ACIAD0764 / SwissProt Alignments

BLASTP 2.2.28+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: 0f03bf4e51c8e6f247cc014f4efa0b50.SwissProt.fasta
           15 sequences; 5,251 total letters



Query= ACIAD0764

Length=317
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  C8VK14 2-oxoglutarate-Fe(II) type oxidoreductase hxnY [Emericel...   291    2e-99
  Q4W946 2-oxoglutarate-Fe(II) type oxidoreductase [Neosartorya f...   270    2e-91
  Q1ERI0 2-oxoglutarate-dependent dioxygenase mpl2 [Monascus purp...   219    2e-71
  A0A159BP93 2-oxoglutarate-dependent dioxygenase citB [Monascus ...   219    2e-71
  B8M9K5 2-oxoglutarate-dependent dioxygenase tropC [Talaromyces ...   184    4e-58
  Q76NT9 1-aminocyclopropane-1-carboxylate oxidase [Dictyostelium...   169    6e-52
  A6BM06 1-aminocyclopropane-1-carboxylate oxidase [Dictyostelium...   169    6e-52
  Q84MB6 Probable 2-oxoglutarate-dependent dioxygenase At3g50210 ...   167    1e-51
  P40902 Sexual differentiation process protein isp7 [Schizosacch...   166    8e-51
  Q54RA4 Probable iron/ascorbate oxidoreductase DDB_G0283291 [Dic...   157    1e-47
  Q8H113 Probable 2-oxoglutarate-dependent dioxygenase DIN11 [Ara...   156    2e-47
  F4IY03 Probable 2-oxoglutarate-dependent dioxygenase At3g49630 ...   151    1e-45
  Q9FFF6 Probable 2-oxoglutarate-dependent dioxygenase At5g05600 ...   135    2e-39
  K0DZA0 2-oxoglutarate-dependent dioxygenase htyE [Aspergillus r...   133    5e-39
  Q15JG7 Validamycin A dioxygenase [Streptomyces hygroscopicus su...   128    4e-37


> C8VK14 2-oxoglutarate-Fe(II) type oxidoreductase hxnY [Emericella 
nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 
194 / M139)]
Length=349

 Score =  291 bits (745),  Expect = 2e-99
 Identities = 142/316 (45%), Positives = 202/316 (64%), Gaps = 6/316 (2%)

Query  6    PIISISGLFSPLLEDRLQVAMQMKQACEDNGFFYIADHGVSKNLQQKVFEQSRQFFDLPT  65
            PI+  S  +      + ++  Q++++CE NGFF I  H + + LQ +V + +++FF LP 
Sbjct  7    PILDFSPFYGTDGAAKAKLVQQVRESCEYNGFFQITGHRIPRELQVRVMDAAKRFFALPL  66

Query  66   NEKEKIHKKNSIANRGYEPLKNQTLEAGTPADLKEGFYAGREYALDSQAVLNKRFNHGPN  125
             EK  I K  +  NRGYE L++Q LE GT  +LKEG Y G E   D    +N R N GPN
Sbjct  67   EEKMAIDKNLNSFNRGYELLRSQMLEVGTAPELKEGLYIGEEIGADHPYYINGRLNSGPN  126

Query  126  QWPEQFPEF----ESTMQHYQAELEVLAKHLMRGLALSLNLDENYFDDFCQDSLVTLRLL  181
            QWP   P+     E++M++Y A  E LAK ++  LAL+L+++E++FD   +  + T+R+L
Sbjct  127  QWPATVPDAQEFRETSMEYYHAVYE-LAKDVLAVLALTLDVEESFFDPLTEGGVATMRML  185

Query  182  HYPPQPANPEPN-EKGCGAHTDFGALTLLLQDQQGGLQVWDKHTESWIDAPPIEGTYVIN  240
            HYP QP + +    +G GAHTDFG +TLLLQD+  GLQV D  +  W+D  P+ G YV+N
Sbjct  186  HYPSQPKDEDEKLNRGIGAHTDFGCITLLLQDEVDGLQVLDAPSGQWLDVQPVLGAYVVN  245

Query  241  LGDLIARWTNNHYKSTVHRVINKSGKQRYSVPFFFGGNPDYLVKCLPDCMSESEPSLFVP  300
            LGDL+ R  N+ YKS +HRVINKSG++RYS+PFFF GNPD++ KCLP+C    E   + P
Sbjct  246  LGDLMMRMANDRYKSNIHRVINKSGRERYSIPFFFSGNPDHVCKCLPNCCKAGEQPKYPP  305

Query  301  TTVEQHHIEMYRRTYG  316
             TVE      Y+++YG
Sbjct  306  ITVEDMVRGAYKQSYG  321


> Q4W946 2-oxoglutarate-Fe(II) type oxidoreductase [Neosartorya 
fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC 
A1100)]
Length=337

 Score =  270 bits (691),  Expect = 2e-91
 Identities = 132/312 (42%), Positives = 187/312 (60%), Gaps = 3/312 (1%)

Query  6    PIISISGLFSPLLEDRLQVAMQMKQACEDNGFFYIADHGVSKNLQQKVFEQSRQFFDLPT  65
            PI+  S  +    + + Q+  ++++ C +NGFF I  H VS  LQ++ F+ +++FFDLP 
Sbjct  8    PILDFSVFYGHDSQAKAQLVQRVRECCLNNGFFQITGHKVSPELQRRTFDCAKRFFDLPL  67

Query  66   NEKEKIHKKNSIANRGYEPLKNQTLEAGTPADLKEGFYAGREYALDSQAVLNKRFNHGPN  125
             EK+KI +     NRGYE  ++   + G+  D KEG + G + A D    + K+ N GPN
Sbjct  68   IEKKKIERSPDAFNRGYEAFQSHMSQPGSAPDRKEGLFLGPDLAEDHPYCVQKKLNCGPN  127

Query  126  QWPE---QFPEFESTMQHYQAELEVLAKHLMRGLALSLNLDENYFDDFCQDSLVTLRLLH  182
            +WP+      EF+     Y A L  LAK ++  LAL+++ +E +FD   + ++ TLR LH
Sbjct  128  RWPQGLDDLEEFKLVSMEYYAALFQLAKDVVAVLALTMDYEETFFDPLTEGAIATLRYLH  187

Query  183  YPPQPANPEPNEKGCGAHTDFGALTLLLQDQQGGLQVWDKHTESWIDAPPIEGTYVINLG  242
            YPPQP        G GAH D+  +TLLLQD  GGLQV D+ T  W+D  P+ G Y++NL 
Sbjct  188  YPPQPVGDAEAGLGTGAHRDYSCITLLLQDGTGGLQVLDEPTGQWLDVKPVPGAYIVNLA  247

Query  243  DLIARWTNNHYKSTVHRVINKSGKQRYSVPFFFGGNPDYLVKCLPDCMSESEPSLFVPTT  302
            ++ AR TN HYKS +HRV+NKSG +RYS+PFFF GNPDY+ +CL     E EP    P T
Sbjct  248  NVFARMTNGHYKSALHRVVNKSGMERYSIPFFFTGNPDYVCECLSRFRKEGEPVRHPPAT  307

Query  303  VEQHHIEMYRRT  314
            V +   E  R T
Sbjct  308  VHEVVAEAVRGT  319


> Q1ERI0 2-oxoglutarate-dependent dioxygenase mpl2 [Monascus purpureus]
Length=329

 Score =  219 bits (557),  Expect = 2e-71
 Identities = 131/322 (41%), Positives = 184/322 (57%), Gaps = 17/322 (5%)

Query  4    HIPIISISG-LFSPLLEDRLQVAMQMKQACEDNGFFYIADHGVSKNLQQKVFEQSRQFFD  62
            ++P + IS  L  P  +   +V   ++ AC   GFF +  HG+S  LQQ VF  + +FF 
Sbjct  10   YLPAVDISPYLQDPNSDAARKVIDDVRAACTSTGFFQLLGHGISPALQQSVFAAAAKFFA  69

Query  63   LPTNEKEKIHKKNSIANRGYEPLKNQTLEAGTPADLKEGFYAGREYALDSQAVLNKRFNH  122
            LP++ K +     ++  RGY+P+ +Q+ E G   DLKEGF AG++  LD   V ++RF  
Sbjct  70   LPSDVKSRCR---NVGFRGYDPMASQSYELGVLPDLKEGFIAGKDIPLDDPRVASQRFFM  126

Query  123  GPNQWP--EQFPE--FESTMQHYQAELEVLAKHLMRGLALSLNLDENYFDDFCQ-DSLVT  177
            G N WP  E  PE  F   ++ Y   +  L   ++  +A +L    + FD+F + D    
Sbjct  127  GQNAWPPSELLPEANFRRPIEEYYQAMLKLCWVVLDLVAATLPYGPHVFDEFKENDPACP  186

Query  178  LRLLHYPPQPANP--EPNEKGCGAHTDFGALTLLLQDQQGGLQVWDKHTESWIDAPPIEG  235
            LRLLHYPP PA    +  + G  AHTDFGA+TLLLQD   GL+V D  T  WI  PP + 
Sbjct  187  LRLLHYPPAPAPDVAKGRQLGSSAHTDFGAITLLLQDDHSGLEVQDCETGEWIGVPPNKD  246

Query  236  TYVINLGDLIARWTNNHYKSTVHRVINKSGKQRYSVPFFFGGNPDYLVKCLPDCMS--ES  293
             YV+NLGD+++R T  HYKS++HRVIN++   RYSV FFF GN DY ++ L       + 
Sbjct  247  AYVVNLGDMMSRITRGHYKSSIHRVINQNLTDRYSVVFFFDGNLDYRLRPLDRVGQNWDE  306

Query  294  EPSLFVPTTVEQHHIEMYRRTY  315
            E +L    TVE+H +E    TY
Sbjct  307  EDTL----TVEEHMLERTTTTY  324


> A0A159BP93 2-oxoglutarate-dependent dioxygenase citB [Monascus 
ruber]
Length=329

 Score =  219 bits (557),  Expect = 2e-71
 Identities = 131/322 (41%), Positives = 184/322 (57%), Gaps = 17/322 (5%)

Query  4    HIPIISISG-LFSPLLEDRLQVAMQMKQACEDNGFFYIADHGVSKNLQQKVFEQSRQFFD  62
            ++P + IS  L  P  +   +V   ++ AC   GFF +  HG+S  LQQ VF  + +FF 
Sbjct  10   YLPAVDISPYLQDPNSDAARKVIDDVRAACTSTGFFQLLGHGISPALQQSVFAAAAKFFA  69

Query  63   LPTNEKEKIHKKNSIANRGYEPLKNQTLEAGTPADLKEGFYAGREYALDSQAVLNKRFNH  122
            LP++ K +     ++  RGY+P+ +Q+ E G   DLKEGF AG++  LD   V ++RF  
Sbjct  70   LPSDVKSRCR---NVGFRGYDPMASQSYELGVLPDLKEGFIAGKDIPLDDPRVASQRFFM  126

Query  123  GPNQWP--EQFPE--FESTMQHYQAELEVLAKHLMRGLALSLNLDENYFDDFCQ-DSLVT  177
            G N WP  E  PE  F   ++ Y   +  L   ++  +A +L    + FD+F + D    
Sbjct  127  GQNAWPPSELLPEANFRRPIEEYYQAMLKLCWVVLDLVAATLPYGPHVFDEFKENDPACP  186

Query  178  LRLLHYPPQPANP--EPNEKGCGAHTDFGALTLLLQDQQGGLQVWDKHTESWIDAPPIEG  235
            LRLLHYPP PA    +  + G  AHTDFGA+TLLLQD   GL+V D  T  WI  PP + 
Sbjct  187  LRLLHYPPAPAPDVAKGRQLGSSAHTDFGAITLLLQDDHSGLEVQDCETGEWIGVPPNKD  246

Query  236  TYVINLGDLIARWTNNHYKSTVHRVINKSGKQRYSVPFFFGGNPDYLVKCLPDCMS--ES  293
             YV+NLGD+++R T  HYKS++HRVIN++   RYSV FFF GN DY ++ L       + 
Sbjct  247  AYVVNLGDMMSRITRGHYKSSIHRVINQNLTDRYSVVFFFDGNLDYRLRPLDRVGQNWDE  306

Query  294  EPSLFVPTTVEQHHIEMYRRTY  315
            E +L    TVE+H +E    TY
Sbjct  307  EDTL----TVEEHMLERTTTTY  324


> B8M9K5 2-oxoglutarate-dependent dioxygenase tropC [Talaromyces 
stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 
1006)]
Length=325

 Score =  184 bits (466),  Expect = 4e-58
 Identities = 114/294 (39%), Positives = 160/294 (54%), Gaps = 17/294 (6%)

Query  5    IPIISISGLFSPLL--EDRLQVAMQMKQACEDNGFFYIADHGVSKNLQQKVFEQSRQFFD  62
            IP + IS   S     E + +V  +++ AC   GFF +  HG+    ++K+F  +++FFD
Sbjct  8    IPTVDISAWLSSTASPESKNKVVEEVRSACNKYGFFNLVGHGIPAEAREKIFGCTKKFFD  67

Query  63   LPTNEKEKIHKKNSIAN--RGYEPLKNQTLEAGTPADLKEGFYAGREYALDSQAVLNKRF  120
            LP  EK KI    S+    RGYEP   QT + G   D KE F  G E   D       +F
Sbjct  68   LPLEEKMKISVDKSLGKSFRGYEPSLIQTHQDGLLPDTKECFITGAEIPADHPDA--GKF  125

Query  121  NHGPNQWPEQFP--EFESTMQHYQAELEVLAKHLMRGLALSLNLDENYFDDFCQDSLVT-  177
            + GPN WPE     EF   +  Y+A +  L   ++R L   ++    +  D   D L+  
Sbjct  126  STGPNLWPEGLSDKEFRQPVMEYRALMLDLVSTIVRILGQGIHKAFGHPSDVLNDILINP  185

Query  178  ---LRLLHYPPQPANPEPNEKGCGAHTDFGALTLLLQDQQG--GLQVWDKHTESWIDAPP  232
               +RLLHY PQ  NP+P + G G HTDFG +++LLQ Q+G  GL+VW    E+WI  P 
Sbjct  186  SIPMRLLHYAPQE-NPDPRQFGVGDHTDFGCVSILLQ-QKGTKGLEVWYPPKETWIPVPV  243

Query  233  IEGTYVINLGDLIARWTNNHYKSTVHRVINKSGKQRYSVPFFFGGNPDYLVKCL  286
            IE  +VIN+GD + RWT  +Y+S  HRV   +G++RYSV FF  GN +  +K L
Sbjct  244  IEDAFVINMGDTMHRWTGGYYRSARHRVY-ITGERRYSVAFFLNGNLNLKIKPL  296


> Q76NT9 1-aminocyclopropane-1-carboxylate oxidase [Dictyostelium 
discoideum]
Length=368

 Score =  169 bits (427),  Expect = 6e-52
 Identities = 117/347 (34%), Positives = 179/347 (52%), Gaps = 40/347 (12%)

Query  3    QHIPIISISGLFSPLLEDRLQVAMQMKQACEDNGFFYIADHGVSKNLQQKVFEQSRQFFD  62
            + +PII IS  F     D+ QVA ++ +AC++ GFFYI +HGV + L + +    ++FF 
Sbjct  6    EKLPIIDISS-FQNNENDKNQVAKEINKACKEYGFFYIKNHGVDQELIENLQNVIKKFFS  64

Query  63   LPTNEKEKIHKKNSIANRGYEPL--KNQTLEAGTPADLKEGFYAGREYALDSQAVLNKRF  120
            LP   K K   K  + NR +       Q +  G   D KEG Y   E   D   + N   
Sbjct  65   LPLEIKMKW--KMGLTNREWLGFFKVGQEITYGQ-VDWKEGCYYSSEMDGDINTIHNVPL  121

Query  121  NHGPNQWPE-QFPEFESTMQHYQAELEVLAKHLMRGLALSLNLDENYF-DDFCQDSLVTL  178
                 Q  + +   F+ST+  Y  +L  L++ ++  ++LSLNL ++YF  ++  D  + +
Sbjct  122  YPTAEQEEQYEIQGFKSTIHTYIEKLTHLSQQIIEAISLSLNLPQDYFFKNYTYDPFILM  181

Query  179  RLLHYP-----------------------PQP---ANPEPNEKGCGAHTDFGALTLLLQD  212
             LLHYP                       P P     PE  + G G HTD+G LT+L QD
Sbjct  182  GLLHYPSFHHQEQEEEQEDDESNNGGKKSPNPDESKKPEVEKFGTGQHTDWGLLTVLYQD  241

Query  213  QQGGLQVWDKHTESWIDAPPIEGTYVINLGDLIARWTNNHYKSTVHRV-INKSGKQRYSV  271
              GGLQV  K++E +IDAPPI GT++ N+GD++ + T  +Y S +HRV  NKSG+ R+S+
Sbjct  242  DVGGLQVKSKNSEEYIDAPPIPGTFICNIGDMLDKMTGGYYLSNLHRVKYNKSGRDRFSI  301

Query  272  PFFFGGNPDYLVKCLP--DCMSESEPSLFVPTTVEQHHIEMYRRTYG  316
            PFF   + + + K +P  D +S+       P   ++ +I  +  TYG
Sbjct  302  PFFLDPSLNSIPKLIPNYDQLSQFADK---PERWDKQNIHEFDGTYG  345


> A6BM06 1-aminocyclopropane-1-carboxylate oxidase [Dictyostelium 
mucoroides]
Length=368

 Score =  169 bits (427),  Expect = 6e-52
 Identities = 117/347 (34%), Positives = 179/347 (52%), Gaps = 40/347 (12%)

Query  3    QHIPIISISGLFSPLLEDRLQVAMQMKQACEDNGFFYIADHGVSKNLQQKVFEQSRQFFD  62
            + +PII IS  F     D+ QVA ++ +AC++ GFFYI +HGV + L + +    ++FF 
Sbjct  6    EKLPIIDISS-FQNNENDKNQVAKEINKACKEYGFFYIKNHGVDQELIENLQNVIKKFFS  64

Query  63   LPTNEKEKIHKKNSIANRGYEPL--KNQTLEAGTPADLKEGFYAGREYALDSQAVLNKRF  120
            LP   K K   K  + NR +       Q +  G   D KEG Y   E   D   + N   
Sbjct  65   LPLEIKMKW--KMGLTNREWLGFFKVGQEITYGQ-VDWKEGCYYSSEMDGDINTIHNVPL  121

Query  121  NHGPNQWPE-QFPEFESTMQHYQAELEVLAKHLMRGLALSLNLDENYF-DDFCQDSLVTL  178
                 Q  + +   F+ST+  Y  +L  L++ ++  ++LSLNL ++YF  ++  D  + +
Sbjct  122  YPTAEQEEQYEIQGFKSTIHTYIEKLTHLSQQIIEAISLSLNLPQDYFFKNYTYDPFILM  181

Query  179  RLLHYP-----------------------PQP---ANPEPNEKGCGAHTDFGALTLLLQD  212
             LLHYP                       P P     PE  + G G HTD+G LT+L QD
Sbjct  182  GLLHYPSFHHQEQEEEQEDDESNNGGKKSPNPDESKKPEVEKFGTGQHTDWGLLTVLYQD  241

Query  213  QQGGLQVWDKHTESWIDAPPIEGTYVINLGDLIARWTNNHYKSTVHRV-INKSGKQRYSV  271
              GGLQV  K++E +IDAPPI GT++ N+GD++ + T  +Y S +HRV  NKSG+ R+S+
Sbjct  242  DVGGLQVKSKNSEEYIDAPPIPGTFICNIGDMLDKMTGGYYLSNLHRVKYNKSGRDRFSI  301

Query  272  PFFFGGNPDYLVKCLP--DCMSESEPSLFVPTTVEQHHIEMYRRTYG  316
            PFF   + + + K +P  D +S+       P   ++ +I  +  TYG
Sbjct  302  PFFLDPSLNSIPKLIPNYDQLSQFADK---PERWDKQNIHEFDGTYG  345


> Q84MB6 Probable 2-oxoglutarate-dependent dioxygenase At3g50210 
[Arabidopsis thaliana]
Length=332

 Score =  167 bits (423),  Expect = 1e-51
 Identities = 112/296 (38%), Positives = 163/296 (55%), Gaps = 15/296 (5%)

Query  5    IPIISISGLF-----SPLLEDR--LQVAMQMKQACEDNGFFYIADHGVSKNLQQKVFEQS  57
            +P+I IS L        + ED    +V  Q+ +AC D GFFY+  HG+S+++  KV E +
Sbjct  8    LPVIDISRLLLKCDDPDMAEDVGVAEVVQQLDKACRDAGFFYVIGHGISEDVINKVREIT  67

Query  58   RQFFDLPTNEKEKIHKKNSIANRGYEPLKNQTLEAGTPADLKEGFYAGREYALDSQAVLN  117
            R+FF LP  EK KI    +   RGY+ +  + +  G P D+ E     RE        + 
Sbjct  68   REFFKLPYEEKLKIKMTPAAGYRGYQRI-GENVTKGIP-DIHEAIDCYREIKQGKYGDIG  125

Query  118  KRFNHGPNQWPEQFPEFESTMQHYQAELEVLAKHLMRGLALSLNLDENYFDD-FCQDSLV  176
            K    GPNQWPE   EF+  M+ Y      L++ ++RG++L+L      F+     D   
Sbjct  126  KVME-GPNQWPENPQEFKELMEEYIKLCTDLSRKILRGISLALAGSPYEFEGKMAGDPFW  184

Query  177  TLRLLHYP-PQPANPEP-NEKGCGAHTDFGALTLLLQDQ-QGGLQVWDKHTESWIDAPPI  233
             +RL+ YP  +  N +P N+ GCGAHTD+G LTL+ QD  +  LQV +   E WI A PI
Sbjct  185  VMRLIGYPGAEFTNGQPENDIGCGAHTDYGLLTLVNQDDDKTALQVRNLGGE-WISAIPI  243

Query  234  EGTYVINLGDLIARWTNNHYKSTVHRVINKSGKQRYSVPFFFGGNPDYLVKCLPDC  289
             G++V N+GD++   +N  Y+ST+HRVIN S + R  V FF+  N D +V+ L  C
Sbjct  244  PGSFVCNIGDMLKILSNGVYESTLHRVINNSPQYRVCVAFFYETNFDAVVEPLDIC  299


> P40902 Sexual differentiation process protein isp7 [Schizosaccharomyces 
pombe (strain 972 / ATCC 24843)]
Length=397

 Score =  166 bits (421),  Expect = 8e-51
 Identities = 112/355 (32%), Positives = 162/355 (46%), Gaps = 72/355 (20%)

Query  23   QVAMQMKQACEDNGFFYIADHGVSKNLQQKVFEQSRQFFDLPTNEKEKIHKKNSIANRGY  82
            ++  Q++ ACE  GFF I +  +S ++ +  F  S+QFF+LP +EK  +  K+  +NRGY
Sbjct  43   RIIQQLRAACESTGFFQIVNSPISPDVVKNAFRASKQFFELPFDEKLTL-SKDMFSNRGY  101

Query  83   EPLKNQTLE----AGTP-----ADLKEGFYAGRE--------YALDSQAVLN--------  117
            E +++  LE    + +P      D + G Y G          Y L   ++ N        
Sbjct  102  ELMEDFVLEGEEDSSSPLEISGIDFEAGSYPGEAPLPPSSIGYVLPPSSLANGEGSSMFD  161

Query  118  ------------------------------------KRFNHGPNQWPEQF-PEFESTMQH  140
                                                 R   GPN+WP      F   +  
Sbjct  162  ADMTTSNAVAHGDESISNEFRESFYFGNDNLSKDRLLRPFQGPNKWPSTAGSSFRKALVK  221

Query  141  YQAELEVLAKHLMRGLALSLNLDENYFDDFCQDSLVTLRLLHYPPQPANPEPNEKGCGAH  200
            Y  ++   A H+M  LA SL L  + FD+FC D   ++RLL YP       PN  G   H
Sbjct  222  YHDQMLAFANHVMSLLAESLELSPDAFDEFCSDPTTSIRLLRYP-----SSPNRLGVQEH  276

Query  201  TDFGALTLLLQDQQGGLQVWDKHTESWIDAPPIEGTYVINLGDLIARWTNNHYKSTVHRV  260
            TD  ALTL+ QD   GL++ D  +  ++   P  G  + NLGD++A  TNN YKS++HRV
Sbjct  277  TDADALTLMSQDNVKGLEILDPVSNCFLSVSPAPGALIANLGDIMAILTNNRYKSSMHRV  336

Query  261  INKSGKQRYSVPFFFGGNPDYLVKCLPDCMSESEPSLFVPTTVEQHHIEMYRRTY  315
             N SG  RY++PFF  GN DY+V  LP       PS   P  VE    + ++ +Y
Sbjct  337  CNNSGSDRYTIPFFLQGNIDYVVAPLPGL----GPSTAEPIAVEDLLRDHFQNSY  387


> Q54RA4 Probable iron/ascorbate oxidoreductase DDB_G0283291 [Dictyostelium 
discoideum]
Length=363

 Score =  157 bits (397),  Expect = 1e-47
 Identities = 107/301 (36%), Positives = 161/301 (53%), Gaps = 29/301 (10%)

Query  3    QHIPIISISGLFSPLLED--RLQVAMQMKQACEDNGFFYIADHGVSKNLQQKVFEQSRQF  60
            + +PII I    +   E+  +  ++ +++ AC++ GFFYI  HG+ + L  ++   S++F
Sbjct  11   EQLPIIDIESYGNDKEEELKKKLISKEIENACKNFGFFYIKGHGIDQELIDRLERLSKKF  70

Query  61   FDLPTNEKEKIHKKNSI-ANRGYEPLKNQTLEAGTPADLKEGFYAGREYALDSQAVLNKR  119
            F L  + K K   + +  A RGY  +  + L +G   D KEG Y G E   D   V+ + 
Sbjct  71   FSLDQSIKMKYRMELAQKAWRGYFVVGGE-LTSGLK-DWKEGLYLGTELNDDHPLVIAQT  128

Query  120  FNHGPNQWPEQFPE-------FESTMQHYQAELEVLAKHLMRGLALSLNLDENYFDD-FC  171
              HG N +P    E       F+ T+  Y  ++  L   LM  +A+SLNL  +YF   + 
Sbjct  129  PLHGLNLFPTLEEEIEYDIVGFKDTILTYIDKVTKLGHSLMELIAISLNLSADYFSSRYT  188

Query  172  QDSLVTLRLLHYPPQPANPEPN-------------EKGCGAHTDFGALTLLLQDQQGGLQ  218
            +D L+  R+ +YP   ++ + N             E G G HTD+G LT+L QD  GGLQ
Sbjct  189  KDPLILYRIFNYPSIISSGDDNKTTGESSDDNDKVEWGVGEHTDYGVLTILYQDDVGGLQ  248

Query  219  VWDKHTESWIDAPPIEGTYVINLGDLIARWTNNHYKSTVHRV-INKSGKQRYSVPFFFGG  277
            V  K+   WI APPI+GT+V N+GD++ R T   Y+ST HRV +N+SG+ R S P FF  
Sbjct  249  VHSKN--GWISAPPIKGTFVCNIGDMLDRMTGGLYRSTPHRVELNRSGRDRISFPLFFDP  306

Query  278  N  278
            N
Sbjct  307  N  307


> Q8H113 Probable 2-oxoglutarate-dependent dioxygenase DIN11 [Arabidopsis 
thaliana]
Length=357

 Score =  156 bits (395),  Expect = 2e-47
 Identities = 108/301 (36%), Positives = 163/301 (54%), Gaps = 19/301 (6%)

Query  5    IPIISISGLFSP-----LLEDR--LQVAMQMKQACEDNGFFYIADHGVSKNLQQKVFEQS  57
            +P+I IS L +      + ED   ++V  ++ +AC D GFFY+  HG+S +L  KV E +
Sbjct  34   LPVIDISPLLAKCDDFDMAEDAGVVEVVGKLDRACRDVGFFYVIGHGISDDLINKVKEMT  93

Query  58   RQFFDLPTNEKEKIHKKNSIANRGYEPLKNQTLEAGTPADLKEGFYAGREYALDSQAVLN  117
             QFF+LP  EK KI    +   RGY+ +      +G   D+ E     RE+       + 
Sbjct  94   HQFFELPYEEKLKIKITPTAGYRGYQRI-GVNFTSG-KQDMHEAIDCYREFKQGKHGDIG  151

Query  118  KRFNHGPNQWPEQFPEFESTMQHYQAELEVLAKHLMRGLALSLNLDENYFD-DFCQDSLV  176
            K    GPNQWP    E++  M+ Y      L+++++RG++L+L      F+    +D   
Sbjct  152  KVL-EGPNQWPGNPQEYKDLMEKYIKLCTDLSRNILRGISLALGGSPYEFEGKMLRDPFW  210

Query  177  TLRLLHYPPQPANPEPNEKGCGAHTDFGALTLLLQ-DQQGGLQVWDKHTE-SWIDAPPIE  234
             +R++ YP    N E N  GCGAHTD+G LTL+ Q D +  LQV  K+ +  WI A PI 
Sbjct  211  VMRIIGYP--GVNQE-NVIGCGAHTDYGLLTLINQDDDKTALQV--KNVDGDWIPAIPIP  265

Query  235  GTYVINLGDLIARWTNNHYKSTVHRVINKSGKQRYSVPFFFGGNPDYLVKCLPDCMSESE  294
            G+++ N+GD++   +N  Y+ST+H+VIN S K R  V FF+  N +  V+ L D   E  
Sbjct  266  GSFICNIGDMLTILSNGVYQSTLHKVINNSPKYRVCVAFFYETNFEAEVEPL-DIFKEKH  324

Query  295  P  295
            P
Sbjct  325  P  325


> F4IY03 Probable 2-oxoglutarate-dependent dioxygenase At3g49630 
[Arabidopsis thaliana]
Length=332

 Score =  151 bits (381),  Expect = 1e-45
 Identities = 108/300 (36%), Positives = 158/300 (53%), Gaps = 17/300 (6%)

Query  5    IPIISISGLF-----SPLLEDR--LQVAMQMKQACEDNGFFYIADHGVSKNLQQKVFEQS  57
            +P+I IS L      + + ED    +V  ++ +AC D GFFY+  HG+S++  +KV   S
Sbjct  9    LPVIDISPLVVKCDDANMAEDAGVAEVVGKLDRACRDAGFFYVIGHGISEDFIRKVRVMS  68

Query  58   RQFFDLPTNEKEKIHKKNSIANRGYEPLKNQTLEAGTPADLKEGFYAGREYALDSQAVLN  117
             QFF+LP  EK KI    +   RGY+ +    L  G   D+ E     +E+       + 
Sbjct  69   HQFFELPYEEKLKIKITPAAGYRGYQRI-GLNLTNG-KQDMHEAIDCYKEFKQGKHGDIG  126

Query  118  KRFNHGPNQWPEQFPEFESTMQHYQAELEVLAKHLMRGLALSLNLDENYFD-DFCQDSLV  176
            K    G NQWPE   E++  M+ Y      L+++++RG++L+L      F+     D   
Sbjct  127  K-VMEGANQWPENPQEYKELMEEYIKLCIDLSRNILRGISLALGGSPYEFEGKMLTDPFW  185

Query  177  TLRLLHYPPQPANPEPNEKGCGAHTDFGALTLLLQ-DQQGGLQVWDKHTESWIDAPPIEG  235
             +R+L YP    N E N  GCGAHTD+G L+L+ Q D +  LQV D     WI   PI G
Sbjct  186  IMRILGYP--GVNQE-NVIGCGAHTDYGLLSLINQDDDKTALQVRDL-AGDWIPVIPIPG  241

Query  236  TYVINLGDLIARWTNNHYKSTVHRVINKSGKQRYSVPFFFGGNPDYLVKCLPDCMSESEP  295
            ++V N+GD++   +N  Y+ST+HRVIN S + R  V FF+  N D  V+ L D   E  P
Sbjct  242  SFVCNIGDMLKILSNGVYESTLHRVINNSPRYRVCVGFFYETNFDAAVEPL-DIFKEKYP  300


> Q9FFF6 Probable 2-oxoglutarate-dependent dioxygenase At5g05600 
[Arabidopsis thaliana]
Length=371

 Score =  135 bits (339),  Expect = 2e-39
 Identities = 103/317 (32%), Positives = 160/317 (50%), Gaps = 24/317 (8%)

Query  4    HIPIISISGLFSPL-LEDRLQVAMQMKQACEDNGFFYIADHGVSKNLQQKVFEQSRQFFD  62
            +IPII + GLFS   L D + +A ++ +AC   GFF + +HGV   L     E  R+FF 
Sbjct  61   NIPIIDLEGLFSEEGLSDDVIMA-RISEACRGWGFFQVVNHGVKPELMDAARENWREFFH  119

Query  63   LPTNEKEKIHKKNSIANRGYEPLKNQT-LEAGTPADLKEGFYAGREYALDSQAVLNKRFN  121
            +P N KE      S + R YE   ++  +E G   D  + ++    + L       K FN
Sbjct  120  MPVNAKETY----SNSPRTYEGYGSRLGVEKGASLDWSDYYFL---HLLPHHL---KDFN  169

Query  122  HGPNQWPEQFPEFESTMQHYQAELEVLAKHLMRGLALSLNLDENYFDD-FCQDSLVTLRL  180
                +WP   P     +  Y  EL  L+  +MR L+ +L L E+ F + F  +++     
Sbjct  170  ----KWPSFPPTIREVIDEYGEELVKLSGRIMRVLSTNLGLKEDKFQEAFGGENIGACLR  225

Query  181  LHYPPQPANPEPNEKGCGAHTDFGALTLLLQDQQG-GLQVWDKHTESWIDAPPIEGTYVI  239
            ++Y P+   PE    G   H+D G +T+LL D Q  GLQV  +  ++WI   P    +++
Sbjct  226  VNYYPKCPRPEL-ALGLSPHSDPGGMTILLPDDQVFGLQV--RKDDTWITVKPHPHAFIV  282

Query  240  NLGDLIARWTNNHYKSTVHRVINKSGKQRYSVPFFFGGNPDYLVKCLPDCMSESEPSLFV  299
            N+GD I   +N+ YKS  HRVI  S K+R S+ FF+    D  ++ L + +S   P L+ 
Sbjct  283  NIGDQIQILSNSTYKSVEHRVIVNSDKERVSLAFFYNPKSDIPIQPLQELVSTHNPPLYP  342

Query  300  PTTVEQHHIEMYRRTYG  316
            P T +Q+   ++ RT G
Sbjct  343  PMTFDQY--RLFIRTQG  357


> K0DZA0 2-oxoglutarate-dependent dioxygenase htyE [Aspergillus 
rugulosus]
Length=329

 Score =  133 bits (334),  Expect = 5e-39
 Identities = 99/304 (33%), Positives = 150/304 (49%), Gaps = 31/304 (10%)

Query  36   GFFYIADHGVSKNLQQKVFEQSRQFFDLPTNEKEKIHKKNSI-ANRGYEPLKNQTLEAGT  94
            GF  I +  +S  L  ++F+ +R FF LP + K K    N+   +RG+  +  + +   +
Sbjct  34   GFAKIRNTTLSNELIDEIFKYTRSFFALPNDIKAKAKHPNAPNPHRGWSAIGQERVWKIS  93

Query  95   PADLKEGFYAGREYALDSQAVLNKRFNHG-------PNQWPEQ--FPEFESTMQHYQAEL  145
                  GF   +E   DS     + F+ G       PN+W ++   P F++ M+ +    
Sbjct  94   ------GFEQNKERT-DSYNEFRESFDQGAADDQLFPNRWVDEDDLPGFQAFMEGFYKSC  146

Query  146  EVLAKHLMRGLALSLNLDENYFDDFCQDSLVTLRLLHYPPQPANPEPNEKGCGAHTDFGA  205
            + L  HL+R ++  L L +       + +   LRLLHYPP P +   +    G H+DFG 
Sbjct  147  DELHAHLLRAISTGLKLPDTLLPSKHRHNTSELRLLHYPPIPCSALRSNMRIGEHSDFGT  206

Query  206  LTLLLQDQQGGLQVWD-KHTESWIDAPPIEG-TYVINLGDLIARWTNNHYKSTVHRVINK  263
            LTLLLQD  GGLQV D ++  S+I   P +G   VIN+GD + RWTN    S  HRV+  
Sbjct  207  LTLLLQDSVGGLQVEDQRNPRSFIPVEPEDGYEVVINIGDCLQRWTNRRLCSANHRVMLP  266

Query  264  SGK---------QRYSVPFFFGGNPDYLVKCLPDCMSESEPSLFVP--TTVEQHHIEMYR  312
             GK          RYSV +F   + D LV  LP+C+   E   +    T ++ + I++  
Sbjct  267  EGKDVDSEEVLDDRYSVAYFGKPDRDVLVDTLPECVEVGERVEYGDHLTALQYNQIKL-T  325

Query  313  RTYG  316
            RTYG
Sbjct  326  RTYG  329


> Q15JG7 Validamycin A dioxygenase [Streptomyces hygroscopicus 
subsp. limoneus]
Length=365

 Score =  128 bits (322),  Expect = 4e-37
 Identities = 96/323 (30%), Positives = 153/323 (47%), Gaps = 17/323 (5%)

Query  1    VTQHIPIISISGLFSPLLEDRLQVAMQMKQACEDNGFFYIADHGVSKNLQQKVFEQSRQF  60
            +T  +PI+ +    +   E+R  +A  +  A    G F +A HGV   L  ++    R F
Sbjct  1    MTGSVPIVDLEAWRAADEENRASLAEIIDGALHTVGTFLLAGHGVPAELTARMRTAGRSF  60

Query  61   FDLPTNEKEK--IHKKNSIANRGYEPLKNQTLEA-GTPADLKEGFYAGREYALDSQAVLN  117
            FDLP  +KE   + + +    RG    +  T+E  G   DL E F+ G  +     A   
Sbjct  61   FDLPWEKKEPHAVQRPHDNGWRGLVKHRTDTIEGTGGAPDLHEAFHMGPTHRTGDDAF--  118

Query  118  KRFNHGPNQWPEQFPEFESTMQHYQAELEVLAKHLMRGLALSLNLDENYFDDFCQDSLVT  177
                +  N+WP + PE   T   Y A +  +A  +M  LA  L L+  +F   C+ +  T
Sbjct  119  DALYYPANKWPAELPELRETALAYTAHMTRVAGAVMEMLAGVLGLEPAFFTSRCEHATWT  178

Query  178  LRLLHYPPQPANPEPNE--KGCGAHTDFGALTLLLQDQQG--GLQVWDKHTESWIDAPPI  233
              +  YP      +  E     G HTDFG +TLL   QQG  GL+VW +  + W   P +
Sbjct  179  QSVNWYPSLDTVGQTAEGQMRVGPHTDFGTITLL-DRQQGVSGLEVWSEE-DGWFAPPFV  236

Query  234  EGTYVINLGDLIARWTNNHYKSTVHRVINKSG----KQRYSVPFFFGGNP--DYLVKCLP  287
            EGT ++NLGDL+ +WT+  ++S  HRV+  S     ++  S+ +FF  +P  + +    P
Sbjct  237  EGTLLVNLGDLMHQWTDGRWRSLRHRVLAPSASAPQEELVSLVYFFDADPEAELVPLAAP  296

Query  288  DCMSESEPSLFVPTTVEQHHIEM  310
                   P++ V  T+ + +I+M
Sbjct  297  VGGGAGMPTVNVGETILKKNIQM  319



Lambda      K        H        a         alpha
   0.320    0.137    0.425    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1227420


  Database: 0f03bf4e51c8e6f247cc014f4efa0b50.SwissProt.fasta
    Posted date:  Sep 26, 2020  8:03 PM
  Number of letters in database: 5,251
  Number of sequences in database:  15



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40