ACIAD0688 / SwissProt Alignments

BLASTP 2.2.28+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: 585c2597337ac0d4f9021531066a9441.SwissProt.fasta
           3 sequences; 918 total letters



Query= ACIAD0688

Length=277
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  Q47453 Copper resistance protein B [Escherichia coli]               93.2    4e-26
  P12375 Copper resistance protein B [Pseudomonas syringae pv. to...  93.2    5e-26
  P59572 Copper resistance protein B homolog [Pseudomonas syringa...  90.1    4e-25


> Q47453 Copper resistance protein B [Escherichia coli]
Length=296

 Score = 93.2 bits (230),  Expect = 4e-26
 Identities = 55/192 (29%), Positives = 101/192 (53%), Gaps = 10/192 (5%)

Query  89   SISSELKSWIGTDENKVFLKAELEKEQSSSPDRYISILYSRNIANFWDVQAGVRYRDQAS  148
            + S  + SWIG D ++++LK+E E+    +      +L+   +  +WD+ AGVR   + +
Sbjct  109  NFSWSVNSWIGGDTDRIWLKSEGERSNGETEAAEAQLLWGHAVGPWWDLVAGVRQDFRPA  168

Query  149  QVESKEHLDAVFALHGLAPYFFETDVSLYLGEQQYASLKLETERDILLTQKLILKPYLEA  208
               +     A     GLA Y FE++++ ++     A+L+L  E D+LLT +LIL+P  E 
Sbjct  169  SARTW----AAVGFQGLALYNFESEITGFVSNGGKAALRLGGEYDVLLTNRLILQPSYEV  224

Query  209  DIVLSDQSRDAEKKGLSTLKSGLQTRYEINKKVMPFIDLAYHYKHGQDAQ------EKTS  262
            +    D       +GL+  + GL+ RYEI ++  P+I ++++  +G+ +       EK  
Sbjct  225  NFYSQDDESRGRGRGLTDTELGLRLRYEIRREFAPYIGVSWNQLYGKTSDMAKREGEKDH  284

Query  263  EREWLYGAGMTF  274
            +  +L GA + F
Sbjct  285  QVVFLAGARIWF  296


> P12375 Copper resistance protein B [Pseudomonas syringae pv. 
tomato]
Length=328

 Score = 93.2 bits (230),  Expect = 5e-26
 Identities = 55/188 (29%), Positives = 95/188 (51%), Gaps = 10/188 (5%)

Query  93   ELKSWIGTDENKVFLKAELEKEQSSSPDRYISILYSRNIANFWDVQAGVRYRDQASQVES  152
            ++  W+G D +++++++E E+    +    +  L+   I+ +WD+  GVR   +    ++
Sbjct  145  DVNGWVGGDIDRLWIRSEGERTNGKTESAELQALWGHAISPWWDLVGGVRQDFKPGSPQT  204

Query  153  KEHLDAVFALHGLAPYFFETDVSLYLGEQQYASLKLETERDILLTQKLILKPYLEADIVL  212
                 A F L GLA Y FE + + +LGE     L+LE + DILLT +LIL+P  E +   
Sbjct  205  W----AAFGLQGLALYNFEAEATAFLGEGGQTGLRLEGDYDILLTNRLILQPTAEVNFYG  260

Query  213  SDQSRDAEKKGLSTLKSGLQTRYEINKKVMPFIDLAYHYKHGQDAQ------EKTSEREW  266
                +     GLS  + G++ RYEI ++  P+I + ++  +G  A       E  SE   
Sbjct  261  QSDPQRGIGSGLSETEVGVRLRYEIRREFAPYIGVTWNRSYGNTADFAREEGEDRSEARL  320

Query  267  LYGAGMTF  274
            + G  M F
Sbjct  321  VLGVRMWF  328


> P59572 Copper resistance protein B homolog [Pseudomonas syringae 
pv. tomato (strain ATCC BAA-871 / DC3000)]
Length=294

 Score = 90.1 bits (222),  Expect = 4e-25
 Identities = 64/248 (26%), Positives = 118/248 (48%), Gaps = 14/248 (6%)

Query  22   HDAHAMNTMVSSDHHMQSTPQLDNFAETETIQNDAAMDEQHR-HE-HGGQIYQATQWDNL  79
            H +H+M    SSD   QS   +    + +     AA+   H  H+ H   I      D L
Sbjct  42   HGSHSMPMGASSDAPAQSRTPIPPVTDADR----AAVYTSHSGHQVHDSAINSYFVADKL  97

Query  80   WALNRHGEASISSELKSWIGTDENKVFLKAELEKEQSSSPDRYISILYSRNIANFWDVQA  139
               + +  ++++ +L  WIG D +++ L++E E+    + +  +  L+   +++ WDV A
Sbjct  98   EWQDANDGSALAWDLSGWIGGDIDRLLLRSEGERTNGKTEEAEVQALWGHAVSSSWDVVA  157

Query  140  GVR--YRDQASQVESKEHLDAVFALHGLAPYFFETDVSLYLGEQQYASLKLETERDILLT  197
            G R  ++  A Q        A F L G A    + + + ++G+    + +LE + D+LLT
Sbjct  158  GARQDFKPGAPQTW------AAFGLQGQAISDLDVEATAFIGDAGQTAARLEADYDLLLT  211

Query  198  QKLILKPYLEADIVLSDQSRDAEKKGLSTLKSGLQTRYEINKKVMPFIDLAYHYKHGQDA  257
              LIL+P  E +    +  +     GLST + GL+ RYEI  +  P++ + ++  +G+ A
Sbjct  212  NDLILQPTGELNFYGKNDPQRGNGSGLSTSEFGLRLRYEITPQFAPYVGVTWNRSYGKTA  271

Query  258  QEKTSERE  265
                 + E
Sbjct  272  DYAREDDE  279



Lambda      K        H        a         alpha
   0.318    0.131    0.382    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 198288


  Database: 585c2597337ac0d4f9021531066a9441.SwissProt.fasta
    Posted date:  Sep 19, 2020  2:12 PM
  Number of letters in database: 918
  Number of sequences in database:  3



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40