAHSDYGSVTLLWQDGVGGLEVQDK-DGVFVPA  240

Query  231  PPIEGTYVINLGDLIARWTNNHYKSTVHRVINKSG-------KQRYSVPFFFGGNPDYLV  283
             P+  T V+N+GDL+ RW+N+  KST+HRV+  +         +R S+ FF   +   ++
Sbjct  241  RPVADTVVVNVGDLLQRWSNDVLKSTIHRVVLPADGDPLEMTPRRNSIAFFSNPSLRTVI  300

Query  284  KCLPDCMSESEPSLFVPTTVEQHHIEMYRRTY  315
              LP      EP  + P   E + ++    TY
Sbjct  301  SALP---GTGEPK-YEPVETEAYLVKRLSETY  328


> A0A1X9PXY3 2-oxoglutarate/FeII oxygenase [Phyllosticta cirsii]
Length=322

 Score =  151 bits (382),  Expect = 1e-45
 Identities = 101/280 (36%), Positives = 141/280 (50%), Gaps = 15/280 (5%)

Query  5    IPIISISG-LFSPLLEDRLQVAMQMKQACEDNGFFYIADHGVSKNLQQKVFEQSRQFFDL  63
            +PII +S  L S   ED+ +V  Q++ A    GFF I  HG+  NLQ+ + +     FDL
Sbjct  10   LPIIDLSPYLNSTKREDKDKVITQVRDAARQYGFFQIRGHGIPVNLQRDLVKAMDHVFDL  69

Query  64   PTNEKEKIHKKNSIANRGYEPLKNQTLEAGTPA-DLKEGFYAGREYALDSQAVLNKRFNH  122
            P  EK  +    +   RGYE  +  +   G P  D KE F+ G+E A    A        
Sbjct  70   PEEEKLSMSFLENPCRRGYEA-QGMSHRVGDPLPDAKECFFIGQEDATVEAAGF-----F  123

Query  123  GPNQWPEQFPEFE---STMQHYQAELEVLAKHLMRGLALSLNLDENYFDDFCQDSLVTLR  179
            GPN WP   P+        +HYQ   E L K +   L   L    +  D F +  +V ++
Sbjct  124  GPNVWPS-LPDASFRTPVWEHYQKTRE-LGKTIWTILIEGLGQSASLIDAFAKRPVVPMK  181

Query  180  LLHYPPQPANPEPNEKGCGAHTDFGALTLLLQD-QQGGLQVWDKHTESWIDAPPIEGTYV  238
            ++ YPP     E  + G GAHTDFG +T+L Q   + GL+VW +  + WI+ P  E  YV
Sbjct  182  MIRYPPHSTARE-GQFGIGAHTDFGGVTILFQQPSKDGLEVWHEGKQDWIEVPAQEDVYV  240

Query  239  INLGDLIARWTNNHYKSTVHRVINKSGKQRYSVPFFFGGN  278
            IN GD++ RW+   YKS  HRVINK   +R S   F+ G+
Sbjct  241  INCGDMVERWSGGTYKSARHRVINKVQGKRLSCATFWHGD  280



Lambda      K        H        a         alpha
   0.320    0.137    0.425    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1696976


  Database: 021397cc2c407b864583220cf11f9e76.TrEMBL.fasta
    Posted date:  Sep 21, 2020  5:59 AM
  Number of letters in database: 7,459
  Number of sequences in database:  23



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40