ACIAD0644 / TrEMBL Alignments

BLASTP 2.2.28+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: 49d3f367b74110be4bfc0efa78e60b12.TrEMBL.fasta
           18 sequences; 7,845 total letters



Query= ACIAD0644

Length=429
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  Q6FEE4 Dihydrofolate synthase/folylpolyglutamate synthase [Acin...   841    0.0  
  A0A009YIZ3 Dihydrofolate synthase/folylpolyglutamate synthase [...   676    0.0  
  N9C603 Dihydrofolate synthase/folylpolyglutamate synthase [Acin...   675    0.0  
  N9SFT6 Dihydrofolate synthase/folylpolyglutamate synthase [Acin...   673    0.0  
  A0A013SNK3 Dihydrofolate synthase/folylpolyglutamate synthase [...   662    0.0  
  A0A2T5QQH0 Dihydrofolate synthase/folylpolyglutamate synthase [...   661    0.0  
  A0A1C2TXP2 Dihydrofolate synthase/folylpolyglutamate synthase [...   660    0.0  
  A0A009HBT8 Dihydrofolate synthase/folylpolyglutamate synthase [...   660    0.0  
  G3XCM6 Dihydrofolate synthase/folylpolyglutamate synthase [Pseu...   289    1e-95
  Q50990 Dihydrofolate synthase/folylpolyglutamate synthase [Neis...   233    3e-74
  Q8GJP1 Bifunctional protein FolC, folC [Lactococcus lactis subs...   179    6e-54
  Q84FV7 Dihydrofolate synthase/folylpolyglutamate synthase [Meth...   166    7e-49
  Q9X7F5 Dihydrofolate synthase/folylpolyglutamate synthase [Meth...   163    9e-48
  A0A0M4G2P0 Dihydrofolate synthase/folylpolyglutamate synthase [...   158    3e-46
  O08416 Folylpolyglutamate synthase [Streptomyces coelicolor]         140    5e-40
  Q5VAN8 Dihydrofolate synthase/folylpolyglutamate synthase [Rhiz...   140    7e-40
  Q54614 Bifunctional folylpolyglutamate synthase/dihydrofolate s...   139    1e-39
  E9RG83 Putative FolC bifunctional protein [Rhodococcus erythrop...   135    3e-38


> Q6FEE4 Dihydrofolate synthase/folylpolyglutamate synthase [Acinetobacter 
baylyi (strain ATCC 33305 / BD413 / ADP1)]
Length=428

 Score =  841 bits (2172),  Expect = 0.0
 Identities = 427/428 (99%), Positives = 428/428 (100%), Gaps = 0/428 (0%)

Query  1    LKLDAPSIQDDLMTWLTYWGHVHVTGIDLGLERVIPVAEKLGVTQTSAKVFTVAGTNGKG  60
            +KLDAPSIQDDLMTWLTYWGHVHVTGIDLGLERVIPVAEKLGVTQTSAKVFTVAGTNGKG
Sbjct  1    MKLDAPSIQDDLMTWLTYWGHVHVTGIDLGLERVIPVAEKLGVTQTSAKVFTVAGTNGKG  60

Query  61   STTTTLASILTEQGYRVGLYQSPHIYRFNERVKLNGQEASDQQLIEAFVKVDQVRRECGL  120
            STTTTLASILTEQGYRVGLYQSPHIYRFNERVKLNGQEASDQQLIEAFVKVDQVRRECGL
Sbjct  61   STTTTLASILTEQGYRVGLYQSPHIYRFNERVKLNGQEASDQQLIEAFVKVDQVRRECGL  120

Query  121  SLSFFEATTLAAFLIFQQQACDIWVLEVGLGGRLDVVNVIDPDVAVITNIGLDHTDWLGD  180
            SLSFFEATTLAAFLIFQQQACDIWVLEVGLGGRLDVVNVIDPDVAVITNIGLDHTDWLGD
Sbjct  121  SLSFFEATTLAAFLIFQQQACDIWVLEVGLGGRLDVVNVIDPDVAVITNIGLDHTDWLGD  180

Query  181  TIEKIAFEKAGIIRSNIPVIFGGVQTLPQAIADKAAAQQAQLYVLGRDYFYQVAPDQKSW  240
            TIEKIAFEKAGIIRSNIPVIFGGVQTLPQAIADKAAAQQAQLYVLGRDYFYQVAPDQKSW
Sbjct  181  TIEKIAFEKAGIIRSNIPVIFGGVQTLPQAIADKAAAQQAQLYVLGRDYFYQVAPDQKSW  240

Query  241  NFASSGTTLKLPLGSLALENISTAVAALLVSGIDVSQAAITSGIEKAHLAGRFEQRIIKN  300
            NFASSGTTLKLPLGSLALENISTAVAALLVSGIDVSQAAITSGIEKAHLAGRFEQRIIKN
Sbjct  241  NFASSGTTLKLPLGSLALENISTAVAALLVSGIDVSQAAITSGIEKAHLAGRFEQRIIKN  300

Query  301  KAVVFDAGHNGHGVDFLLKQLRNFLEYNKQYTEVIAVFSMLADKDIKAVVNLLKPAVLHW  360
            KAVVFDAGHNGHGVDFLLKQLRNFLEYNKQYTEVIAVFSMLADKDIKAVVNLLKPAVLHW
Sbjct  301  KAVVFDAGHNGHGVDFLLKQLRNFLEYNKQYTEVIAVFSMLADKDIKAVVNLLKPAVLHW  360

Query  361  KVAALSVPRAAPVTQLLDALDGEITQQYDSIREAFSVALEESRPHQLILVCGSFHTLEAV  420
            KVAALSVPRAAPVTQLLDALDGEITQQYDSIREAFSVALEESRPHQLILVCGSFHTLEAV
Sbjct  361  KVAALSVPRAAPVTQLLDALDGEITQQYDSIREAFSVALEESRPHQLILVCGSFHTLEAV  420

Query  421  WEYLEKCQ  428
            WEYLEKCQ
Sbjct  421  WEYLEKCQ  428


> A0A009YIZ3 Dihydrofolate synthase/folylpolyglutamate synthase 
[Acinetobacter sp. 479375]
Length=428

 Score =  676 bits (1745),  Expect = 0.0
 Identities = 334/428 (78%), Positives = 379/428 (89%), Gaps = 0/428 (0%)

Query  1    LKLDAPSIQDDLMTWLTYWGHVHVTGIDLGLERVIPVAEKLGVTQTSAKVFTVAGTNGKG  60
            +K DAP I D+L TWL YWGHVHVTGIDLGLERVIPVAE LGV Q  AKVFTVAGTNGKG
Sbjct  1    MKPDAPKITDNLDTWLDYWGHVHVTGIDLGLERVIPVAEALGVMQPQAKVFTVAGTNGKG  60

Query  61   STTTTLASILTEQGYRVGLYQSPHIYRFNERVKLNGQEASDQQLIEAFVKVDQVRRECGL  120
            STTTTLASIL EQGY+VGLYQSPHIYRFNERVKL GQE  DQ LI+AFV+VDQ RR+C L
Sbjct  61   STTTTLASILNEQGYQVGLYQSPHIYRFNERVKLKGQEVDDQTLIDAFVQVDQARRQCEL  120

Query  121  SLSFFEATTLAAFLIFQQQACDIWVLEVGLGGRLDVVNVIDPDVAVITNIGLDHTDWLGD  180
            SLSFFEATTLAAF+IF+Q+ CD+WVLEVGLGGRLDVVNVIDPD+AVITNIGLDHTDWLGD
Sbjct  121  SLSFFEATTLAAFVIFKQKQCDVWVLEVGLGGRLDVVNVIDPDIAVITNIGLDHTDWLGD  180

Query  181  TIEKIAFEKAGIIRSNIPVIFGGVQTLPQAIADKAAAQQAQLYVLGRDYFYQVAPDQKSW  240
            +IEKIAFEKAGI+R +IPVIF G+Q LPQAI  +A    A+LYV  +DYFYQ A D +SW
Sbjct  181  SIEKIAFEKAGIMRPDIPVIFAGLQDLPQAIQTQADQVNAKLYVAQQDYFYQAAGDGQSW  240

Query  241  NFASSGTTLKLPLGSLALENISTAVAALLVSGIDVSQAAITSGIEKAHLAGRFEQRIIKN  300
            NFASSGTTLKLPL SLALENISTAVAA+L+SG+D+SQAA++SGI+KA LAGRFEQR+I N
Sbjct  241  NFASSGTTLKLPLSSLALENISTAVAAVLLSGLDISQAALSSGIKKAQLAGRFEQRVIAN  300

Query  301  KAVVFDAGHNGHGVDFLLKQLRNFLEYNKQYTEVIAVFSMLADKDIKAVVNLLKPAVLHW  360
            K V+FDAGHN HGV+FLLKQLRNFLEYNKQYTEV+AVFSMLADKDIK+VV  LK  VL+W
Sbjct  301  KTVIFDAGHNAHGVEFLLKQLRNFLEYNKQYTEVVAVFSMLADKDIKSVVERLKSTVLNW  360

Query  361  KVAALSVPRAAPVTQLLDALDGEITQQYDSIREAFSVALEESRPHQLILVCGSFHTLEAV  420
            K+A L+VPRAAP++QL+DAL GE    ++SI+EAF +ALE++  +QLILVCGSFHTLEAV
Sbjct  361  KIAPLNVPRAAPLSQLMDALQGETVHSFESIQEAFKLALEQTNNNQLILVCGSFHTLEAV  420

Query  421  WEYLEKCQ  428
            WEYLE+CQ
Sbjct  421  WEYLEQCQ  428


> N9C603 Dihydrofolate synthase/folylpolyglutamate synthase [Acinetobacter 
ursingii ANC 3649]
Length=425

 Score =  675 bits (1742),  Expect = 0.0
 Identities = 335/425 (79%), Positives = 375/425 (88%), Gaps = 0/425 (0%)

Query  1    LKLDAPSIQDDLMTWLTYWGHVHVTGIDLGLERVIPVAEKLGVTQTSAKVFTVAGTNGKG  60
            +K DAP I DDL TWL YWGHVHVTGIDLGLERVIPVAE LGV Q  AKVFTVAGTNGKG
Sbjct  1    MKPDAPKITDDLDTWLDYWGHVHVTGIDLGLERVIPVAEALGVMQPQAKVFTVAGTNGKG  60

Query  61   STTTTLASILTEQGYRVGLYQSPHIYRFNERVKLNGQEASDQQLIEAFVKVDQVRRECGL  120
            STTTTLASIL EQGY+VGLYQSPHIYRFNERVKL GQE  DQ LI AFV+VDQ RR+C L
Sbjct  61   STTTTLASILNEQGYQVGLYQSPHIYRFNERVKLKGQEVDDQTLIHAFVEVDQARRQCEL  120

Query  121  SLSFFEATTLAAFLIFQQQACDIWVLEVGLGGRLDVVNVIDPDVAVITNIGLDHTDWLGD  180
            SLSFFEATTLAAF+IF+Q+ CD+WVLEVGLGGRLDVVNVIDPD+AVITNIGLDHTDWLGD
Sbjct  121  SLSFFEATTLAAFVIFKQKQCDVWVLEVGLGGRLDVVNVIDPDIAVITNIGLDHTDWLGD  180

Query  181  TIEKIAFEKAGIIRSNIPVIFGGVQTLPQAIADKAAAQQAQLYVLGRDYFYQVAPDQKSW  240
            TIEKIAFEKAGI+R +IPVIF G+Q LPQAI  +A    A+LYV  +DYFYQ A D +SW
Sbjct  181  TIEKIAFEKAGIMRPDIPVIFAGLQDLPQAIQTQANQVNAKLYVAQQDYFYQAAGDGQSW  240

Query  241  NFASSGTTLKLPLGSLALENISTAVAALLVSGIDVSQAAITSGIEKAHLAGRFEQRIIKN  300
            NFASSGTTLKLPL SLALENISTAVAA+L+SG+D+SQAA++SGI+KA LAGRFEQR+I N
Sbjct  241  NFASSGTTLKLPLSSLALENISTAVAAVLLSGLDISQAALSSGIKKAQLAGRFEQRVIAN  300

Query  301  KAVVFDAGHNGHGVDFLLKQLRNFLEYNKQYTEVIAVFSMLADKDIKAVVNLLKPAVLHW  360
            K V+FDAGHN HGV+FLLKQLRNFLEYNKQYTEV+AVFSMLADKDIK+VV  LKP VL+W
Sbjct  301  KTVIFDAGHNAHGVEFLLKQLRNFLEYNKQYTEVVAVFSMLADKDIKSVVERLKPTVLNW  360

Query  361  KVAALSVPRAAPVTQLLDALDGEITQQYDSIREAFSVALEESRPHQLILVCGSFHTLEAV  420
            K+A L+VPRAAP+ QL+DAL GE    ++SI+EAF +ALE++  +QLILVCGSFHTLEAV
Sbjct  361  KIAPLNVPRAAPLFQLMDALQGETVDSFESIQEAFKLALEQTNNNQLILVCGSFHTLEAV  420

Query  421  WEYLE  425
            WEYLE
Sbjct  421  WEYLE  425


> N9SFT6 Dihydrofolate synthase/folylpolyglutamate synthase [Acinetobacter 
ursingii NIPH 706]
Length=425

 Score =  673 bits (1737),  Expect = 0.0
 Identities = 333/425 (78%), Positives = 376/425 (88%), Gaps = 0/425 (0%)

Query  1    LKLDAPSIQDDLMTWLTYWGHVHVTGIDLGLERVIPVAEKLGVTQTSAKVFTVAGTNGKG  60
            +K DAP I DDL TWL YWGHVHVTGIDLGLERVIPVAE LGV Q  AKVFTVAGTNGKG
Sbjct  1    MKPDAPKITDDLDTWLDYWGHVHVTGIDLGLERVIPVAEALGVMQPQAKVFTVAGTNGKG  60

Query  61   STTTTLASILTEQGYRVGLYQSPHIYRFNERVKLNGQEASDQQLIEAFVKVDQVRRECGL  120
            STTT LASIL EQGY+VGLYQSPHIYRFNERVKL GQE  DQ LI+AFV+VDQ RR+C L
Sbjct  61   STTTALASILNEQGYQVGLYQSPHIYRFNERVKLKGQEVDDQTLIDAFVQVDQARRQCEL  120

Query  121  SLSFFEATTLAAFLIFQQQACDIWVLEVGLGGRLDVVNVIDPDVAVITNIGLDHTDWLGD  180
            SLSFFEATTLAAF+IF+Q+ CD+WVLEVGLGGRLDVVNVIDPD+AVITNIGLDHTDWLGD
Sbjct  121  SLSFFEATTLAAFVIFKQKQCDVWVLEVGLGGRLDVVNVIDPDIAVITNIGLDHTDWLGD  180

Query  181  TIEKIAFEKAGIIRSNIPVIFGGVQTLPQAIADKAAAQQAQLYVLGRDYFYQVAPDQKSW  240
            +IEKIAFEKAGIIR +IPVIF G+Q LPQAI  +A    A+LYV  +DYFYQ A D +SW
Sbjct  181  SIEKIAFEKAGIIRPDIPVIFAGLQDLPQAIQTQANQVNAKLYVAQQDYFYQAAGDGQSW  240

Query  241  NFASSGTTLKLPLGSLALENISTAVAALLVSGIDVSQAAITSGIEKAHLAGRFEQRIIKN  300
            NFASSGTTLKLPL SLALENISTAVAA+L+SG+D+SQAA++SGI++A LAGRFEQR+I N
Sbjct  241  NFASSGTTLKLPLSSLALENISTAVAAVLLSGLDISQAALSSGIKEAQLAGRFEQRVIAN  300

Query  301  KAVVFDAGHNGHGVDFLLKQLRNFLEYNKQYTEVIAVFSMLADKDIKAVVNLLKPAVLHW  360
            K V+FDAGHN HGV+FLLKQLRNFLEYNKQYTEV+AVFSMLADKDIK+VV  LKP VL+W
Sbjct  301  KTVIFDAGHNAHGVEFLLKQLRNFLEYNKQYTEVVAVFSMLADKDIKSVVERLKPTVLNW  360

Query  361  KVAALSVPRAAPVTQLLDALDGEITQQYDSIREAFSVALEESRPHQLILVCGSFHTLEAV  420
            K+A L+VPRAAP++QL+DAL GE    ++SI+EAF +ALE++  +QLILVCGSFHTLEAV
Sbjct  361  KIAPLNVPRAAPLSQLMDALQGETVDSFESIQEAFKLALEQTNNNQLILVCGSFHTLEAV  420

Query  421  WEYLE  425
            WEYLE
Sbjct  421  WEYLE  425


> A0A013SNK3 Dihydrofolate synthase/folylpolyglutamate synthase 
[Acinetobacter sp. 826659]
Length=428

 Score =  662 bits (1709),  Expect = 0.0
 Identities = 324/424 (76%), Positives = 370/424 (87%), Gaps = 0/424 (0%)

Query  5    APSIQDDLMTWLTYWGHVHVTGIDLGLERVIPVAEKLGVTQTSAKVFTVAGTNGKGSTTT  64
            AP   D L TWL YW HVHVTGIDLGLERVIPVAEKLGVTQ +AKVFTVAGTNGKGSTTT
Sbjct  5    APLSIDSLDTWLNYWSHVHVTGIDLGLERVIPVAEKLGVTQPNAKVFTVAGTNGKGSTTT  64

Query  65   TLASILTEQGYRVGLYQSPHIYRFNERVKLNGQEASDQQLIEAFVKVDQVRRECGLSLSF  124
            TLA+IL  QGY+VGLYQSPHIYRFNERVKL G E  DQ LI+AFV+VDQ RR+C LSLSF
Sbjct  65   TLAAILNAQGYKVGLYQSPHIYRFNERVKLGGVEVDDQSLIDAFVQVDQARRDCDLSLSF  124

Query  125  FEATTLAAFLIFQQQACDIWVLEVGLGGRLDVVNVIDPDVAVITNIGLDHTDWLGDTIEK  184
            FEATTLAAF+IF+QQ CD+WVLEVGLGGRLDVVNVIDPD+AVITNIGLDHTDWLGDTIEK
Sbjct  125  FEATTLAAFVIFKQQQCDVWVLEVGLGGRLDVVNVIDPDIAVITNIGLDHTDWLGDTIEK  184

Query  185  IAFEKAGIIRSNIPVIFGGVQTLPQAIADKAAAQQAQLYVLGRDYFYQVAPDQKSWNFAS  244
            IAFEKAGIIR +IPVIF G Q LPQAI DKA + QA+LY + RDYFY++A D ++W FAS
Sbjct  185  IAFEKAGIIRPHIPVIFAGEQPLPQAIQDKAQSSQAELYTVNRDYFYKLADDGQNWYFAS  244

Query  245  SGTTLKLPLGSLALENISTAVAALLVSGIDVSQAAITSGIEKAHLAGRFEQRIIKNKAVV  304
             GTTLKLPLG+LA+ENI+ AVAA+L SG+++SQ+A+  GI+ A LAGRFEQR ++ K V+
Sbjct  245  EGTTLKLPLGTLAIENIAGAVAAILNSGLEISQSALEKGIQSARLAGRFEQRQVEGKTVI  304

Query  305  FDAGHNGHGVDFLLKQLRNFLEYNKQYTEVIAVFSMLADKDIKAVVNLLKPAVLHWKVAA  364
            FDAGHN HGV+FLLKQLRNFLEYNKQYTEV+AVFSMLADKDIK+VV+LLKP VLHWK+A 
Sbjct  305  FDAGHNPHGVEFLLKQLRNFLEYNKQYTEVVAVFSMLADKDIKSVVDLLKPTVLHWKIAE  364

Query  365  LSVPRAAPVTQLLDALDGEITQQYDSIREAFSVALEESRPHQLILVCGSFHTLEAVWEYL  424
            L+VPRAAP+ QL DAL G+  QQY +I+EAF  ALE++  +QLIL CGSFHTLEA+WEYL
Sbjct  365  LNVPRAAPIQQLNDALQGQTVQQYGNIKEAFKSALEQTNNNQLILACGSFHTLEAIWEYL  424

Query  425  EKCQ  428
            E+CQ
Sbjct  425  EECQ  428


> A0A2T5QQH0 Dihydrofolate synthase/folylpolyglutamate synthase 
[Acinetobacter pittii]
Length=428

 Score =  661 bits (1705),  Expect = 0.0
 Identities = 324/424 (76%), Positives = 368/424 (87%), Gaps = 0/424 (0%)

Query  5    APSIQDDLMTWLTYWGHVHVTGIDLGLERVIPVAEKLGVTQTSAKVFTVAGTNGKGSTTT  64
            AP   D L TWL YW HVHVTGIDLGLERVIPVAEKLGVTQ +AKVFTVAGTNGKGSTTT
Sbjct  5    APLSIDSLDTWLNYWSHVHVTGIDLGLERVIPVAEKLGVTQPNAKVFTVAGTNGKGSTTT  64

Query  65   TLASILTEQGYRVGLYQSPHIYRFNERVKLNGQEASDQQLIEAFVKVDQVRRECGLSLSF  124
            TLA+IL  QGY+VGLYQSPHIYRFNERVKL G E  DQ LI+AFV+VDQ RR+C LSLSF
Sbjct  65   TLAAILNAQGYKVGLYQSPHIYRFNERVKLGGVEVDDQSLIDAFVQVDQARRDCDLSLSF  124

Query  125  FEATTLAAFLIFQQQACDIWVLEVGLGGRLDVVNVIDPDVAVITNIGLDHTDWLGDTIEK  184
            FEATTLAAF+IF+QQ CD+WVLEVGLGGRLDVVNVIDPD+AVITNIGLDHTDWLGDTIEK
Sbjct  125  FEATTLAAFVIFKQQQCDVWVLEVGLGGRLDVVNVIDPDIAVITNIGLDHTDWLGDTIEK  184

Query  185  IAFEKAGIIRSNIPVIFGGVQTLPQAIADKAAAQQAQLYVLGRDYFYQVAPDQKSWNFAS  244
            IAFEKAGIIR +IPVIF G Q LPQAI DKA + QA LY + RDYFY++A D ++W FAS
Sbjct  185  IAFEKAGIIRPHIPVIFAGEQQLPQAIQDKAQSSQADLYTVNRDYFYKLAEDGQNWYFAS  244

Query  245  SGTTLKLPLGSLALENISTAVAALLVSGIDVSQAAITSGIEKAHLAGRFEQRIIKNKAVV  304
             GTTLKLPLG+LA+ENI+ AVAA+L SG+++SQ+A+  GI+ A LAGRFEQR +  K V+
Sbjct  245  EGTTLKLPLGTLAIENIAGAVAAILNSGLEISQSALEKGIQSARLAGRFEQRQVDGKTVI  304

Query  305  FDAGHNGHGVDFLLKQLRNFLEYNKQYTEVIAVFSMLADKDIKAVVNLLKPAVLHWKVAA  364
            FDAGHN HGV+FLLKQLRNFLEYNKQYTEV+AVFSMLADKDIK+VV+LLKP VLHWK+A 
Sbjct  305  FDAGHNPHGVEFLLKQLRNFLEYNKQYTEVVAVFSMLADKDIKSVVDLLKPTVLHWKIAE  364

Query  365  LSVPRAAPVTQLLDALDGEITQQYDSIREAFSVALEESRPHQLILVCGSFHTLEAVWEYL  424
            L+VPRAAP+ QL DAL G+  QQY +I+EAF  ALE++  +QLIL CGSFHTLEA+WEYL
Sbjct  365  LNVPRAAPIQQLNDALQGQTVQQYGNIKEAFKSALEQTNNNQLILACGSFHTLEAIWEYL  424

Query  425  EKCQ  428
            E+CQ
Sbjct  425  EECQ  428


> A0A1C2TXP2 Dihydrofolate synthase/folylpolyglutamate synthase 
[Acinetobacter pittii]
Length=428

 Score =  660 bits (1703),  Expect = 0.0
 Identities = 325/424 (77%), Positives = 367/424 (87%), Gaps = 0/424 (0%)

Query  5    APSIQDDLMTWLTYWGHVHVTGIDLGLERVIPVAEKLGVTQTSAKVFTVAGTNGKGSTTT  64
            AP   D L TWL YW HVHVTGIDLGLERVIPVAEKLGVTQ +AKVFTVAGTNGKGSTTT
Sbjct  5    APLSIDSLDTWLNYWSHVHVTGIDLGLERVIPVAEKLGVTQPNAKVFTVAGTNGKGSTTT  64

Query  65   TLASILTEQGYRVGLYQSPHIYRFNERVKLNGQEASDQQLIEAFVKVDQVRRECGLSLSF  124
            TLA+IL  QGY+VGLYQSPHIYRFNERVKL G E  DQ LI+AFV+VDQ RR+C LSLSF
Sbjct  65   TLAAILNAQGYKVGLYQSPHIYRFNERVKLGGVEVDDQSLIDAFVQVDQARRDCDLSLSF  124

Query  125  FEATTLAAFLIFQQQACDIWVLEVGLGGRLDVVNVIDPDVAVITNIGLDHTDWLGDTIEK  184
            FEATTLAAF+IF+QQ CDIWVLEVGLGGRLDVVNVIDPD+AVITNIGLDHTDWLGDTIEK
Sbjct  125  FEATTLAAFVIFKQQQCDIWVLEVGLGGRLDVVNVIDPDIAVITNIGLDHTDWLGDTIEK  184

Query  185  IAFEKAGIIRSNIPVIFGGVQTLPQAIADKAAAQQAQLYVLGRDYFYQVAPDQKSWNFAS  244
            IAFEKAGIIR  IPVIF G Q LPQAI DKA + QA LY + RDYFY++A D ++W FAS
Sbjct  185  IAFEKAGIIRPYIPVIFAGEQQLPQAIQDKAQSSQADLYTVNRDYFYKLAEDGQNWYFAS  244

Query  245  SGTTLKLPLGSLALENISTAVAALLVSGIDVSQAAITSGIEKAHLAGRFEQRIIKNKAVV  304
             GTTLKLPLG+LA+ENI+ AVAA+L SG+++SQ+A+  GI+ A LAGRFEQR +  K V+
Sbjct  245  EGTTLKLPLGTLAIENIAGAVAAILNSGLEISQSALEKGIQSARLAGRFEQRQVDGKTVI  304

Query  305  FDAGHNGHGVDFLLKQLRNFLEYNKQYTEVIAVFSMLADKDIKAVVNLLKPAVLHWKVAA  364
            FDAGHN HGV+FLLKQLRNFLEYNKQYTEV+AVFSMLADKDIK+VV+LLKP VLHWK+A 
Sbjct  305  FDAGHNPHGVEFLLKQLRNFLEYNKQYTEVVAVFSMLADKDIKSVVDLLKPTVLHWKIAE  364

Query  365  LSVPRAAPVTQLLDALDGEITQQYDSIREAFSVALEESRPHQLILVCGSFHTLEAVWEYL  424
            L+VPRAAP+ QL DAL G+  QQY +I+EAF  ALE++  +QLIL CGSFHTLEA+WEYL
Sbjct  365  LNVPRAAPIQQLNDALQGQTVQQYGNIKEAFKSALEQTNNNQLILACGSFHTLEAIWEYL  424

Query  425  EKCQ  428
            E+CQ
Sbjct  425  EECQ  428


> A0A009HBT8 Dihydrofolate synthase/folylpolyglutamate synthase 
[Acinetobacter sp. 1295259]
Length=428

 Score =  660 bits (1703),  Expect = 0.0
 Identities = 325/424 (77%), Positives = 367/424 (87%), Gaps = 0/424 (0%)

Query  5    APSIQDDLMTWLTYWGHVHVTGIDLGLERVIPVAEKLGVTQTSAKVFTVAGTNGKGSTTT  64
            AP   D L TWL YW HVHVTGIDLGLERVIPVAEKLGVTQ +AKVFTVAGTNGKGSTTT
Sbjct  5    APLSIDSLDTWLNYWSHVHVTGIDLGLERVIPVAEKLGVTQPNAKVFTVAGTNGKGSTTT  64

Query  65   TLASILTEQGYRVGLYQSPHIYRFNERVKLNGQEASDQQLIEAFVKVDQVRRECGLSLSF  124
            TLA+IL  QGY+VGLYQSPHIYRFNERVKL G E  DQ LI+AFV+VDQ RR+C LSLSF
Sbjct  65   TLAAILNAQGYKVGLYQSPHIYRFNERVKLGGVEVDDQSLIDAFVQVDQARRDCDLSLSF  124

Query  125  FEATTLAAFLIFQQQACDIWVLEVGLGGRLDVVNVIDPDVAVITNIGLDHTDWLGDTIEK  184
            FEATTLAAF+IF+QQ CDIWVLEVGLGGRLDVVNVIDPD+AVITNIGLDHTDWLGDTIEK
Sbjct  125  FEATTLAAFVIFKQQQCDIWVLEVGLGGRLDVVNVIDPDIAVITNIGLDHTDWLGDTIEK  184

Query  185  IAFEKAGIIRSNIPVIFGGVQTLPQAIADKAAAQQAQLYVLGRDYFYQVAPDQKSWNFAS  244
            IAFEKAGIIR  IPVIF G Q LPQAI DKA + QA LY + RDYFY++A D ++W FAS
Sbjct  185  IAFEKAGIIRPYIPVIFAGEQQLPQAIQDKAQSSQADLYTVNRDYFYKLAEDGQNWYFAS  244

Query  245  SGTTLKLPLGSLALENISTAVAALLVSGIDVSQAAITSGIEKAHLAGRFEQRIIKNKAVV  304
             GTTLKLPLG+LA+ENI+ AVAA+L SG+++SQ+A+  GI+ A LAGRFEQR +  K V+
Sbjct  245  EGTTLKLPLGTLAIENIAGAVAAILNSGLEISQSALEKGIQSARLAGRFEQRQVDGKTVI  304

Query  305  FDAGHNGHGVDFLLKQLRNFLEYNKQYTEVIAVFSMLADKDIKAVVNLLKPAVLHWKVAA  364
            FDAGHN HGV+FLLKQLRNFLEYNKQYTEV+AVFSMLADKDIK+VV+LLKP VLHWK+A 
Sbjct  305  FDAGHNPHGVEFLLKQLRNFLEYNKQYTEVVAVFSMLADKDIKSVVDLLKPTVLHWKIAE  364

Query  365  LSVPRAAPVTQLLDALDGEITQQYDSIREAFSVALEESRPHQLILVCGSFHTLEAVWEYL  424
            L+VPRAAP+ QL DAL G+  QQY +I+EAF  ALE++  +QLIL CGSFHTLEA+WEYL
Sbjct  365  LNVPRAAPIQQLNDALQGQTVQQYGNIKEAFKSALEQTNNNQLILACGSFHTLEAIWEYL  424

Query  425  EKCQ  428
            E+CQ
Sbjct  425  EECQ  428


> G3XCM6 Dihydrofolate synthase/folylpolyglutamate synthase [Pseudomonas 
aeruginosa]
Length=429

 Score =  289 bits (739),  Expect = 1e-95
 Identities = 174/431 (40%), Positives = 249/431 (58%), Gaps = 23/431 (5%)

Query  9    QDDLMTWLTYWGHVHVTGIDLGLERVIPVAEKLGVTQTSAKVFTVAGTNGKGSTTTTLAS  68
            Q  L  WL+Y   +H T ID+GLER   VA +LG+ + + +V TV GTNGKGST   LA 
Sbjct  3    QRSLADWLSYLEQLHPTAIDMGLERSREVARRLGLGRPAKRVVTVTGTNGKGSTCALLAE  62

Query  69   ILTEQGYRVGLYQSPHIYRFNERVKLNGQEASDQQLIEAFVKVDQVRRECGLSLSFFEAT  128
            +L EQG  VG+Y SPH+ R+NERV+++G EA D QL +AF  V+  R E  +SL++FE  
Sbjct  63   LLREQGLSVGVYSSPHLLRYNERVRIDGIEAGDAQLCDAFSAVEAARGE--ISLTYFEMG  120

Query  129  TLAAFLIFQQQACDIWVLEVGLGGRLDVVNVIDPDVAVITNIGLDHTDWLGDTIEKIAFE  188
            TLAAF +F++   D  VLEVGLGGRLD VN+ID D+A+IT+IGLDH DWLGDT E +AFE
Sbjct  121  TLAAFWLFERAGLDFAVLEVGLGGRLDAVNLIDADLALITSIGLDHADWLGDTRESVAFE  180

Query  189  KAGIIRSNIPVIFGGVQTLPQAIADKAAAQQAQLYVLGRDYFYQVAPDQKSW-NFASSGT  247
            KAGI+R+  P + G +   PQ + ++ AA  A LY+ GRDY   +A     W   A+ G 
Sbjct  181  KAGILRAGKPALCGDLDP-PQPLLEQVAALGAPLYLRGRDYDLALADHGWHWRGLAADGQ  239

Query  248  TL---KLPLGSLALENISTAVAALLVSGIDVSQAAITSGIEKAHLAGRFEQRII----KN  300
             L    LPL  L +EN + A+ A  +  +      +   + +  + GR ++R +    + 
Sbjct  240  ALALHDLPLLGLPMENAALALQAYALLELPWQAERLAEALRRTRVTGRLDRRDLSWNGQP  299

Query  301  KAVVFDAGHNGHGVDFLLKQLRNFLEYNKQYTEVIAVFSMLADKDIKAVVNLLKPAVLHW  360
            + ++ D GHN     +L ++LR      +     +AVF +LADKD+  V+  L   V  W
Sbjct  300  RQLLLDVGHNPQAAQYLAQRLRAAAPRGR----YLAVFGLLADKDLDGVLEPLTGLVQDW  355

Query  361  KVAALSVPRAAPVTQLLDALDGEITQQ-----YDSIREAFSVALEESRPHQLILVCGSFH  415
             VA L  PR+ P  +L  AL   I +Q     +  I  A      ++    +IL+ GSF+
Sbjct  356  AVAPLPTPRSRPAAELEAAL---ILRQVPASSHADIAAALDAQCAKATADDVILLFGSFY  412

Query  416  TLEAVWEYLEK  426
            ++    E+L +
Sbjct  413  SVAEGLEWLAR  423


> Q50990 Dihydrofolate synthase/folylpolyglutamate synthase [Neisseria 
gonorrhoeae]
Length=424

 Score =  233 bits (594),  Expect = 3e-74
 Identities = 159/431 (37%), Positives = 226/431 (52%), Gaps = 28/431 (6%)

Query  12   LMTWLTYWGHVHVTG-IDLGLERVIPVAEKLGVTQTSAKVFTVAGTNGKGSTTTTLASIL  70
            L  WL++    H  G ID+GLERV  V +++ +T     V  VAGTNGKGS    L  I 
Sbjct  4    LQDWLSHLETAHSGGLIDMGLERVSEVKKRMNLTP-QCPVVVVAGTNGKGSVCAYLTQIY  62

Query  71   TEQGYRVGLYQSPHIYRFNERVKLNGQEASDQQLIEAFVKVDQVRRECGLSLSFFEATTL  130
             + G++ G   SPH+  +NER+ +N +  SD  +I +F +++  R E  +SL++FE   L
Sbjct  63   KQAGFKTGTLTSPHLLHYNERIAINAEPVSDDTIIASFERIEAARGE--ISLTYFEFNAL  120

Query  131  AAFLIFQQQACDIWVLEVGLGGRLDVVNVIDPDVAVITNIGLDHTDWLGDTIEKIAFEKA  190
            AA  IF ++  D+ +LEVGLGGRLD VN  D D AV+T++ LDH  +LGDT+E++ FEKA
Sbjct  121  AAVDIFIREQVDVMILEVGLGGRLDAVNGFDGDCAVVTSVDLDHQAFLGDTVEQVGFEKA  180

Query  191  GIIRSNIPVIFGGVQTLPQAIADKAAAQQAQLYVLGRDYFYQVAPDQKSWNF--------  242
            G+ RS  P I  G    P ++   A A  A+L ++ RD+ +  A +   WN+        
Sbjct  181  GVFRSGKPAIC-GQNPAPASLVAHAEAIGAKLLMVQRDFEFH-AMENIQWNYRFRPQHSD  238

Query  243  --ASSGTTLKLPL--GSLALENISTAVAAL--LVSGIDVSQAAITSGIEKAHLAGRFEQR  296
              A +   L  P   G+  L N + A+  L  L   + V   AI  G+      GRF Q 
Sbjct  239  GPARNRNALPFPALRGAYQLSNAACALTVLECLDDRLPVDIGAIKRGLLLVENPGRF-QV  297

Query  297  IIKNKAVVFDAGHNGHGVDFLLKQLRNFLEYNKQYTEVIAVFSMLADKDIKAVVNLLKPA  356
            +      V D GHN H    L + L N L Y ++ T   AVFSML+DKDI  V   +K  
Sbjct  298  LPGRPLTVLDVGHNPHAARALRRNLIN-LAYAQKRT---AVFSMLSDKDIDGVSETVKDQ  353

Query  357  VLHWKVAALSVPRAAPVTQLLDALDG---EITQQYDSIREAFSVALEESRPHQLILVCGS  413
               W +A L VPR      L   L+    E  Q + ++R+A+  A  ++     I+V GS
Sbjct  354  FDEWYIAPLDVPRGMTADALKAKLEQHHIENIQTFAAVRDAYRAAASKAGEDDRIVVFGS  413

Query  414  FHTLEAVWEYL  424
            FHT+  V   L
Sbjct  414  FHTVADVMSVL  424


> Q8GJP1 Bifunctional protein FolC, folC [Lactococcus lactis subsp. 
cremoris]
Length=427

 Score =  179 bits (454),  Expect = 6e-54
 Identities = 136/414 (33%), Positives = 212/414 (51%), Gaps = 26/414 (6%)

Query  30   GLERVIPVAEKLGVTQTSAKVFTVAGTNGKGSTTTTLASILTEQGYRVGLYQSPHIYRFN  89
            GL RV  + E LG  + S  +  +AGTNGKGST     SI  + G +V  + SP I  F 
Sbjct  21   GLNRVSALLELLGNPEESLSMIHIAGTNGKGSTVAFTRSIFMQAGLKVASFTSPFITTFG  80

Query  90   ERVKLNGQEASDQQLIEAFVK-----VDQVRRECGLS-LSFFEATTLAAFLIFQQQACDI  143
            ER+ +N Q   D++LI  +VK     V+Q+  +  L+ ++ FE  T  AF  F  +  D+
Sbjct  81   ERMSINAQPIPDEKLIY-YVKMIQPLVEQLDNDAELTGITEFEIITAMAFKYFADEKVDL  139

Query  144  WVLEVGLGGRLDVVNVIDPDVAVITNIGLDHTDWLGDTIEKIAFEKAGIIRSNIPVIFGG  203
             V+EVGLGG LD  NVI P V+ IT IGLDH D LG TIE+IA +KAGII++ IPV+ G 
Sbjct  140  AVIEVGLGGLLDSTNVIRPVVSGITTIGLDHIDILGSTIEEIAAQKAGIIKAGIPVVVGN  199

Query  204  VQTLP-QAIADKAAAQQAQLYVLGRDYFYQVAPDQKSWNFASSGTTLKLP---LGSLALE  259
            ++    + I + A    A++Y    DY  ++   +    FA     L L    +G   +E
Sbjct  200  IELKALRVIWEVARKNTARIYQYPYDYRTELKEHEHFDFFAGQEAILDLEKSLIGLHQVE  259

Query  260  NISTAVAALLV----SGIDVSQAAITSGIEKAHLAGRFEQRIIKNKAVVFDAGHNGHGVD  315
            N   A+   LV     GI++++  I +GI +A    R E ++ +N  ++ D  HN H ++
Sbjct  260  NAGMAIELALVYANKVGINLNEEIIRAGIREAFWPARME-KLGENPLILLDGAHNVHAMN  318

Query  316  FLLKQLRNFLEYNKQYTEVIAVFSMLADKDIKAVVNLLKPAV-LHWKVAALSVPRAAPVT  374
             LL+ L       K    +  +FS +  KDI+ ++ +L+        +     P+A  + 
Sbjct  319  RLLENLGKEFPDKK----ITIIFSAITTKDIRQMIKMLQTVKNSRLILTTFDYPKALDLK  374

Query  375  --QLLDALDGEITQQYDSIREAFSVALEESRPHQLILVCGSFHTLEAVWEYLEK  426
              + L+    E+   ++        AL+E    +L+L+ GS +    V E+L+K
Sbjct  375  DFRYLEDEGVELAPSWELAIVRAQKALDED---ELLLITGSLYFSSQVREFLKK  425


> Q84FV7 Dihydrofolate synthase/folylpolyglutamate synthase [Methylorubrum 
extorquens]
Length=441

 Score =  166 bits (419),  Expect = 7e-49
 Identities = 132/431 (31%), Positives = 207/431 (48%), Gaps = 40/431 (9%)

Query  22   VHVTGIDLGLERVIPVAEKLGVTQTSAK-VFTVAGTNGKGSTTTTLASILTEQGYRVGLY  80
            +H   IDL L R+  +   L   +     V  VAGTNGKGST   + +IL   G    +Y
Sbjct  14   LHPRTIDLSLGRIQRLLAALNHPERRLPPVIHVAGTNGKGSTIAFMRAILEAGGLAAHVY  73

Query  81   QSPHIYRFNERVKL----NGQEASDQQLIEAFVKVDQVRRECGLSLSFFEATTLAAFLIF  136
             SPH+ RF+ER++L     G   ++ +L +AF + +   +  G  ++ FE TT AA L+F
Sbjct  74   TSPHLVRFHERIRLGGIGGGHYVAEDRLADAFARCEAANK--GDPITVFEITTAAALLLF  131

Query  137  QQQACDIWVLEVGLGGRLDVVNVID-PDVAVITNIGLDHTDWLGDTIEKIAFEKAGIIRS  195
             +   D+ +LEVGLGGR+D  NVID P  AV+T IG DH ++LGDT+E +A EKAGI + 
Sbjct  132  SECPADVLLLEVGLGGRVDATNVIDHPACAVVTPIGRDHAEYLGDTVEAVAMEKAGIFKR  191

Query  196  NIPVIFGGVQTLPQAIADKAAAQQAQ----LYVLGRDYFYQVAPDQKSWNFASSGTTLKL  251
              P +   +     A AD    +QA+    + V   +  + V  +   + +        L
Sbjct  192  GCPAV---IAAQDYAGADAVLCRQAERIGAVPVRIGNQDFSVHEESGRFVYQDEIDLFDL  248

Query  252  PLGSLA----LENISTAVAALLVSGI-DVSQAAITSGIEKAHLAGRFE--------QRII  298
            P   LA    L N  TA+AAL  +G  D+   A+ +G+      GR +        +R+ 
Sbjct  249  PRPRLAGRHQLTNAGTAIAALRAAGFGDIGTVALEAGLRNVDWPGRLQRLVRGALAERMP  308

Query  299  KNKAVVFDAGHNGHGVDFLLKQLRNFLEYNKQYTEVIAVFSMLADKD----IKAVVNLLK  354
            K+  +  D GHN  G   L   + +  E  +    ++ +  +L  KD    +K  V L +
Sbjct  309  KDAELWLDGGHNADGGRILAAAMADLGE--RSDVPLVLIVGLLGTKDAEGFLKNFVGLAR  366

Query  355  PAV---LHWKVAALSVPRAAPVTQLLDALDGEITQQYDSIREAFSVALEESRPHQLILVC  411
              V   +  ++AA      A + + +  L  E+    ++   A +  + E  P   +L+C
Sbjct  367  SLVAVPITGQMAARPAEEVAEIAREV-GLSAEVAPSVEAALAALADTVFERPPR--VLIC  423

Query  412  GSFHTLEAVWE  422
            GS +   AV E
Sbjct  424  GSLYLAGAVLE  434


> Q9X7F5 Dihydrofolate synthase/folylpolyglutamate synthase [Methylorubrum 
extorquens]
Length=467

 Score =  163 bits (412),  Expect = 9e-48
 Identities = 136/420 (32%), Positives = 194/420 (46%), Gaps = 21/420 (5%)

Query  22   VHVTGIDLGLERVIPVAEKLGVTQ-TSAKVFTVAGTNGKGSTTTTLASILTEQGYRVGLY  80
            +H   ID  L R+  +   LG  +     V  VAGTNGKGS    + ++L   G RV  Y
Sbjct  36   LHTQEIDYSLHRMHRLLADLGSPERVLPPVIHVAGTNGKGSAIAVMRTLLEAGGLRVHTY  95

Query  81   QSPHIYRFNERVKLNGQEASDQQLIEAFVKVDQVRREC--GLSLSFFEATTLAAFLIFQQ  138
             SPH+  FNER++L    AS     +          EC  G  ++ FE  T AAF +F  
Sbjct  96   TSPHLVHFNERIRLASINASRPVADDVLENALMYCLECNRGRPITQFEVVTAAAFHMFAT  155

Query  139  QACDIWVLEVGLGGRLDVVNVIDPDVA-VITNIGLDHTDWLGDTIEKIAFEKAGIIRSNI  197
               D+ +LE GLGGR D  NV+   VA VIT+I  DH  +LG +IE+IA EKAGI R  I
Sbjct  156  HDADVVLLEAGLGGRCDATNVVPKPVATVITSISYDHETYLGSSIEQIAVEKAGIFRPGI  215

Query  198  PVIFGGVQ--TLPQAIADKAAAQQAQLYVLGRDYFYQVAPDQKSWNFASSGTTLKLP--L  253
            PVI G  Q       I+  A+   A ++  GRD+  +V  D+  +  +    +  LP   
Sbjct  216  PVIVGPQQYFVAENVISRAASLIGAPIHKAGRDFRGKVRGDKFVYIDSEGLHSWPLPGLA  275

Query  254  GSLALENISTAVAALLVSGIDVSQAAITSGIEKAH-------LAGRFEQRIIKNKAVVFD  306
            G   ++N STA+A LL +G+    A +   +           L GR  + +  +  VV D
Sbjct  276  GEHQIDNSSTAIATLLTTGLMPDSATVRRALPLVRWPGRLQPLTGRVAEMLPPDTDVVVD  335

Query  307  AGHNGHGVDFLLKQLRNFLEYNKQYTEVIAVFSMLADKDIKAVVNLLKPAVLHWKVAALS  366
             GHN      +  +LR   E +++ T  + +  MLA KD  A +     +V       L 
Sbjct  336  GGHNPGAAAVIASELRRRNETDQRST--VLILGMLATKDAAAFLAPFLGSVFRVVTVPLR  393

Query  367  VPRAAPVTQLLDALDGEI---TQQYDSIREAFSVALEESRPHQL-ILVCGSFHTLEAVWE  422
                +   Q L A+ G+I        S+ EA + A   +   +L +L  GS H    V E
Sbjct  394  PDLISHDPQTLAAIAGDIGLSGHAASSVTEAIAEAGRLTSTLKLRLLFIGSLHLAGEVLE  453


> A0A0M4G2P0 Dihydrofolate synthase/folylpolyglutamate synthase 
[Rickettsia endosymbiont of Ixodes pacificus]
Length=426

 Score =  158 bits (399),  Expect = 3e-46
 Identities = 113/365 (31%), Positives = 181/365 (50%), Gaps = 24/365 (7%)

Query  50   VFTVAGTNGKGSTTTTLASILTEQGYRVGLYQSPHIYRFNERVKLNGQEASDQQLIEAFV  109
            V  +AGTNGKGS+T  L SI    GY+V  Y SPH+  FNER+ + G++ SD +L +   
Sbjct  39   VIHIAGTNGKGSSTAMLKSIFMLAGYKVHCYTSPHLLEFNERIVVAGEKISDNELWQVCE  98

Query  110  KVDQVRRECGLSLSFFEATTLAAFLIFQQQACDIWVLEVGLGGRLDVVNVID-PDVAVIT  168
            +V     +  +  SFFE TT AAFL F++   DI +LE GLGGRLD  N+++ P + +IT
Sbjct  99   QVRVASEKFNIEPSFFEGTTAAAFLAFEKTKADILILETGLGGRLDATNIVERPLITLIT  158

Query  169  NIGLDHTDWLGDTIEKIAFEKAGIIRSNIPVIFGGVQTLPQAIADKAAAQQAQLYVLGRD  228
             I  DH + LG+T+  IA EKAGI++S +P +   +Q L       A A++ ++     +
Sbjct  159  PISYDHMNMLGNTLPLIAIEKAGIMKSCVPCVI-SMQALEVYETLFAKAEELEVPSFCYE  217

Query  229  YFYQVAPDQKSWNFASSGTTLKLP----LGSLALENISTAVA--ALLVSGIDVSQAAITS  282
            Y   +      + ++S   + + P    LG   L N ++ +A  +L+    ++S   I+ 
Sbjct  218  YDSGIKKTDNGFIYSSRNFSYEFPTPSLLGGHQLINAASVIALISLINKQFNISNEIISK  277

Query  283  GIEKAHLAGRFE--------QRIIKNKAVVFDAGHNGHGVDFLLKQLRNFLEYNKQYTEV  334
            G++      R E        + I  N  +  DA HN  G   L   +R+ L+     + +
Sbjct  278  GLQNTIWGARIEKIEPKKYSKLIGDNVQIWVDAAHNNSGAQVLANWIRDNLK-----SPI  332

Query  335  IAVFSMLADKDIKAVVNLLKPAVLH-WKVAALSVP--RAAPVTQLLDALDGEITQQYDSI  391
              +  M  +++I+   +  K   +  + V  LS P   +A    L     G    + DS+
Sbjct  333  YLILGMTKNRNIEEFCSYFKGLTIKGYGVKVLSEPLSHSAETINLEGRKSGIDFSESDSL  392

Query  392  REAFS  396
             EA S
Sbjct  393  EEAIS  397


> O08416 Folylpolyglutamate synthase [Streptomyces coelicolor]
Length=444

 Score =  140 bits (354),  Expect = 5e-40
 Identities = 115/377 (31%), Positives = 170/377 (45%), Gaps = 27/377 (7%)

Query  19   WGHVHVTGIDLGLERVIPVAEKLGVTQTSAKVFTVAGTNGKGSTTTTLASILTEQGYRVG  78
            WG    T ++  + R+  + + LG  Q S     + GTNGK ST   + ++L     R G
Sbjct  16   WGE---TKLEPSVTRIAALMDVLGEPQRSYPSIHITGTNGKTSTARMIEALLGAFDLRTG  72

Query  79   LYQSPHIYRFNERVKLNGQEASDQQLIEAFVK----VDQVRRECGLSLSFFEATTLAAFL  134
             Y SPH+    ER+ L+G   S ++ IE +      V+ V  +     SFFE  T  A+ 
Sbjct  73   RYTSPHVQSITERISLDGAPISAERFIETYEDIKPYVEMVDAQRSTGCSFFEVLTGMAYA  132

Query  135  IFQQQACDIWVLEVGLGGRLDVVNVIDPDVAVITNIGLDHTDWLGDTIEKIAFEKAGIIR  194
             F     D+ V+EVG+GG  D  NVID DVAV+T I LDHTD LG T  +IA EKAGI++
Sbjct  133  AFADAPVDVAVVEVGMGGSWDATNVIDGDVAVVTPIDLDHTDRLGGTPGEIAVEKAGIVK  192

Query  195  SNIPVIFGGVQT-LPQAIADKAAAQQAQLYVLGRDY--FYQVAPDQKSW----NFASSGT  247
             +  VI         Q +  KA    A +   G ++    +  P   SW          T
Sbjct  193  QDATVILAQQPVDAAQVMLKKAVDVNATVAREGLEFGVVAREVPSAGSWPPCAGLGGEYT  252

Query  248  TLKLPL-GSLALENISTAVAAL---LVSGIDVSQAAITSGIEKAHLA----GRFEQRIIK  299
             + LPL G+    N + A+AA+      G    +      + KA  +    GR E  + +
Sbjct  253  EVYLPLHGAHQAHNAAVALAAVEAFFGVGAQRPEPLDVDTVRKAFASVASPGRMEV-VRR  311

Query  300  NKAVVFDAGHNGHGVDFLLKQLRNFLEYNKQYTEVIAVFSMLADKDIKAVVNLLKPAVLH  359
            +  VV DA HN  G     + +        Q++ +I V    ADK+++ ++   +P    
Sbjct  312  SPTVVLDAAHNPAGARVTAEAVGEAF----QFSRLIGVVGASADKNVRGLLEAFEPVFAE  367

Query  360  WKVAALSVPRAAPVTQL  376
              V   S  RA    +L
Sbjct  368  VVVTQNSSHRAMDADEL  384


> Q5VAN8 Dihydrofolate synthase/folylpolyglutamate synthase [Rhizobium 
etli]
Length=450

 Score =  140 bits (353),  Expect = 7e-40
 Identities = 104/344 (30%), Positives = 165/344 (48%), Gaps = 25/344 (7%)

Query  22   VHVTGIDLGLERVIPVAEKLGVTQTSAK-VFTVAGTNGKGSTTTTLASILTEQGYRVGLY  80
            +H  G DL L+R+  + ++LG        V  VAGTNGKGS T    ++L   GY   ++
Sbjct  22   LHPKGFDLSLDRITRLLDRLGNPHRKLPPVVHVAGTNGKGSVTAFCRALLEAGGYSAHVH  81

Query  81   QSPHIYRFNERVKLNGQEASDQQLIEAFVKVDQVRR----ECGLSLSFFEATTLAAFLIF  136
             SPH+  ++ER ++ G      QL++  V  + VRR      G  ++ FE  T   F++F
Sbjct  82   TSPHLVNWHERYRI-GVAGGRGQLVDDAVFAEAVRRVAEANAGQHITVFEILTAVTFILF  140

Query  137  QQQACDIWVLEVGLGGRLDVVNVI-DPDVAVITNIGLDHTDWLGDTIEKIAFEKAGIIRS  195
             +   D  ++EVGLGGR D  NVI DP V+VI  I LDH  +LGD +E IA EKAGI++ 
Sbjct  141  SEHPADAAIIEVGLGGRFDATNVISDPAVSVIMPISLDHQPYLGDRVELIAAEKAGIMKP  200

Query  196  NIPVIFGGVQTLPQAIADKAAAQQAQLY----VLGRDYFYQVAPDQKSWNFASSGTTLKL  251
             +PV+ G  +    A  D   +   +L+    V G+D+       +  +        L L
Sbjct  201  GLPVVIGHQEY--DAALDVLMSTAERLHCPSAVFGQDFMAHEEYGRLVYQDEYGLADLPL  258

Query  252  PL--GSLALENISTAVAALLVSGIDVSQAAITSGIEKAHLAGRF----EQRIIKN----K  301
            P   G     N + A+ A+  +G  V++  +   +      GR     E R++ +     
Sbjct  259  PRLPGRHQYANAAAAIRAVKAAGFTVTETMMEKAMNCVEWPGRLQRLSEGRLLSHAPLGA  318

Query  302  AVVFDAGHNGHGVDFLLKQLRNFLEYNKQYTEVIAVFSMLADKD  345
             +  D GHN    + + + + +F E  +Q   +  +  M+  KD
Sbjct  319  EIWVDGGHNPGAGEVIAEAMASFEE--RQPRPLFLIIGMINTKD  360


> Q54614 Bifunctional folylpolyglutamate synthase/dihydrofolate 
synthase [Streptococcus pneumoniae]
Length=440

 Score =  139 bits (351),  Expect = 1e-39
 Identities = 104/342 (30%), Positives = 174/342 (51%), Gaps = 25/342 (7%)

Query  30   GLERVIPVAEKLGVTQTSAKVFTVAGTNGKGSTTTTLASILTEQGYRVGLYQSPHIYRFN  89
            GLER++ +    G      KV  + GTNGKGST   L  +L + G RVG++ SP++  + 
Sbjct  21   GLERMVELLALRGNPHLKLKVLHIGGTNGKGSTIAFLKKMLEKLGLRVGVFSSPYLIHYT  80

Query  90   ERVKLNGQEASDQQLIEAFVKVDQ--VRRECGLSL---SFFEATTLAAFLIFQQQACDIW  144
            +++ +NG+  S+ +L EA +   Q  +  E   +L   + FE  T  A+  F  +  D+ 
Sbjct  81   DQISINGESISEARL-EALMADYQSLLEGEAVANLQGTTEFEIITALAYDYFASEQVDVA  139

Query  145  VLEVGLGGRLDVVNVIDPDVAVITNIGLDHTDWLGDTIEKIAFEKAGIIRSNIPVIFGGV  204
            ++EVG+GG  D  NV  P +  IT IGLDH   LGDT+E IA +KAGII+  +P++ G +
Sbjct  140  IMEVGMGGLFDSTNVCQPILTGITTIGLDHVALLGDTLEAIAEQKAGIIKQGMPLVTGRI  199

Query  205  QTLPQAIADK-AAAQQAQLYVLGRDY---FYQVAPDQKSWNFASS---GTTLKLPLGSLA  257
                 A+ D+ A  + A     G DY     +     + +++ S+   G      LG   
Sbjct  200  APEALAVIDRIAEGKDAPRLAYGTDYQVRHQESVVTGEVFDYTSAVRQGRFQTSLLGLYQ  259

Query  258  LENISTAVAAL----LVSGIDV-SQAAITSGIEKAHLAGRFEQRIIKNKAVVFDAGHNGH  312
            +EN   A+A L       G ++ S   +   +E+    GR E  + ++  ++ D  HN H
Sbjct  260  IENAGMAIALLDTFCQEDGRELASNDFLGQALEETSWPGRLE-IVSRDPLMILDGAHNPH  318

Query  313  GVDFLLKQLR-NFLEYNKQYTEVIAVFSMLADKDIKAVVNLL  353
             +  LL  L+  F +Y+K+      +F+ +  K ++ +++LL
Sbjct  319  AIKALLVTLQERFADYHKE-----ILFTCIKTKALEDMLDLL  355


 Score = 18.1 bits (35),  Expect = 10.0
 Identities = 9/24 (38%), Positives = 11/24 (46%), Gaps = 0/24 (0%)

Query  207  LPQAIADKAAAQQAQLYVLGRDYF  230
            L Q + DK   +Q    V G  YF
Sbjct  397  LEQNVTDKKEEKQTVRIVTGSLYF  420


> E9RG83 Putative FolC bifunctional protein [Rhodococcus erythropolis]
Length=479

 Score =  135 bits (341),  Expect = 3e-38
 Identities = 120/405 (30%), Positives = 184/405 (45%), Gaps = 34/405 (8%)

Query  25   TGIDLGLERVIPVAEKLGVTQTSAKVFTVAGTNGKGSTTTTLASILTEQGYRVGLYQSPH  84
            T I+  L R+  + + LG  Q +     V GTNGK S T  + S++T    R G   SPH
Sbjct  38   TKIEPSLTRIEALMDVLGSPQHNYPSVHVTGTNGKTSVTRMIDSLMTALHRRTGRTTSPH  97

Query  85   IYRFNERVKLNGQEASDQQLIEAFVKVD--------QVRRECGLSLSFFEATTLAAFLIF  136
            +    ER+ ++G   S +  ++ F +++        Q     G ++S FE  T  A+  F
Sbjct  98   LQIATERISIDGHPISPRLYVDTFREIEPYVQMIDAQSEEAGGPAMSKFEVLTAMAYAAF  157

Query  137  QQQACDIWVLEVGLGGRLDVVNVIDPDVAVITNIGLDHTDWLGDTIEKIAFEKAGIIR--  194
             +   D+ V+EVGLGGR D  NVID  VAVIT I LDH ++LG  +  IA EKAGII+  
Sbjct  158  AEAPVDVAVVEVGLGGRWDATNVIDGQVAVITPISLDHAEYLGTDLAGIAEEKAGIIKKG  217

Query  195  -------SNIPVIFGGVQTLPQAIADKAAAQQAQLYVLGRDY---FYQVAPDQKSWNFAS  244
                     + +I      + + +  +A   +A +   G ++     Q+A   +      
Sbjct  218  REDLVPVDTVAIIAEQTPEVMEVLLRRAVEVEAAVAREGSEFKVLARQIAVGGQQLELQG  277

Query  245  -SG--TTLKLPL-GSLALENISTAVAAL---LVSGID--VSQAAITSGIEKAHLAGRFEQ  295
             SG  T + LPL G     N + A+AA+     +G D  + Q AI +G       GR E 
Sbjct  278  LSGVYTDIFLPLHGEHQAHNAALALAAVEAFFGAGPDRQLDQDAIRNGFASVVNPGRLE-  336

Query  296  RIIKNKAVVFDAGHNGHGVDFLLKQLRNFLEYNKQYTEVIAVFSMLADKDIKAVVNLLKP  355
            R+     V  DA HN  G   L   L    ++ K    ++ V S++ADKD+ A++   + 
Sbjct  337  RVRSAPTVFLDAAHNPDGARALAAALAAEFDFRK----LVGVVSVMADKDVDAILTAFES  392

Query  356  AVLHWKVAALSVPRAAPVTQLLDALDGEITQQYDSIREAFSVALE  400
                  V     PRA  V +L +    +   +   +    + ALE
Sbjct  393  VFDEIVVTHNGSPRAMDVEELANIAVAKFGDERVVVAPVLADALE  437



Lambda      K        H        a         alpha
   0.322    0.136    0.399    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2604693


  Database: 49d3f367b74110be4bfc0efa78e60b12.TrEMBL.fasta
    Posted date:  Sep 28, 2020  3:07 PM
  Number of letters in database: 7,845
  Number of sequences in database:  18



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40