ACIAD0688 / TrEMBL Alignments

BLASTP 2.2.28+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: 85284ae64eef4e456b8a610153a499b1.TrEMBL.fasta
           18 sequences; 5,419 total letters



Query= ACIAD0688

Length=277
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  Q6FEA5 Copper resistance protein B [Acinetobacter baylyi (strai...   558    0.0   
  A0A0M1I487 Copper resistance protein CopB [Acinetobacter sp. C15]    298    7e-104
  A0A1P8EJG2 Copper resistance protein CopB [Acinetobacter soli]       298    1e-103
  N9S4Z3 Uncharacterized protein [Acinetobacter ursingii NIPH 706]     298    2e-103
  A0A009YWU4 Copper resistance B family protein [Acinetobacter sp...   298    2e-103
  N9BX49 Uncharacterized protein [Acinetobacter soli NIPH 2899]        295    1e-102
  N9BXN4 Uncharacterized protein [Acinetobacter ursingii ANC 3649]     295    2e-102
  A0A137XMF7 Copper resistance protein CopB [Acinetobacter veneti...   276    1e-94 
  A0A150HK41 Copper resistance protein B [Acinetobacter venetianus]    274    5e-94 
  Q56796 Uncharacterized protein [Xanthomonas campestris pv. jugl...   110    4e-31 
  F4ZD00 Copper resistance protein B [Xanthomonas euvesicatoria p...   110    4e-31 
  Q5F0H6 CopB-like protein [Xanthomonas perforans]                     109    2e-30 
  F4ZBX4 CopB [Xanthomonas citri pv. citri]                            108    3e-30 
  Q9L913 CopB [Aeromonas veronii bv. sobria]                           107    3e-30 
  Q7WYH0 CopB [Pseudomonas putida]                                     105    2e-29 
  K4MV24 CopB [Pseudomonas syringae pv. syringae]                     93.6    2e-25 
  X4R623 Copper resistance protein B [Xylella fastidiosa subsp. f...  46.6    1e-09 
  H2FK46 Copper resistance protein B [Xylella fastidiosa subsp. m...  46.6    1e-09 


> Q6FEA5 Copper resistance protein B [Acinetobacter baylyi (strain 
ATCC 33305 / BD413 / ADP1)]
Length=276

 Score =  558 bits (1438),  Expect = 0.0
 Identities = 276/276 (100%), Positives = 276/276 (100%), Gaps = 0/276 (0%)

Query  1    MRITKVTFYLTGVLMNASVYAHDAHAMNTMVSSDHHMQSTPQLDNFAETETIQNDAAMDE  60
            MRITKVTFYLTGVLMNASVYAHDAHAMNTMVSSDHHMQSTPQLDNFAETETIQNDAAMDE
Sbjct  1    MRITKVTFYLTGVLMNASVYAHDAHAMNTMVSSDHHMQSTPQLDNFAETETIQNDAAMDE  60

Query  61   QHRHEHGGQIYQATQWDNLWALNRHGEASISSELKSWIGTDENKVFLKAELEKEQSSSPD  120
            QHRHEHGGQIYQATQWDNLWALNRHGEASISSELKSWIGTDENKVFLKAELEKEQSSSPD
Sbjct  61   QHRHEHGGQIYQATQWDNLWALNRHGEASISSELKSWIGTDENKVFLKAELEKEQSSSPD  120

Query  121  RYISILYSRNIANFWDVQAGVRYRDQASQVESKEHLDAVFALHGLAPYFFETDVSLYLGE  180
            RYISILYSRNIANFWDVQAGVRYRDQASQVESKEHLDAVFALHGLAPYFFETDVSLYLGE
Sbjct  121  RYISILYSRNIANFWDVQAGVRYRDQASQVESKEHLDAVFALHGLAPYFFETDVSLYLGE  180

Query  181  QQYASLKLETERDILLTQKLILKPYLEADIVLSDQSRDAEKKGLSTLKSGLQTRYEINKK  240
            QQYASLKLETERDILLTQKLILKPYLEADIVLSDQSRDAEKKGLSTLKSGLQTRYEINKK
Sbjct  181  QQYASLKLETERDILLTQKLILKPYLEADIVLSDQSRDAEKKGLSTLKSGLQTRYEINKK  240

Query  241  VMPFIDLAYHYKHGQDAQEKTSEREWLYGAGMTFKF  276
            VMPFIDLAYHYKHGQDAQEKTSEREWLYGAGMTFKF
Sbjct  241  VMPFIDLAYHYKHGQDAQEKTSEREWLYGAGMTFKF  276


> A0A0M1I487 Copper resistance protein CopB [Acinetobacter sp. 
C15]
Length=272

 Score =  298 bits (764),  Expect = 7e-104
 Identities = 149/276 (54%), Positives = 195/276 (71%), Gaps = 4/276 (1%)

Query  1    MRITKVTFYLTGVLMNASVYAHDAHAMNTMVSSDHHMQSTPQLDNFAETETIQNDAAMDE  60
            MRITK+T  +   L +    A  ++    M +  H +   P      +T     ++   +
Sbjct  1    MRITKMTLCICMALGSTGTIAQTSNEQ--MYTHSHAIMPMPTT-TLKDTHLAYQESDEAQ  57

Query  61   QHRHEHGGQIYQATQWDNLWALNRHGEASISSELKSWIGTDENKVFLKAELEKEQSSSPD  120
             HR +HGGQ YQATQ D  W +N HG+ ++ SEL+SW GTDENK++LKAELEKE+S+S  
Sbjct  58   HHRDQHGGQWYQATQVDTQWMVNTHGKGAVQSELRSWWGTDENKLYLKAELEKEESASAS  117

Query  121  RYISILYSRNIANFWDVQAGVRYRDQASQVESKEHLDAVFALHGLAPYFFETDVSLYLGE  180
            R IS+ YSR I++FWD+Q G+RYRD AS+  + E LD V ALHGLAPYFFETD+SL++G 
Sbjct  118  RNISMRYSRMISDFWDIQTGLRYRDDASE-SADEALDGVIALHGLAPYFFETDLSLFIGA  176

Query  181  QQYASLKLETERDILLTQKLILKPYLEADIVLSDQSRDAEKKGLSTLKSGLQTRYEINKK  240
              Y  L +ETERD+LLTQK+++KPYL+ADIV+SDQS +A + GL+ LK+GLQTRYEINKK
Sbjct  177  HGYTGLSVETERDVLLTQKIVIKPYLKADIVISDQSSEAAETGLNELKTGLQTRYEINKK  236

Query  241  VMPFIDLAYHYKHGQDAQEKTSEREWLYGAGMTFKF  276
            VMPF+D+AYHYK    A    S+R W YGAG+TFKF
Sbjct  237  VMPFVDVAYHYKQHPTALFSVSDRAWWYGAGVTFKF  272


> A0A1P8EJG2 Copper resistance protein CopB [Acinetobacter soli]
Length=272

 Score =  298 bits (762),  Expect = 1e-103
 Identities = 149/276 (54%), Positives = 190/276 (69%), Gaps = 4/276 (1%)

Query  1    MRITKVTFYLTGVLMNASVYAHDAHAMNTMVSSDHHMQSTPQLDNFAETETIQNDAAMDE  60
            MRITK+T  +   L +    A  +   N  + +  H           +T     ++   +
Sbjct  1    MRITKMTLCICAALGSTGTIAQTS---NEQIYTHSHAIMPMPTTTLKDTHLAYQESDEAQ  57

Query  61   QHRHEHGGQIYQATQWDNLWALNRHGEASISSELKSWIGTDENKVFLKAELEKEQSSSPD  120
             HR +HGGQ YQATQ D  W +N HG+ ++ SEL+SW GTDENK++LKAELEKE+S S  
Sbjct  58   HHRDQHGGQWYQATQVDTQWMVNTHGKGAVQSELRSWWGTDENKLYLKAELEKEESESAS  117

Query  121  RYISILYSRNIANFWDVQAGVRYRDQASQVESKEHLDAVFALHGLAPYFFETDVSLYLGE  180
            R IS+ YSR I++FWD+Q G+RYRD AS+  + E LD V ALHGLAPYFFETD+SL++G 
Sbjct  118  RNISMRYSRMISDFWDIQTGLRYRDDASE-SAHESLDGVIALHGLAPYFFETDLSLFIGA  176

Query  181  QQYASLKLETERDILLTQKLILKPYLEADIVLSDQSRDAEKKGLSTLKSGLQTRYEINKK  240
              Y  L +ETERD+LLTQK+ +KPYL+ADIV+SDQS +A K GL+ LK+GLQTRYEINKK
Sbjct  177  HGYTGLSVETERDVLLTQKIAIKPYLKADIVISDQSSEAAKTGLNELKTGLQTRYEINKK  236

Query  241  VMPFIDLAYHYKHGQDAQEKTSEREWLYGAGMTFKF  276
            VMPFID+AYHYK    A    S+R W YGAG+ FKF
Sbjct  237  VMPFIDVAYHYKQHPTALFSVSDRAWWYGAGVAFKF  272


> N9S4Z3 Uncharacterized protein [Acinetobacter ursingii NIPH 706]
Length=292

 Score =  298 bits (763),  Expect = 2e-103
 Identities = 152/292 (52%), Positives = 204/292 (70%), Gaps = 16/292 (5%)

Query  1    MRITK---VTFYLTGVLMNASVYAHDAH--AMNTMVSSD--HHMQSTPQLDNFAETET--  51
            MR TK   V  + TG +M++  +AH+ H   M+ M  SD   H +      N A+T T  
Sbjct  1    MRTTKMMTVLMFSTGFMMSSWAFAHEGHDMMMSNMSMSDGQDHAEMPMPEKNRAQTNTEV  60

Query  52   ---IQNDAAMDEQHRHEHGGQIYQATQWDNLWALNRHGEASISSELKSWIGTDENKVFLK  108
               ++ D   D  HR EHGGQIYQAT+ DN W L++HG+   ++EL++WIGTD+NK+F+K
Sbjct  61   SSNVRVDDHSDHDHRREHGGQIYQATKLDNQWRLDKHGQGEFNTELETWIGTDQNKLFIK  120

Query  109  AELEKEQSSSPDRYISILYSRNIANFWDVQAGVRYRDQASQVESKEHLDAVFALHGLAPY  168
            A  EK +S   +  +S LYSRNIA+FWD Q G+RYR +A +   +E +DA F LHGLAPY
Sbjct  121  AHREKSESEKANYAVSALYSRNIADFWDAQVGLRYRSEAFEAHRQEAVDAAFGLHGLAPY  180

Query  169  FFETDVSLYLGEQQYASLKLETERDILLTQKLILKPYLEADIVLSDQSRDAEKKGLSTLK  228
            FFETD  +Y+G+ Q+ SL LETERDILLTQKLI +PYL+ADI++ D+S +A+K GLS+L+
Sbjct  181  FFETDAYVYIGQDQHVSLSLETERDILLTQKLITQPYLKADILIRDESDNAKKTGLSSLQ  240

Query  229  SGLQTRYEINKKVMPFIDLAYHYKHGQDAQEK----TSEREWLYGAGMTFKF  276
            +G+QTRYEI+KKVMPFID+AY Y+ G     +    +SE  WLYGAG+TFKF
Sbjct  241  TGVQTRYEISKKVMPFIDVAYRYEKGDRETSRQVATSSESGWLYGAGITFKF  292


> A0A009YWU4 Copper resistance B family protein [Acinetobacter 
sp. 479375]
Length=292

 Score =  298 bits (763),  Expect = 2e-103
 Identities = 152/292 (52%), Positives = 204/292 (70%), Gaps = 16/292 (5%)

Query  1    MRITK---VTFYLTGVLMNASVYAHDAH--AMNTMVSSD--HHMQSTPQLDNFAETET--  51
            MR TK   V  + TG +M++  +AH+ H   M+ M  SD   H +      N A+T T  
Sbjct  1    MRTTKMMTVLMFSTGFMMSSWAFAHEGHDMMMSNMSMSDGQDHAEMPMPEKNRAQTNTEV  60

Query  52   ---IQNDAAMDEQHRHEHGGQIYQATQWDNLWALNRHGEASISSELKSWIGTDENKVFLK  108
               ++ D   D  HR EHGGQIYQAT+ DN W L++HG+   ++EL++WIGTD+NK+F+K
Sbjct  61   SSNVRVDDHSDHDHRREHGGQIYQATKLDNQWRLDKHGQGEFNTELETWIGTDQNKLFIK  120

Query  109  AELEKEQSSSPDRYISILYSRNIANFWDVQAGVRYRDQASQVESKEHLDAVFALHGLAPY  168
            A  EK +S   +  +S LYSRNIA+FWD Q G+RYR +A +   +E +DA F LHGLAPY
Sbjct  121  AHREKSESEKANYAVSALYSRNIADFWDAQVGLRYRSEAFEAHRQEAVDAAFGLHGLAPY  180

Query  169  FFETDVSLYLGEQQYASLKLETERDILLTQKLILKPYLEADIVLSDQSRDAEKKGLSTLK  228
            FFETD  +Y+G+ Q+ SL LETERDILLTQKLI +PYL+ADI++ D+S +A+K GLS+L+
Sbjct  181  FFETDAYVYIGQDQHVSLSLETERDILLTQKLITQPYLKADILIRDESDNAKKTGLSSLQ  240

Query  229  SGLQTRYEINKKVMPFIDLAYHYKHGQDAQEK----TSEREWLYGAGMTFKF  276
            +G+QTRYEI+KKVMPFID+AY Y+ G     +    +SE  WLYGAG+TFKF
Sbjct  241  TGVQTRYEISKKVMPFIDVAYRYEKGDRETSRQVATSSESGWLYGAGITFKF  292


> N9BX49 Uncharacterized protein [Acinetobacter soli NIPH 2899]
Length=272

 Score =  295 bits (756),  Expect = 1e-102
 Identities = 149/276 (54%), Positives = 193/276 (70%), Gaps = 4/276 (1%)

Query  1    MRITKVTFYLTGVLMNASVYAHDAHAMNTMVSSDHHMQSTPQLDNFAETETIQNDAAMDE  60
            MRITK+T  +   L +    A  ++    M +  H +   P      +T     ++   +
Sbjct  1    MRITKMTLCICAALGSTGTIAQISNEQ--MHTHSHAIMPMPTT-TLKDTHLAYQESDEAQ  57

Query  61   QHRHEHGGQIYQATQWDNLWALNRHGEASISSELKSWIGTDENKVFLKAELEKEQSSSPD  120
             HR +HGGQ YQATQ D  W +N H + ++ SEL+SW GTD+NK++LKAELEKE+S S  
Sbjct  58   HHRDQHGGQWYQATQVDTQWMVNTHSKGAVQSELRSWWGTDKNKLYLKAELEKEESESAS  117

Query  121  RYISILYSRNIANFWDVQAGVRYRDQASQVESKEHLDAVFALHGLAPYFFETDVSLYLGE  180
            R IS+ YSR I++FWD+Q G+RYRD AS+  + E LD V ALHGLAPYFFETD+SLY+G 
Sbjct  118  RNISMRYSRMISDFWDIQTGLRYRDDASE-SADEALDGVIALHGLAPYFFETDLSLYVGA  176

Query  181  QQYASLKLETERDILLTQKLILKPYLEADIVLSDQSRDAEKKGLSTLKSGLQTRYEINKK  240
              Y  L +ETERD+LLTQK+++KPYL+ADIV+SDQS +A + GL+ LK+GLQTRYEINKK
Sbjct  177  HGYTGLSVETERDVLLTQKIVIKPYLKADIVISDQSSEAAETGLNELKTGLQTRYEINKK  236

Query  241  VMPFIDLAYHYKHGQDAQEKTSEREWLYGAGMTFKF  276
            VMPFID+AYHYK    A    S+R W YGAG+TFKF
Sbjct  237  VMPFIDVAYHYKQHPTALFSVSDRAWWYGAGVTFKF  272


> N9BXN4 Uncharacterized protein [Acinetobacter ursingii ANC 3649]
Length=292

 Score =  295 bits (756),  Expect = 2e-102
 Identities = 148/292 (51%), Positives = 203/292 (70%), Gaps = 16/292 (5%)

Query  1    MRITK---VTFYLTGVLMNASVYAHDAHAM---NTMVSS--DHHMQSTPQLDNFAETETI  52
            MR TK   V  + TG +M++  +AH+ H M   N  +S   DH     P+ +       +
Sbjct  1    MRTTKMMTVLMFSTGFMMSSWAFAHEGHDMMMSNMSMSEGQDHAEMPMPEKNRAQTNREV  60

Query  53   QNDAAMDEQ----HRHEHGGQIYQATQWDNLWALNRHGEASISSELKSWIGTDENKVFLK  108
             ++ ++D+     HR EHGGQIYQAT+ DN W L++HG+   ++EL++WIGTD+NK+F+K
Sbjct  61   SSNVSVDDHSDHDHRREHGGQIYQATKLDNQWRLDKHGQGEFNTELETWIGTDQNKLFIK  120

Query  109  AELEKEQSSSPDRYISILYSRNIANFWDVQAGVRYRDQASQVESKEHLDAVFALHGLAPY  168
            A  EK +S   D  IS LYSRNIA+FWD Q G+RYR +A     +E +DA F LHGLAPY
Sbjct  121  AHSEKSESEKADYAISALYSRNIADFWDAQVGLRYRSEAFDTHRQEAVDAAFGLHGLAPY  180

Query  169  FFETDVSLYLGEQQYASLKLETERDILLTQKLILKPYLEADIVLSDQSRDAEKKGLSTLK  228
            FFETD  +Y+G+ Q+ SL LETERDILLTQKLI +PYL+AD+++ D+S +A+K GLS+L+
Sbjct  181  FFETDAYVYVGKDQHVSLSLETERDILLTQKLITQPYLKADVLIRDESDNAKKTGLSSLQ  240

Query  229  SGLQTRYEINKKVMPFIDLAYHYKHGQDAQEK----TSEREWLYGAGMTFKF  276
            +G+QTRYEI+KKVMPF+D+AY Y+ G     +    +SE  WLYGAG+TFKF
Sbjct  241  TGVQTRYEISKKVMPFMDVAYRYEKGDRETSRQVATSSESGWLYGAGITFKF  292


> A0A137XMF7 Copper resistance protein CopB [Acinetobacter venetianus]
Length=297

 Score =  276 bits (705),  Expect = 1e-94
 Identities = 143/271 (53%), Positives = 181/271 (67%), Gaps = 10/271 (4%)

Query  16   NASVYAHDAHAMNTMVSSDHHMQSTPQLD--NFAETETIQ---NDAAMD-EQHRHEHGGQ  69
            +A  +A+++H M  M  S H M S  +    + ++ +T++    DA      HR EHGGQ
Sbjct  27   SAITFANESHQMTEMDHSAHQMTSMNEASAIDHSQHQTVKAAPTDAVHHAHDHRREHGGQ  86

Query  70   IYQATQWDNLWALNRHGEASISSELKSWIGTDENKVFLKAELEKEQSSSPDRYISILYSR  129
            IYQAT  +N W L+ HG    S+ELK+WIGTDENK+F+KA +EK +S   D     LYSR
Sbjct  87   IYQATTLENAWTLDEHGRGRASTELKTWIGTDENKIFIKAHVEKAESEKADTETMALYSR  146

Query  130  NIANFWDVQAGVRYRDQASQVESKEHLDAVFALHGLAPYFFETDVSLYLGEQQYASLKLE  189
            NIA+FWDVQAGVRY+    Q   K    AVF LHGLAPYFFET+  LY G+ Q   L L+
Sbjct  147  NIADFWDVQAGVRYQYMPEQSLDKNQWSAVFGLHGLAPYFFETEAYLYAGQDQRWQLSLD  206

Query  190  TERDILLTQKLILKPYLEADIVLSDQSRDAEKKGLSTLKSGLQTRYEINKKVMPFIDLAY  249
            T RD L TQKLI +PYL+ADIVL+D+S+ A+K GLS L++G+QTRYEINKK+MPFID+AY
Sbjct  207  TSRDFLFTQKLIAQPYLQADIVLNDKSKYAQKTGLSKLQAGVQTRYEINKKIMPFIDIAY  266

Query  250  HYKHGQD----AQEKTSEREWLYGAGMTFKF  276
             Y  G D     +   SE+ WLYGAG T KF
Sbjct  267  AYHKGADKTLWQEGSDSEKGWLYGAGFTLKF  297


> A0A150HK41 Copper resistance protein B [Acinetobacter venetianus]
Length=297

 Score =  274 bits (701),  Expect = 5e-94
 Identities = 143/271 (53%), Positives = 181/271 (67%), Gaps = 10/271 (4%)

Query  16   NASVYAHDAHAMNTMVSSDHHMQSTPQLD--NFAETETIQ---NDAAMD-EQHRHEHGGQ  69
            +A  +A+++H M  M  S H M S  +    + ++ +TI+    DA      HR EHGGQ
Sbjct  27   SAITFANESHQMTEMDHSAHQMTSMNKASAIDHSQHQTIKAAPTDAVHHAHDHRREHGGQ  86

Query  70   IYQATQWDNLWALNRHGEASISSELKSWIGTDENKVFLKAELEKEQSSSPDRYISILYSR  129
            IYQAT  +N W L+ HG    S+ELK+WIG+DENK+F+KA +EK +S   D     LYSR
Sbjct  87   IYQATTLENAWTLDEHGRGRASTELKTWIGSDENKIFIKAHVEKAESEKADTETMALYSR  146

Query  130  NIANFWDVQAGVRYRDQASQVESKEHLDAVFALHGLAPYFFETDVSLYLGEQQYASLKLE  189
            NIA+FWDVQAGVRY+    Q   K    AVF LHGLAPYFFET+  LY G+ Q   L L+
Sbjct  147  NIADFWDVQAGVRYQYMPEQSLDKNQWSAVFGLHGLAPYFFETEAYLYAGQDQRWQLSLD  206

Query  190  TERDILLTQKLILKPYLEADIVLSDQSRDAEKKGLSTLKSGLQTRYEINKKVMPFIDLAY  249
            T RD L TQKLI +PYL+AD+VLSD+S+ A+K GLS L++G+QTRYEINKK+MPFID+AY
Sbjct  207  TTRDFLFTQKLIAQPYLQADLVLSDKSKYAQKTGLSKLQAGVQTRYEINKKIMPFIDIAY  266

Query  250  HYKHGQD----AQEKTSEREWLYGAGMTFKF  276
             Y  G D     +   SE+ WLYGAG T KF
Sbjct  267  AYHKGADKTLWQEGSDSEKGWLYGAGFTLKF  297


> Q56796 Uncharacterized protein [Xanthomonas campestris pv. juglandis]
Length=339

 Score =  110 bits (275),  Expect = 4e-31
 Identities = 65/202 (32%), Positives = 104/202 (51%), Gaps = 8/202 (4%)

Query  66   HGGQIYQATQWDNLWALNRHGEASISSELKSWIGTDENKVFLKAELEKEQSSSPDRYISI  125
            H   I     ++ L A N       + E +SWIGTD N++ +++E E+    +    + +
Sbjct  129  HDNTIQHYVLFNRLEAWNADPGTGQAWEGQSWIGTDLNRLCVRSEGERNDGRTEAADLEV  188

Query  126  LYSRNIANFWDVQAGVR--YRDQASQVESKEHLDAVFALHGLAPYFFETDVSLYLGEQQY  183
            LY R++A +WD+ AG+R  ++  +SQ        A F + GLAP  FE   + Y+GE+  
Sbjct  189  LYGRSVAPWWDLVAGIRQDFKPGSSQTY------AAFGVQGLAPMKFEVAATAYIGERGQ  242

Query  184  ASLKLETERDILLTQKLILKPYLEADIVLSDQSRDAEKKGLSTLKSGLQTRYEINKKVMP  243
             + +LE E ++LLT + IL+P  E ++   D        GLST + GL+ RYE  ++  P
Sbjct  243  TAARLEAEYELLLTNRWILQPLAEIELFGKDDPARGIGSGLSTAELGLRLRYEFTRQFAP  302

Query  244  FIDLAYHYKHGQDAQEKTSERE  265
            +I L Y    G  A  +  E E
Sbjct  303  YIGLVYERAFGNTADLRRDESE  324


> F4ZD00 Copper resistance protein B [Xanthomonas euvesicatoria 
pv. citrumelonis]
Length=422

 Score =  110 bits (276),  Expect = 4e-31
 Identities = 78/249 (31%), Positives = 116/249 (47%), Gaps = 17/249 (7%)

Query  27   MNTMVSSDHHMQ-------STPQLDNFAETETIQNDAAMDEQHRHE-HGGQIYQATQWDN  78
            M +M   DH          + P+    A TE     AA+   H H  H   I      + 
Sbjct  166  MQSMEGMDHSQMGHGSAAPTQPRTPIPAVTEA-DRQAAIAPAHAHPVHDNSIKSYVLLNR  224

Query  79   LWALNRHGEASISSELKSWIGTDENKVFLKAELEKEQSSSPDRYISILYSRNIANFWDVQ  138
            L A +      +  E + WIGTD N+V+L++E E+    +    + +LY R+I+ +WDV 
Sbjct  225  LEAWDADPGTGLGWEGQGWIGTDLNRVWLRSEGERTDGQTESADLEVLYGRSISTWWDVV  284

Query  139  AGVR--YRDQASQVESKEHLDAVFALHGLAPYFFETDVSLYLGEQQYASLKLETERDILL  196
            AGVR  ++  ASQ        A   + GLAP  FE   + YLGE    +  +E E ++LL
Sbjct  285  AGVRHDFKPGASQ------NFAAIGVQGLAPMKFEVSATAYLGEGGQTAANVEAEYELLL  338

Query  197  TQKLILKPYLEADIVLSDQSRDAEKKGLSTLKSGLQTRYEINKKVMPFIDLAYHYKHGQD  256
            T +LIL+P +E      +        GLST ++GL+ RYE  +K  P+I + Y    G  
Sbjct  339  TNRLILQPLVEVTAYGKNDPLRGIGSGLSTAEAGLRLRYEFTRKFAPYIGVVYERAFGNT  398

Query  257  AQEKTSERE  265
            A  +    E
Sbjct  399  ADMRREHGE  407


 Score = 17.3 bits (33),  Expect = 7.3
 Identities = 6/18 (33%), Positives = 12/18 (67%), Gaps = 0/18 (0%)

Query  256  DAQEKTSEREWLYGAGMT  273
            D Q ++++ E LYG  ++
Sbjct  261  DGQTESADLEVLYGRSIS  278


> Q5F0H6 CopB-like protein [Xanthomonas perforans]
Length=423

 Score =  109 bits (272),  Expect = 2e-30
 Identities = 77/249 (31%), Positives = 115/249 (46%), Gaps = 17/249 (7%)

Query  27   MNTMVSSDHHMQ-------STPQLDNFAETETIQNDAAMDEQHRHE-HGGQIYQATQWDN  78
            M +M   DH          + P+    A TE     AA+   H H  H   I      + 
Sbjct  167  MQSMEGMDHSQMGHGPVAPTQPRTPIPAVTEA-DRQAAIAPAHAHPVHDNSIKSYVLLNR  225

Query  79   LWALNRHGEASISSELKSWIGTDENKVFLKAELEKEQSSSPDRYISILYSRNIANFWDVQ  138
            L A +      +  E + WIGTD N+V+ ++E E+    +    + +LY R+I+ +WDV 
Sbjct  226  LEAWDADPGTGLGWEGQGWIGTDLNRVWFRSEGERTDGQTESADLEVLYGRSISTWWDVV  285

Query  139  AGVR--YRDQASQVESKEHLDAVFALHGLAPYFFETDVSLYLGEQQYASLKLETERDILL  196
            AGVR  ++  ASQ        A   + GLAP  FE   + YLGE    +  +E E ++LL
Sbjct  286  AGVRHDFKPGASQ------NFAAIGVQGLAPMKFEVSATAYLGEGGQTAANVEAEYELLL  339

Query  197  TQKLILKPYLEADIVLSDQSRDAEKKGLSTLKSGLQTRYEINKKVMPFIDLAYHYKHGQD  256
            T +LIL+P +E      +        GLST ++GL+ RYE  +K  P+I + Y    G  
Sbjct  340  TNRLILQPLVEVTAYGKNDPLRGIGSGLSTAEAGLRLRYEFTRKFAPYIGVVYERAFGNT  399

Query  257  AQEKTSERE  265
            A  +    E
Sbjct  400  ADMRREHGE  408


 Score = 17.3 bits (33),  Expect = 7.3
 Identities = 6/18 (33%), Positives = 12/18 (67%), Gaps = 0/18 (0%)

Query  256  DAQEKTSEREWLYGAGMT  273
            D Q ++++ E LYG  ++
Sbjct  262  DGQTESADLEVLYGRSIS  279


> F4ZBX4 CopB [Xanthomonas citri pv. citri]
Length=422

 Score =  108 bits (270),  Expect = 3e-30
 Identities = 80/268 (30%), Positives = 122/268 (46%), Gaps = 24/268 (9%)

Query  15   MNASVYAHDAHA-------MNTMVSSDHHMQ-------STPQLDNFAETETIQNDAAMDE  60
            M+ S   HD+ A       M +M   DH          + P+    A T+     AA+  
Sbjct  147  MDHSQMGHDSPAPATPEAGMQSMEGMDHSQMGHGPAAPTQPRTPIPAVTDA-DRKAAIAP  205

Query  61   QHRHE-HGGQIYQATQWDNLWALNRHGEASISSELKSWIGTDENKVFLKAELEKEQSSSP  119
            +H H  H   I      + L   +      +  E + WIGTD N+V+L++E E+    + 
Sbjct  206  EHAHPVHDNSIKSYVLLNRLETWDADPGTGLGWEGQGWIGTDLNRVWLRSEGERTDGQTE  265

Query  120  DRYISILYSRNIANFWDVQAGVR--YRDQASQVESKEHLDAVFALHGLAPYFFETDVSLY  177
               + +LY R+I+ +WDV AGVR  ++  ASQ        A   + GLAP  FE   + Y
Sbjct  266  SADLEVLYGRSISTWWDVVAGVRHDFKPGASQ------NFAAIGVQGLAPMKFEVSATAY  319

Query  178  LGEQQYASLKLETERDILLTQKLILKPYLEADIVLSDQSRDAEKKGLSTLKSGLQTRYEI  237
            LGE    +  +E E ++LLT +LIL+P +E      +        GLS  ++GL+ RYE 
Sbjct  320  LGEGGQTAANVEAEYELLLTNRLILQPLVEVTAYGKNDPLRGIGSGLSAAEAGLRLRYEF  379

Query  238  NKKVMPFIDLAYHYKHGQDAQEKTSERE  265
             +K  P+I + Y    G  A  +    E
Sbjct  380  TRKFAPYIGVVYERAFGNTADMRREHGE  407


 Score = 17.3 bits (33),  Expect = 7.3
 Identities = 6/18 (33%), Positives = 12/18 (67%), Gaps = 0/18 (0%)

Query  256  DAQEKTSEREWLYGAGMT  273
            D Q ++++ E LYG  ++
Sbjct  261  DGQTESADLEVLYGRSIS  278


> Q9L913 CopB [Aeromonas veronii bv. sobria]
Length=284

 Score =  107 bits (266),  Expect = 3e-30
 Identities = 68/185 (37%), Positives = 103/185 (56%), Gaps = 11/185 (6%)

Query  96   SWIGTDENKVFLKAELEKEQSSSPDRYISILYSRNIANFWDVQAGVRYRDQASQVESKEH  155
            +WIG D  K++ K++ E + S        ILY   I+++WDV  G RY    ++V  ++ 
Sbjct  105  AWIGKDYQKIWFKSDGEYKNSLQETEN-QILYGYAISSYWDVLMGARYDTYKARV-IRDG  162

Query  156  LDAVFALHGLAPYFFETDVSLYLGEQQYASLKLETERDILLTQKLILKPYLEADIVLSDQ  215
            L  VF   G APY+FE D SL++     A L LE E D+LLTQKLI +P +  +I   D 
Sbjct  163  LHLVF--RGFAPYWFELDSSLFVDSHGLALLSLEAEYDLLLTQKLI-QPQVSVNIYSKDD  219

Query  216  SRDAEKKGLSTLKSGLQTRYEINKKVMPFIDLAYH------YKHGQDAQEKTSEREWLYG  269
            S  +  +G+S L +GL+ RYEIN++  P+I + +       Y   +D +E TS+  ++ G
Sbjct  220  SDMSVGRGVSDLSAGLRLRYEINRQFAPYIGVEWKTLAGGTYDIAKDNEESTSDTRFITG  279

Query  270  AGMTF  274
            A   F
Sbjct  280  ARFWF  284


> Q7WYH0 CopB [Pseudomonas putida]
Length=295

 Score =  105 bits (261),  Expect = 2e-29
 Identities = 60/189 (32%), Positives = 103/189 (54%), Gaps = 4/189 (2%)

Query  77   DNLWALNRHGEASISSELKSWIGTDENKVFLKAELEKEQSSSPDRYISILYSRNIANFWD  136
            D L   N    ++++ +L  WIG D ++++L++E E+    + D  I  L+   I+ +WD
Sbjct  96   DKLEWQNADDGSAVAWDLSGWIGGDTDRLWLRSEGERNNGKTEDAEIQALWGHAISPWWD  155

Query  137  VQAGVRYRDQASQVESKEHLDAVFALHGLAPYFFETDVSLYLGEQQYASLKLETERDILL  196
            V  GVR   +    +S     A F + G+A Y FE + + +LGE   ++++LE + DILL
Sbjct  156  VVGGVRQDFKPGAPQSW----AAFGVQGMALYNFEAEATAFLGEGGQSAVRLEGDYDILL  211

Query  197  TQKLILKPYLEADIVLSDQSRDAEKKGLSTLKSGLQTRYEINKKVMPFIDLAYHYKHGQD  256
            T +LIL+P  E +I   +  +     GLS  ++GL+ RYEI ++  P+I + ++  +G  
Sbjct  212  TNRLILQPTAELNIYGKNDPQRGIGSGLSNTEAGLRLRYEIRREFAPYIGVTWNRTYGNT  271

Query  257  AQEKTSERE  265
            A     E E
Sbjct  272  ADYAREEDE  280


> K4MV24 CopB [Pseudomonas syringae pv. syringae]
Length=308

 Score = 93.6 bits (231),  Expect = 2e-25
 Identities = 53/200 (27%), Positives = 102/200 (51%), Gaps = 4/200 (2%)

Query  66   HGGQIYQATQWDNLWALNRHGEASISSELKSWIGTDENKVFLKAELEKEQSSSPDRYISI  125
            H   I     +D L   +  G ++++ +   W G D +++++++E E+    + +  +  
Sbjct  98   HDESINYMLLFDQLEWQDADGGSALNWDFTGWAGGDIDRLWVRSEGERLNGKTEEAEVQA  157

Query  126  LYSRNIANFWDVQAGVRYRDQASQVESKEHLDAVFALHGLAPYFFETDVSLYLGEQQYAS  185
            L+   +  +WDV  GVR   +    ++     A F L GLA Y FE + ++++GE    +
Sbjct  158  LWGHAVGPWWDVVTGVRQDFKPGDPQTW----AAFGLQGLALYNFEAEATVFIGEGGQTA  213

Query  186  LKLETERDILLTQKLILKPYLEADIVLSDQSRDAEKKGLSTLKSGLQTRYEINKKVMPFI  245
            ++LE + DILLT +LIL+P  E +    +  +     GL+  + G++ RYEI ++  P+I
Sbjct  214  MRLEGDYDILLTNRLILQPTAEVNFYGKNDPQRGTGAGLAESEVGVRLRYEIRREFAPYI  273

Query  246  DLAYHYKHGQDAQEKTSERE  265
             + ++  +G  A     E E
Sbjct  274  GVTWNRSYGNTADYARDEGE  293


> X4R623 Copper resistance protein B [Xylella fastidiosa subsp. 
fastidiosa]
Length=182

 Score = 46.6 bits (109),  Expect = 1e-09
 Identities = 31/118 (26%), Positives = 53/118 (45%), Gaps = 5/118 (4%)

Query  61   QHRHEHGGQIYQATQWDNLWALNRHGEASISSELKSWIGTDENKVFLKAELEKEQSSSPD  120
            +HR  H   +    + D L   N       +   ++WIG+D  +++L+++ E        
Sbjct  69   RHRAAHAPPLVSLVRIDRLETWNADPGRGHAWATQAWIGSDIQRLWLRSQGECYGGRCQS  128

Query  121  RYISILYSRNIANFWDVQAGVRYRDQASQVESKEHLDAVFALHGLAPYFFETDVSLYL  178
              + +LY  +I+ +WD   G R RD    V+      A   + G+ PY FE+   LYL
Sbjct  129  VAVDMLYGHDISPWWDALIGAR-RD----VQPDGRTWAALGVQGVTPYKFESAAFLYL  181


> H2FK46 Copper resistance protein B [Xylella fastidiosa subsp. 
multiplex]
Length=182

 Score = 46.6 bits (109),  Expect = 1e-09
 Identities = 31/118 (26%), Positives = 53/118 (45%), Gaps = 5/118 (4%)

Query  61   QHRHEHGGQIYQATQWDNLWALNRHGEASISSELKSWIGTDENKVFLKAELEKEQSSSPD  120
            +HR  H   +    + D L   N       +   ++WIG+D  +++L+++ E        
Sbjct  69   RHRAAHAPPLVSLVRIDRLETWNADPGRGHAWATQAWIGSDIQRLWLRSQGECYGGRCQS  128

Query  121  RYISILYSRNIANFWDVQAGVRYRDQASQVESKEHLDAVFALHGLAPYFFETDVSLYL  178
              + +LY  +I+ +WD   G R RD    V+      A   + G+ PY FE+   LYL
Sbjct  129  VAVDMLYGHDISPWWDALIGAR-RD----VQPDGRTWAALGVQGVTPYKFESAAFLYL  181



Lambda      K        H        a         alpha
   0.318    0.131    0.382    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1060521


  Database: 85284ae64eef4e456b8a610153a499b1.TrEMBL.fasta
    Posted date:  Sep 26, 2020  7:47 PM
  Number of letters in database: 5,419
  Number of sequences in database:  18



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40