ACIAD0644 / SwissProt Alignments

BLASTP 2.2.28+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: 2f74d9bb696d5c4f4be6b9665608d68c.SwissProt.fasta
           15 sequences; 7,603 total letters



Query= ACIAD0644

Length=429
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  P08192 Dihydrofolate synthase/folylpolyglutamate synthase [Esch...   312    8e-105
  P43775 Dihydrofolate synthase/folylpolyglutamate synthase [Haem...   256    6e-83 
  Q89AT2 Dihydrofolate synthase/folylpolyglutamate synthase [Buch...   240    5e-77 
  Q8K9X3 Dihydrofolate synthase/folylpolyglutamate synthase [Buch...   233    2e-74 
  P57265 Dihydrofolate synthase/folylpolyglutamate synthase [Buch...   210    1e-65 
  Q05865 Dihydrofolate synthase/folylpolyglutamate synthase [Baci...   160    5e-47 
  P15925 Folylpolyglutamate synthase [Lactobacillus casei]             159    9e-47 
  Q9UTD0 Probable dihydrofolate synthetase [Schizosaccharomyces p...   146    5e-42 
  Q9HS44 Probable folylpolyglutamate synthase / Probable dihydrop...   144    4e-40 
  D4GW05 Probable folylpolyglutamate synthase / Probable dihydrop...   143    9e-40 
  Q12676 Dihydrofolate synthetase [Saccharomyces cerevisiae (stra...   139    1e-39 
  F4JYE9 Dihydrofolate synthetase [Arabidopsis thaliana]               125    1e-34 
  I6Y0R5 Dihydrofolate synthase/folylpolyglutamate synthase [Myco...   125    1e-34 
  Q8W035 Folylpolyglutamate synthase [Arabidopsis thaliana]            122    8e-34 
  F4J2K2 Folylpolyglutamate synthase [Arabidopsis thaliana]            115    7e-31 


> P08192 Dihydrofolate synthase/folylpolyglutamate synthase [Escherichia 
coli (strain K12)]
Length=422

 Score =  312 bits (800),  Expect = 8e-105
 Identities = 181/421 (43%), Positives = 253/421 (60%), Gaps = 13/421 (3%)

Query  6    PSIQDDLMTWLTYWGHVHVTGIDLGLERVIPVAEKLGVTQTSAKVFTVAGTNGKGSTTTT  65
            P     L +WL+Y  ++H   IDLGLERV  VA +LGV + +  VFTVAGTNGKG+T  T
Sbjct  7    PQAASPLASWLSYLENLHSKTIDLGLERVSLVAARLGVLKPAPFVFTVAGTNGKGTTCRT  66

Query  66   LASILTEQGYRVGLYQSPHIYRFNERVKLNGQEASDQQLIEAFVKVDQVRRECGLSLSFF  125
            L SIL   GY+VG+Y SPH+ R+ ERV++ GQE  +     +F +++  R +  +SL++F
Sbjct  67   LESILMAAGYKVGVYSSPHLVRYTERVRVQGQELPESAHTASFAEIESARGD--ISLTYF  124

Query  126  EATTLAAFLIFQQQACDIWVLEVGLGGRLDVVNVIDPDVAVITNIGLDHTDWLGDTIEKI  185
            E  TL+A  +F+Q   D+ +LEVGLGGRLD  N++D DVAV+T+I LDHTDWLG   E I
Sbjct  125  EYGTLSALWLFKQAQLDVVILEVGLGGRLDATNIVDADVAVVTSIALDHTDWLGPDRESI  184

Query  186  AFEKAGIIRSNIPVIFGGVQTLPQAIADKAAAQQAQLYVLGRDYFYQVAPDQKSWNFASS  245
              EKAGI RS  P I G  + +P  IAD A  + A L   G ++ Y V      W F+ +
Sbjct  185  GREKAGIFRSEKPAIVGEPE-MPSTIADVAQEKGALLQRRGVEWNYSVT--DHDWAFSDA  241

Query  246  -GTTLKLPLGSLALENISTAVAALLVSGIDVSQAAITSGIEKAHLAGRFEQRIIKNKAVV  304
             GT   LPL  +   N +TA+AAL  SG++VS+ AI  GI  A L GRF Q + ++  V+
Sbjct  242  HGTLENLPLPLVPQPNAATALAALRASGLEVSENAIRDGIASAILPGRF-QIVSESPRVI  300

Query  305  FDAGHNGHGVDFLLKQLRNFLEYNKQYTEVIAVFSMLADKDIKAVVNLLKPAVLHWKVAA  364
            FD  HN H  ++L  +++   +  +    V+AV  ML DKDI   +  LK  V  W  A 
Sbjct  301  FDVAHNPHAAEYLTGRMKALPKNGR----VLAVIGMLHDKDIAGTLAWLKSVVDDWYCAP  356

Query  365  LSVPRAAPVTQLLDALDGEITQQYDSIREAFSVALEESRPHQLILVCGSFHTLEAVWEYL  424
            L  PR A   QLL+ L     + +DS+ +A+  A+ +++    +LVCGSFHT+  V E +
Sbjct  357  LEGPRGATAEQLLEHLGN--GKSFDSVAQAWDAAMADAKAEDTVLVCGSFHTVAHVMEVI  414

Query  425  E  425
            +
Sbjct  415  D  415


> P43775 Dihydrofolate synthase/folylpolyglutamate synthase [Haemophilus 
influenzae (strain ATCC 51907 / DSM 11121 / KW20 / 
Rd)]
Length=437

 Score =  256 bits (654),  Expect = 6e-83
 Identities = 159/438 (36%), Positives = 233/438 (53%), Gaps = 36/438 (8%)

Query  12   LMTWLTYWGHVHVTGIDLGLERVIPVAEKLGVTQTSAKVFTVAGTNGKGSTTTTLASILT  71
            L  WL+Y    H   IDLGL+R+  VAEKL +      V TV GTNGKG+T   L +IL 
Sbjct  12   LAEWLSYLEKSHFKPIDLGLDRIKSVAEKLDLLHPVPYVITVGGTNGKGTTCRLLETILL  71

Query  72   EQGYRVGLYQSPHIYRFNERVKLNGQEASDQQLIEAFVKVDQVRRECGLSLSFFEATTLA  131
              G RVG+Y SPH+ R+NERV++  Q+  D+    +F  +D+ + E   SL++FE +TL+
Sbjct  72   NHGLRVGVYSSPHLLRYNERVRIQNQDLPDEAHTASFAFIDENKTE---SLTYFEFSTLS  128

Query  132  AFLIFQQQACDIWVLEVGLGGRLDVVNVIDPDVAVITNIGLDHTDWLGDTIEKIAFEKAG  191
            A  +F+Q   D+ +LEVGLGGRLD  N++D  +AVIT+I +DHTD+LGDT E IAFEKAG
Sbjct  129  ALHLFKQAKLDVVILEVGLGGRLDATNIVDSHLAVITSIDIDHTDFLGDTREAIAFEKAG  188

Query  192  IIRSNIPVIFGGVQTLPQAIADKAAAQQAQLYVLGRDYFYQVAPDQKSWNFASSGTTLK-  250
            I R N PV+  G   +PQ + D+A     Q  V  RD  +    + ++W + +    L+ 
Sbjct  189  IFRENCPVVI-GEPNVPQTMLDQAEKLHCQ--VARRDVDWLFEQNAENWQWQNKKVRLEN  245

Query  251  LPLGSLALENISTAVAALLVSGIDVSQAAITSGIEKAHLAGRFEQRIIKNK---------  301
            LP   + L N +T +AA+     D+S+  +   +++  L GRF Q I  +K         
Sbjct  246  LPFCQIPLANAATVLAAVQYLPFDISEQTLRKSLQEVELVGRF-QAIKTDKREKLADYLG  304

Query  302  -------AVVFDAGHNGHGVDFL---LKQLRNFLEYNKQYTEVIAVFSMLADKDIKAVVN  351
                    ++ D GHN H   +L   L  L+  +E      ++IAV  ML DKD   V  
Sbjct  305  VPVETLPTIIVDVGHNPHAAKYLSEKLTALKRSIE-----GKMIAVCGMLKDKDANGVFE  359

Query  352  LLKPAVLHWKVAALSVPRAAPVTQLLDALDGEI----TQQYDSIREAFSVALEESRPHQL  407
             L P +  W    L   R     +L++ L            +S+ +    AL+ +  + +
Sbjct  360  HLTPIIDEWHCVTLGGYRGQSGDELVEKLKSHFPNIQATSDNSVMDGVCTALKSAVKNDV  419

Query  408  ILVCGSFHTLEAVWEYLE  425
            +LV GSFHT+   W  +E
Sbjct  420  VLVFGSFHTVAEFWAVVE  437


> Q89AT2 Dihydrofolate synthase/folylpolyglutamate synthase [Buchnera 
aphidicola subsp. Baizongia pistaciae (strain Bp)]
Length=426

 Score =  240 bits (613),  Expect = 5e-77
 Identities = 151/408 (37%), Positives = 229/408 (56%), Gaps = 12/408 (3%)

Query  12   LMTWLTYWGHVHVTGIDLGLERVIPVAEKLGVTQTSAKVFTVAGTNGKGSTTTTLASILT  71
            L  WL Y  H  +  ID  L RV  VA+KLGV ++ A VF V GTNGKGST   L ++L 
Sbjct  12   LYEWLYYLDHFMLDNIDPTLNRVFYVAKKLGVLKSKAFVFIVGGTNGKGSTCHVLENLLL  71

Query  72   EQGYRVGLYQSPHIYRFNERVKLNGQEASDQQLIEAFVKVDQVRRECGLSLSFFEATTLA  131
              GYRVGLY SPH+ R+ ERV++NG E      I AF  V   + +  + L+ FE  TL+
Sbjct  72   NSGYRVGLYTSPHLMRYTERVRINGFELEHLYHISAFNDVKYFQND--VLLTRFEFITLS  129

Query  132  AFLIFQQQACDIWVLEVGLGGRLDVVNVIDPDVAVITNIGLDHTDWLGDTIEKIAFEKAG  191
            A ++F+    DI +LEVGLGGRLD  N++  DV+VITNI +DH+  LG     I+ EK+G
Sbjct  130  ALILFKSYNLDIIILEVGLGGRLDATNILSADVSVITNIDIDHSKILGVNRSSISVEKSG  189

Query  192  IIRSNIPVIFGGVQTLPQAIADKAAAQQAQLYVLGRDYFYQVAPDQKSWNFASSGTT-LK  250
            I R N   I       P+     A  ++ +L ++  D+ Y+    +  W+F SS  T L 
Sbjct  190  IFRKNKIAIVAD-NNFPKVAQYLAKKKKVRLRIVNIDWIYKKI--EFEWSFCSSKITWLH  246

Query  251  LPL-GSLALENISTAVAALLVSGIDVSQAAITSGIEKAHLAGRFEQRIIKNKAVVFDAGH  309
            LPL  +++L++++TA++A+  SGI ++Q    S I +  L GRFE  I  N  ++ D  H
Sbjct  247  LPLPRNVSLDSVATALSAVSESGIKINQKVFRSCISEITLCGRFE-TISYNPIIILDVAH  305

Query  310  NGHGVDFLLKQLRNFLEYNKQYTEVIAVFSMLADKDIKAVVNLLKPAVLHWKVAALSVPR  369
            N H   +L K++ +F    K+   + AV  +L +K+IK +V+ L P V +W    L   R
Sbjct  306  NPHSARYLFKKMSSF----KKNGNIFAVVGILKEKNIKDIVSPLIPIVDYWYCITLLTHR  361

Query  370  AAPVTQLLDALDGEITQQYDSIREAFSVALEESRPHQLILVCGSFHTL  417
            +A  ++++  L    +Q   ++  A     ++   + ++L+ GSF T+
Sbjct  362  SATSSEIIKYLPNHNSQISKNMTVALEKIFDKVTNNDIVLIFGSFITV  409


> Q8K9X3 Dihydrofolate synthase/folylpolyglutamate synthase [Buchnera 
aphidicola subsp. Schizaphis graminum (strain Sg)]
Length=418

 Score =  233 bits (595),  Expect = 2e-74
 Identities = 140/383 (37%), Positives = 217/383 (57%), Gaps = 12/383 (3%)

Query  37   VAEKLGVTQTSAKVFTVAGTNGKGSTTTTLASILTEQGYRVGLYQSPHIYRFNERVKLNG  96
            +A+KLG+    +  FTV GTNGKG+T   L  +L + GY+VGLY SPH+  ++ER+K+NG
Sbjct  32   IAKKLGLLNLKSFFFTVGGTNGKGTTCAMLEKLLLDSGYQVGLYTSPHLINYSERIKVNG  91

Query  97   QEASDQQLIEAFVKVDQVRRECGLSLSFFEATTLAAFLIFQQQACDIWVLEVGLGGRLDV  156
               S++  I +F+ +D  +    +SL++FE  TL+A  +F Q + DI +LEVGLGGRLD 
Sbjct  92   LYLSEKDHIFSFLIIDAEKGN--VSLTYFEFITLSALFLFSQYSLDIIILEVGLGGRLDA  149

Query  157  VNVIDPDVAVITNIGLDHTDWLGDTIEKIAFEKAGIIR-SNIPVIFGGVQTLPQAIADKA  215
             N+ID D++VITNIG+DHT  LG     I  EK+GI R   I VI  G + +P ++ + A
Sbjct  150  TNIIDSDLSVITNIGIDHTSCLGTDRISIGREKSGIFRKGKIAVI--GEKNIPISVDEIA  207

Query  216  AAQQAQLYVLGRDYFYQVAPDQKSWNFASSGTTL-KLPLGSLALENISTAVAALLVSGID  274
              ++  L  +  D+F+       SWNF  S   L  LP+  + L N + A+A+L  SG++
Sbjct  208  KEKKTILKKIDVDWFW-TRTKIDSWNFIHSNIELYNLPVSRIPLSNTAIALASLFYSGLE  266

Query  275  VSQAAITSGIEKAHLAGRFEQRIIKNKAVVFDAGHNGHGVDFLLKQLRNFLEYNKQYTEV  334
            V+   + S I K  L+GRF Q +  +  ++ D  HN H   +L +++           ++
Sbjct  267  VNLKKLKSSISKVQLSGRF-QTVFNSPRIILDVAHNVHAALYLSEKIDEI----DTEGQI  321

Query  335  IAVFSMLADKDIKAVVNLLKPAVLHWKVAALSVPRAAPVTQLLDALDGEITQQYDSIREA  394
             AVF +L DKD+  VV +L+  + +W V  L   R+A +  L   L       +++I E+
Sbjct  322  YAVFGILKDKDVAGVVQVLQKKINYWYVVNLKTNRSASINYLKKKLSLNNALFFNNINES  381

Query  395  FSVALEESRPHQLILVCGSFHTL  417
            +    +      +ILV GSF T+
Sbjct  382  WQAIKKVITKKDIILVFGSFFTV  404


> P57265 Dihydrofolate synthase/folylpolyglutamate synthase [Buchnera 
aphidicola subsp. Acyrthosiphon pisum (strain APS)]
Length=411

 Score =  210 bits (534),  Expect = 1e-65
 Identities = 143/408 (35%), Positives = 216/408 (53%), Gaps = 14/408 (3%)

Query  12   LMTWLTYWGHVHVTGIDLGLERVIPVAEKLGVTQTSAKVFTVAGTNGKGSTTTTLASILT  71
            L  WL Y   +    I   L  +  +A+KLG+ ++ + +FTVAGTNGKG+T   L  +L 
Sbjct  8    LSLWLKYLEQLDKKRI-YNLTELKFLAKKLGLLKSESFIFTVAGTNGKGTTCAVLERLLL  66

Query  72   EQGYRVGLYQSPHIYRFNERVKLNGQEASDQQLIEAFVKVDQVRRECGLSLSFFEATTLA  131
            + GY+VGLY SPH+  F ERV++NG    +++ I++F  V+ VR   G+ L++FE  TLA
Sbjct  67   DSGYQVGLYTSPHLINFVERVRINGFVLHEEEHIDSFQNVELVRN--GVLLTYFEFITLA  124

Query  132  AFLIFQQQACDIWVLEVGLGGRLDVVNVIDPDVAVITNIGLDHTDWLGDTIEKIAFEKAG  191
            A ++F++ + D  +L+VGLGGRLD  N+ID D+++ITNIG+DHT  LG     IA EK G
Sbjct  125  ALILFKRYSLDCIILKVGLGGRLDATNIIDSDISIITNIGIDHTSILGRDRISIAREKCG  184

Query  192  IIRSN-IPVIFGGVQTLPQAIADKAAAQQAQLYVLGRDYFYQVAPDQKSWNFASSGTTL-  249
            + R N I VI  G   +P ++   A  ++  L  +  D+ ++    +  WNF  S   L 
Sbjct  185  VFRKNKISVI--GETDIPCSMYQIAKEKKTILKKIDIDWSWE--KKRNYWNFFHSTIQLY  240

Query  250  KLPLGSLALENISTAVAALLVSGIDVSQAAITSGIEKAHLAGRFEQRIIKNKAVVFDAGH  309
             LP   + L + +TA++ L  S   + +  I   I    L GRF Q I     ++ D  H
Sbjct  241  NLPETQVPLSSAATALSTLYYSRFKIKEKIIRKSISNVQLPGRF-QVISTFPYIIVDVAH  299

Query  310  NGHGVDFLLKQLRNFLEYNKQYTEVIAVFSMLADKDIKAVVNLLKPAVLHWKVAALSVPR  369
            N +   +L +++       K Y    AV  +L DKDI  +++ L   + HW  A L   R
Sbjct  300  NPNAAFYLSQKIDEINITGKIY----AVVGILKDKDILGIIDPLANKIHHWFTAPLKTIR  355

Query  370  AAPVTQLLDALDGEITQQYDSIREAFSVALEESRPHQLILVCGSFHTL  417
             A   +L        T    SI  A+  AL   +    I++ GSF T+
Sbjct  356  TATKHELKKFFPIHNTSILKSIEIAYKKALILVKKEDAIIIFGSFLTV  403


> Q05865 Dihydrofolate synthase/folylpolyglutamate synthase [Bacillus 
subtilis (strain 168)]
Length=430

 Score =  160 bits (405),  Expect = 5e-47
 Identities = 128/422 (30%), Positives = 206/422 (49%), Gaps = 32/422 (8%)

Query  26   GIDLGLERVIPVAEKLGVTQTSAKVFTVAGTNGKGSTTTTLASILTEQGYRVGLYQSPHI  85
            G+  GL R+  +  +LG  +   + F VAGTNGKGST   + S+L E GY VG + SP+I
Sbjct  19   GVKPGLGRMKQLMARLGHPEKKIRAFHVAGTNGKGSTVAFIRSMLQEAGYTVGTFTSPYI  78

Query  86   YRFNERVKLNGQEASDQ-------QLIEAFVKVDQVRRECGLSLSFFEATTLAAFLIFQQ  138
              FNER+ +NG   SD+       Q+      +DQ   E G     FE  T  AFL F +
Sbjct  79   ITFNERISVNGIPISDEEWTALVNQMKPHVEALDQT--EYGQPTE-FEIMTACAFLYFAE  135

Query  139  -QACDIWVLEVGLGGRLDVVNVIDPDVAVITNIGLDHTDWLGDTIEKIAFEKAGIIRSNI  197
                D  + E GLGGR D  NV++P + VIT+IG DH + LG+TIE+IA EKAGII+  I
Sbjct  136  FHKVDFVIFETGLGGRFDSTNVVEPLLTVITSIGHDHMNILGNTIEEIAGEKAGIIKEGI  195

Query  198  PVIFGGVQTLPQAI------ADKAAAQQAQLYVLGRDYFYQVAPDQKSWNFASSGTTLK-  250
            P++    Q  P+A+      A++ AA    L+     +  +  P  + ++F +     + 
Sbjct  196  PIVTAVTQ--PEALQVIRHEAERHAAPFQSLHDACVIFNEEALPAGEQFSFKTEEKCYED  253

Query  251  ---LPLGSLALENISTAVAA---LLVSGI-DVSQAAITSGIEKAHLAGRFEQRIIKNKAV  303
                 +G+   +N + ++ A   L    I  +S  A+ SG+ KA   GR E  + ++  V
Sbjct  254  IRTSLIGTHQRQNAALSILAAEWLNKENIAHISDEALRSGLVKAAWPGRLE-LVQEHPPV  312

Query  304  VFDAGHNGHGVDFLLKQLRNFLEYNKQYTEVIAVFSMLADKDIKAVVNLLKPAVLHWKVA  363
              D  HN  GV+ L + ++     ++    +  VFS L DK  + ++  L+        A
Sbjct  313  YLDGAHNEEGVEKLAETMKQRFANSR----ISVVFSALKDKPYQNMIKRLETIAHAIHFA  368

Query  364  ALSVPRAAPVTQLLDALDGEITQQYDSIREAFSVALEESRPHQLILVCGSFHTLEAVWEY  423
            +   PRA+    L DA +       +   +       +   ++++L+ GS + +  + + 
Sbjct  369  SFDFPRASLAKDLYDASEISNKSWSEDPDDVIKFIESKKGSNEIVLITGSLYFISDIRKR  428

Query  424  LE  425
            L+
Sbjct  429  LK  430


 Score = 25.8 bits (55),  Expect = 0.038
 Identities = 45/218 (21%), Positives = 83/218 (38%), Gaps = 29/218 (13%)

Query  2    KLDAPSIQDDLMTWLTYWGHVHVTGIDLGLERVIPVAEKLGVTQTSAKVFTVAGTNGKGS  61
            + D+ ++ + L+T +T  GH H+  +   +E +    EK G+ +    + T        +
Sbjct  151  RFDSTNVVEPLLTVITSIGHDHMNILGNTIEEI--AGEKAGIIKEGIPIVTAV------T  202

Query  62   TTTTLASILTEQGYRVGLYQSPH--IYRFNERVKLNGQEASDQQLIEAFVKV------DQ  113
                L  I  E       +QS H     FNE     G++ S +   + +  +        
Sbjct  203  QPEALQVIRHEAERHAAPFQSLHDACVIFNEEALPAGEQFSFKTEEKCYEDIRTSLIGTH  262

Query  114  VRRECGLSLSFFEATTLAAFLIFQQQACDIWVLEVGLGGRLDVVNVIDPDVAVITNIGLD  173
             R+   LS+   E            +A    +++    GRL++V    P       + LD
Sbjct  263  QRQNAALSILAAEWLNKENIAHISDEALRSGLVKAAWPGRLELVQEHPP-------VYLD  315

Query  174  --HTDWLGDTIEKIA-FEKAGIIRSNIPVIFGGVQTLP  208
              H +   + +EK+A   K     S I V+F  ++  P
Sbjct  316  GAHNE---EGVEKLAETMKQRFANSRISVVFSALKDKP  350


> P15925 Folylpolyglutamate synthase [Lactobacillus casei]
Length=428

 Score =  159 bits (403),  Expect = 9e-47
 Identities = 128/413 (31%), Positives = 192/413 (46%), Gaps = 34/413 (8%)

Query  33   RVIPVAEKLGVTQTSAKVFTVAGTNGKGSTTTTLASILTEQGYRVGLYQSPHIYRFNERV  92
            R++ +   LG  Q   +   V GTNGKGS    +A +L   G  VGLY SP I RFNER+
Sbjct  24   RILTLLHALGNPQQQGRYIHVTGTNGKGSAANAIAHVLEASGLTVGLYTSPFIMRFNERI  83

Query  93   KLNGQEASDQQLIEA--FVKVDQVR---RECGLSLSFFEATTLAAFLIFQQQACDIWVLE  147
             ++ +   D  L+ A  FV+    R   ++   +++ FE  T   +  F+Q+  D+ V+E
Sbjct  84   MIDHEPIPDAALVNAVAFVRAALERLQQQQADFNVTEFEFITALGYWYFRQRQVDVAVIE  143

Query  148  VGLGGRLDVVNVIDPDVAVITNIGLDHTDWLGDTIEKIAFEKAGIIRSNIPVIFGG-VQT  206
            VG+GG  D  NVI P V+V+T + LDH   LG TI  IA  KAGII+  IPV+ G  V  
Sbjct  144  VGIGGDTDSTNVITPVVSVLTEVALDHQKLLGHTITAIAKHKAGIIKRGIPVVTGNLVPD  203

Query  207  LPQAIADKAAAQQAQLYVLGRDYFYQVAPDQKSWNFASSGT---------TLKLPL-GSL  256
                +A K A   +Q     RD+     P  K   +    T          L++PL G  
Sbjct  204  AAAVVAAKVATTGSQWLRFDRDF---SVPKAKLHGWGQRFTYEDQDGRISDLEVPLVGDY  260

Query  257  ALENISTAVAALLV----SGIDVSQAAITSGIEKAHLAGRFEQRIIKNKAVVFDAGHNGH  312
               N++ A+    V    +   ++   I  G+  +H   R E +I     +V D  HN  
Sbjct  261  QQRNMAIAIQTAKVYAKQTEWPLTPQNIRQGLAASHWPARLE-KISDTPLIVIDGAHNPD  319

Query  313  GVDFLLKQLRNFLEYNKQYTEVIAVFSMLADKDIKAVVNLLKPAV-LHWKVAALSVPRAA  371
            G++ L+  L+           +  +  +LADKD  A+ + L  A    + V     PRA 
Sbjct  320  GINGLITALKQLFS-----QPITVIAGILADKDYAAMADRLTAAFSTVYLVPVPGTPRAL  374

Query  372  PVTQLLDALDGEITQQYDSIREAFSVALEESRPHQLILVCGSFHTLEAVWEYL  424
            P        +G +    DS +EA + +L +  P Q I++ GS +   AV + L
Sbjct  375  PEAGYEALHEGRLK---DSWQEALAASLNDV-PDQPIVITGSLYLASAVRQTL  423


> Q9UTD0 Probable dihydrofolate synthetase [Schizosaccharomyces 
pombe (strain 972 / ATCC 24843)]
Length=417

 Score =  146 bits (368),  Expect = 5e-42
 Identities = 119/423 (28%), Positives = 205/423 (48%), Gaps = 35/423 (8%)

Query  27   IDLGLERVIPVAEKLGVTQTSAKVFTVAGTNGKGSTTTTLASILTEQGYRVGLYQSPHIY  86
            I LGL+R++ + + LG  Q S     +AGTNGKGS  + + + L +   + G Y SPH  
Sbjct  3    IQLGLQRMLQLLKHLGNPQESFCAVQIAGTNGKGSICSYIYTSLLQAAIKTGRYTSPHFL  62

Query  87   RFNERVKLNGQEASDQQLIEAFVKVDQVRRECGLSLSFFEATTLAAFLIFQQQACDIWVL  146
               + + +NGQ AS++     + +V +V R      + FE  T  AF  F      + V+
Sbjct  63   EPRDTISINGQIASEEIFNTCWKQVIEVDRRFRTKATEFELLTATAFQCFHHSGVRVAVI  122

Query  147  EVGLGGRLDVVNVI-DPDVAVITNIGLDHTDWLGDTIEKIAFEKAGIIRSNIPVIFGGVQ  205
            E G+GGRLD  NV  +P +++I+ I LDH  +LG+T+E IA EKAGI + N+P +  G+ 
Sbjct  123  ETGMGGRLDATNVFEEPVLSIISRICLDHQAFLGNTLEAIAKEKAGIFKKNVPCVVDGLN  182

Query  206  TLPQAIADKAAAQQAQLYVLGRDYFY----QVAPDQKSW--NFASSGT-TLKLPL-GSLA  257
             +      K +A++ + +      FY    +   ++  W  N  + GT T   PL G   
Sbjct  183  EVNVLNQLKLSAEETRAHP-----FYLAKGKSGENKNEWIINTPNWGTNTFSTPLKGDYQ  237

Query  258  LENISTAVAAL--LVSGIDVSQAAITSGIEKAHLAGRFEQRIIKNKA-VVFDAGHNGHGV  314
             +N++ AV AL  L S   +    + +G++     GR + R + +   ++FD  HN    
Sbjct  238  GQNLACAVTALDILSSSFSIMLPHVQNGVKNTSWPGRLDIRSVPSLGDILFDGAHNKEAA  297

Query  315  DFLLKQLRN-FLEYNKQYTEVIAVFSMLADKDIKAVVNLLKP------AVLHWKVAALSV  367
              L K + +   E+NK  + V+A  +    KD+  ++ +L        A     V+ +  
Sbjct  298  IELAKFVNSQRREHNKSVSWVVAFTN---TKDVTGIMKILLRKGDTVIATNFSSVSGMPW  354

Query  368  PRAAPVTQLLDALDGE-----ITQQYDSIREAFSVALEESRPHQLILVCGSFHTLEAVWE  422
             ++     + +++  E      T    +I E   +A E+   +  ++VCGS + L  ++ 
Sbjct  355  IKSMEPEVIKNSISSESSVECYTADNLTISEILRLAKEK---NSSVIVCGSLYLLGDMYR  411

Query  423  YLE  425
            YL+
Sbjct  412  YLK  414


> Q9HS44 Probable folylpolyglutamate synthase / Probable dihydropteroate 
synthase [Halobacterium salinarum (strain ATCC 700922 
/ JCM 11081 / NRC-1)]
Length=815

 Score =  144 bits (363),  Expect = 4e-40
 Identities = 122/377 (32%), Positives = 173/377 (46%), Gaps = 26/377 (7%)

Query  53   VAGTNGKGSTTTTLASILTEQGYRVGLYQSPHIYRFNERVKLNGQEASDQQL---IEAFV  109
            +AG+NGKGST     SIL   G  VGLY SPH     ERV +NG+  S   L   IE   
Sbjct  45   IAGSNGKGSTARFTESILRAAGLDVGLYTSPHFDDVRERVTVNGRRMSKAALTTFIETIT  104

Query  110  KVDQVRRECGLSLSFFEATTLAAFLIFQQQACDIWVLEVGLGGRLDVVNVIDPDVAVITN  169
                 R   G + ++FE  T  A   F +   D+ VLEVG+GGRLD  +V+DP  + +T+
Sbjct  105  PYVTERAADGAAPTYFEVVTAMALWQFSRADVDVAVLEVGIGGRLDATSVVDPSASAVTS  164

Query  170  IGLDHTDWLGDTIEKIAFEKAGII-RSNIPVIFGGVQTLPQAIADKAAAQQAQLYVLGRD  228
            + L+HTD LG+TI +IA +KA +    + P++         A+ D A A +      GRD
Sbjct  165  VTLEHTDVLGETIPEIARDKAHVAPAGDTPLVTATTDDALAAVRDHAGAVRTVGDTAGRD  224

Query  229  Y--FYQVAPDQKSWNFASSG----TTLKLP-LGSLALENISTAVAALLVSGIDVSQAAIT  281
                Y+   +      + +G       ++P LG    EN   A AAL      V   AI 
Sbjct  225  VTATYEGRTNHTEAAVSITGDDWSVATEIPLLGDHQAENAGVA-AALARQTAGVDDDAIA  283

Query  282  SGIEKAHLAGRFEQRIIKNKAVVFDAGHNGHGVDFLLKQLRNFLEYNKQYTEVIAVFSML  341
             G+  AH  GRFE  +  +  VV D  HN      + + +  F      Y  ++ VF  +
Sbjct  284  RGLRSAHWPGRFEV-MGADPVVVLDGAHNPGACGAVAETVAEF-----DYDRLLTVFGAM  337

Query  342  ADKDIKAVVNLLKPAVLHWKVAALSVPRAAPVTQLL-----DALDGEITQQYDSIREAFS  396
             DKD  A+   L      W  A   VP  A    +L     DA  G ++    ++  A +
Sbjct  338  HDKDHGAMAAALPTPDHVW--ACEPVPDRAEDADVLAAVFEDAGAGTVSVT-RAVESAVA  394

Query  397  VALEESRPHQLILVCGS  413
             A+ E+    L+LV GS
Sbjct  395  DAIAEATADDLVLVAGS  411


 Score = 18.5 bits (36),  Expect = 7.7
 Identities = 6/11 (55%), Positives = 10/11 (91%), Gaps = 0/11 (0%)

Query  31   LERVIPVAEKL  41
            L+RV+PV E++
Sbjct  613  LDRVLPVIERI  623


> D4GW05 Probable folylpolyglutamate synthase / Probable dihydropteroate 
synthase [Haloferax volcanii (strain ATCC 29605 / 
DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / 
DS2)]
Length=838

 Score =  143 bits (360),  Expect = 9e-40
 Identities = 120/408 (29%), Positives = 181/408 (44%), Gaps = 31/408 (8%)

Query  30   GLERVIPVAEKLGVTQTSAKVFTVAGTNGKGSTTTTLASILTEQGYRVGLYQSPHIYRFN  89
            G E +  +   LG          VAG+NGKGST   + ++L E G  VGLY SPH     
Sbjct  21   GTESIRRLLSHLGDPHEGVSFVQVAGSNGKGSTARMVDAMLRESGAHVGLYTSPHFDDVR  80

Query  90   ERVKLNGQEASDQQLIEAFV---KVDQVRREC-GLSLSFFEATTLAAFLIFQQQACDIWV  145
            ERV+++G++     L  AFV   K   V R   G  L+FFE  T  A   F +   D+ V
Sbjct  81   ERVRVDGRKIPKSAL-SAFVAEAKPYLVERAADGEPLTFFETVTALALWYFDRAGVDVAV  139

Query  146  LEVGLGGRLDVVNVIDPDVAVITNIGLDHTDWLGDTIEKIAFEKAGIIRSNIPVIFGGVQ  205
            LEVG+GG LD  + +DP  + +TN+ L+HT  LGDT+ +IA  KA +  ++ P++ G   
Sbjct  140  LEVGMGGELDATSAVDPVASAVTNVSLEHTAVLGDTVAEIAKTKAAVAPADAPLVTGTTG  199

Query  206  TLPQAIADKA----------AAQQAQLYVLGRDYFYQVAPDQKSWNFASSGTTL--KLP-  252
                 I ++A          A   A + V    Y  +V   + +    +   TL  ++P 
Sbjct  200  EALSVIREEAGDVLTVGDADADSDADVRV---SYGGRVNHQEAAVTVETDAETLDVRIPL  256

Query  253  LGSLALENISTAVAALLVSGIDVSQAAITSGIEKAHLAGRFEQRIIKNKAVVFDAGHNGH  312
            LG+    N   AV+       D+   AI  G+  AH  GRFE  +     VV D  HN  
Sbjct  257  LGAYQARNAGIAVSLARQVRPDIDAEAIHRGLRNAHWPGRFEV-MGTEPTVVLDGAHNPD  315

Query  313  GVDFLLKQLRNFLEYNKQYTEVIAVFSMLADKDIKAVVNLLKPAVLHWKVAALSVPRAAP  372
                +   L  F      Y ++  V+  + DKD   +V  L P V         + R   
Sbjct  316  ACAQVATVLDEF-----DYDDLHLVYGAMHDKDHGEMVGAL-PEVASVVTCKADISRGED  369

Query  373  ---VTQLLDALDGEITQQYDSIREAFSVALEESRPHQLILVCGSFHTL  417
               ++ + + L+G   +   ++  A   A   + P   +LV GS + +
Sbjct  370  PEILSSVFERLNGPAVETGGAVAAALDRARARADPDDCVLVVGSLYVV  417


> Q12676 Dihydrofolate synthetase [Saccharomyces cerevisiae (strain 
ATCC 204508 / S288c)]
Length=427

 Score =  139 bits (350),  Expect = 1e-39
 Identities = 104/330 (32%), Positives = 166/330 (50%), Gaps = 25/330 (8%)

Query  27   IDLGLERVIPVAEKLGVTQTSAKVFTVAGTNGKGSTTTTLASILTEQGYRVGLYQSPHIY  86
            I+LGL R+  + E LG  Q S +V  +AGTNGKGS  T L+S+L ++ Y++G + +PH+ 
Sbjct  3    IELGLSRITKLLEHLGNPQNSLRVLHIAGTNGKGSVCTYLSSVLQQKSYQIGKFTTPHLV  62

Query  87   RFNERVKLNGQEASDQQLIEAFVKVDQVRRECGLSLSFFEATTLAAFLIFQQQACDIWVL  146
               + + +N +    ++     ++++ + +   L  + FE  T  AF  F    C   V+
Sbjct  63   HVTDSITINNKPIPLERYQNIRLQLEALNKSHSLKCTEFELLTCTAFKYFYDVQCQWCVI  122

Query  147  EVGLGGRLDVVNVI---DPDVAVITNIGLDHTDWLGDTIEKIAFEKAGIIRSNIP--VIF  201
            EVGLGGRLD  NVI   +     IT I LDH  +LG+T+ +I+ EKAGII   +P  VI 
Sbjct  123  EVGLGGRLDATNVIPGANKACCGITKISLDHESFLGNTLSEISKEKAGIITEGVPFTVID  182

Query  202  G-GVQTLPQAIADKAAAQQAQLYVLGRDYFYQVAPDQKSWNFASSGTTLKLPL-GSLALE  259
            G    ++   + ++  A  ++L V        +  D  SW         KLPL G   + 
Sbjct  183  GTNEASVINVVKERCKALGSELSVTDSQLNGNMI-DTNSWGCFD---LAKLPLNGEYQIF  238

Query  260  NISTAVAAL----LVSGIDVSQAAITSGIEKAHLAG-------RFEQRIIKNKAVVFDAG  308
            N+  A+  L    +   ID+++  +++ + K    G       RF++   +   ++ D  
Sbjct  239  NLRVAMGMLDYLQMNELIDITKNEVSTRLAKVDWPGRLYRMDYRFDKVSNRTVPILMDGA  298

Query  309  HNGHGVDFLLKQLRNFLEY-NKQYTEVIAV  337
            HNG     L+K LR   EY N+  T V+AV
Sbjct  299  HNGSAAVELVKYLRK--EYGNQPLTFVMAV  326


> F4JYE9 Dihydrofolate synthetase [Arabidopsis thaliana]
Length=530

 Score =  125 bits (315),  Expect = 1e-34
 Identities = 116/377 (31%), Positives = 168/377 (45%), Gaps = 55/377 (15%)

Query  26   GIDLGLERVIPVAEKLGVTQTSAKVFTVAGTNGKGSTTTTLASILTEQGYRVGLYQSPHI  85
            G DLG  R+  +  +L       KV  VAGT GKGST+  L++IL   GY VG Y SPHI
Sbjct  74   GFDLG--RMKRLMLRLRNPHYKYKVVHVAGTKGKGSTSAFLSNILRAGGYSVGCYSSPHI  131

Query  86   YRFNERVKLNGQEASDQQLIEAFVKV----DQVRRECGLSLSFFEATTLAAFLIFQQQAC  141
                ER+  NG+  S   L + F  V    +Q  +E   SLS FE  T  AF +F+++  
Sbjct  132  LSIKERISCNGEPVSASTLNDLFYSVKPILEQSIQEENGSLSHFEILTGIAFSLFEKENV  191

Query  142  DIWVLEVGLGGRLDVVNVIDPD---VAVITNIGLDHTDWLGDTIEKIAFEKAGIIRSNIP  198
            DI V+E GLGG  D  NVI+      +VIT IG +H   LG ++E IA  K+GII+   P
Sbjct  192  DIAVIEAGLGGARDATNVIESSNLAASVITTIGEEHMAALGGSLESIAEAKSGIIKHGRP  251

Query  199  VIFGG--VQTLPQAIADKAAAQQAQLYVLGR----------------------DYFYQVA  234
            V+ GG  +  +   +  KAA+  + + +                         D   Q  
Sbjct  252  VVLGGPFLPHIEGILRSKAASVSSSVILASNIGSSSSIKGIINKNGIGLCQSCDIVIQNE  311

Query  235  PDQKSWNFASSGTTLKLPLGSLALENISTAVAALLVSGID----VSQAAITSGIEKAHLA  290
             D +      S   L++ LG   L+N  TA    L         V+  AI  G+E   L 
Sbjct  312  KDDQP-IVELSDVNLRM-LGHHQLQNAVTATCVSLCLRDQGCGRVTDEAIRIGLENTRLL  369

Query  291  GR--------FEQRIIKNKAVVFDAGHNGHGVDFLLKQLRNFLEYNKQYTEVIAVFSMLA  342
            GR         E  ++    V+ D  H         + L+  ++ +     ++ V +M +
Sbjct  370  GRSQFLTPKEAETLLLPGATVLLDGAHTKESA----RALKEMIKKDFPEKRLVFVVAMAS  425

Query  343  DKD----IKAVVNLLKP  355
            DKD     K +++ LKP
Sbjct  426  DKDHVSFAKELLSGLKP  442


> I6Y0R5 Dihydrofolate synthase/folylpolyglutamate synthase [Mycobacterium 
tuberculosis (strain ATCC 25618 / H37Rv)]
Length=487

 Score =  125 bits (313),  Expect = 1e-34
 Identities = 120/412 (29%), Positives = 185/412 (45%), Gaps = 47/412 (11%)

Query  25   TGIDLGLERVIPVAEKLGVTQTSAKVFTVAGTNGKGSTTTTLASILTEQGYRVGLYQSPH  84
            T ID  L R+  + + LG  Q S     +AGTNGK S    + +++T    R G   SPH
Sbjct  41   TRIDPSLTRISALMDLLGSPQRSYPSIHIAGTNGKTSVARMVDALVTALHRRTGRTTSPH  100

Query  85   IYRFNERVKLNGQEASDQQLIEAFVKVDQV-----------RRECGLSLSFFEATTLAAF  133
            +    ER+ ++G+  S  Q +  + +++ +             + G ++S FE  T  AF
Sbjct  101  LQSPVERISIDGKPISPAQYVATYREIEPLVALIDQQSQASAGKGGPAMSKFEVLTAMAF  160

Query  134  LIFQQQACDIWVLEVGLGGRLDVVNVIDPDVAVITNIGLDHTDWLGDTIEKIAFEKAGII  193
              F     D+ V+EVG+GGR D  NVI+  VAVIT I +DH D+LG  I  IA EKAGII
Sbjct  161  AAFADAPVDVAVVEVGMGGRWDATNVINAPVAVITPISIDHVDYLGADIAGIAGEKAGII  220

Query  194  R-------SNIPVIFGGVQTLPQAI------ADKAAAQQ-AQLYVLGRDYFYQVAPDQKS  239
                      + VI   V  + + +      AD + A++ ++  VL R    Q+A   + 
Sbjct  221  TRAPDGSPDTVAVIGRQVPKVMEVLLAESVRADASVAREDSEFAVLRR----QIAVGGQV  276

Query  240  WNFASSG---TTLKLPL-GSLALENISTAVA---ALLVSGI--DVSQAAITSGIEKAHLA  290
                  G   + + LPL G     N   A+A   A   +G    +   A+ +G       
Sbjct  277  LQLQGLGGVYSDIYLPLHGEHQAHNAVLALASVEAFFGAGAQRQLDGDAVRAGFAAVTSP  336

Query  291  GRFEQRIIKNKAVVFDAGHNGHGVDFLLKQLRNFLEYNKQYTEVIAVFSMLADKDIKAVV  350
            GR E R+     V  DA HN  G   L + L +  ++      ++ V S+L DKD+  ++
Sbjct  337  GRLE-RMRSAPTVFIDAAHNPAGASALAQTLAHEFDFR----FLVGVLSVLGDKDVDGIL  391

Query  351  NLLKPAVLHWKVAALSVPRAAPVTQLL----DALDGEITQQYDSIREAFSVA  398
              L+P      V     PRA  V  L     +    +  +  +++R+A  VA
Sbjct  392  AALEPVFDSVVVTHNGSPRALDVEALALAAGERFGPDRVRTAENLRDAIDVA  443


> Q8W035 Folylpolyglutamate synthase [Arabidopsis thaliana]
Length=492

 Score =  122 bits (307),  Expect = 8e-34
 Identities = 105/351 (30%), Positives = 165/351 (47%), Gaps = 32/351 (9%)

Query  49   KVFTVAGTNGKGSTTTTLASILTEQGYRVGLYQSPHIYRFNERVKLNGQEASDQQLIE--  106
            K+  VAGT GKGST T   SIL   G R GL+ SPH+    ER +LNG E S ++ +   
Sbjct  59   KIIHVAGTKGKGSTCTFAESILRCYGLRTGLFTSPHLIDVRERFRLNGIEISQEKFVNYF  118

Query  107  --AFVKVDQVRRECGLSLSFFEATTLAAFLIFQQQACDIWVLEVGLGGRLDVVNVID-PD  163
               F K+ +         ++F    L AF IF  +  D+ +LEVGLGGR D  NVI  P 
Sbjct  119  WCCFHKLKEKTSNEVPMPTYFCFLALLAFKIFTTEQVDVVILEVGLGGRFDATNVIQKPV  178

Query  164  VAVITNIGLDHTDWLGDTIEKIAFEKAGIIRSNIPVI-FGGVQTLPQAIADKAAAQQAQL  222
            V  I+++G DH + LG T+ +IA EKAGI +S +P           + + +KA+  +  L
Sbjct  179  VCGISSLGYDHMEILGYTLAEIAAEKAGIFKSGVPAFTVAQPDEAMRVLNEKASKLEVNL  238

Query  223  YVLGRDYFYQVAPDQKSWNFASSGTTLKLPLGSLALENISTAVAALLV---SGIDVSQA-  278
             V        V P   S      G    L  G LA+   ST +  + +   +G+D +   
Sbjct  239  QV--------VEPLDSSQRLGLQGEHQYLNAG-LAVALCSTFLKEIGIEDKNGLDQTNGL  289

Query  279  --AITSGIEKAHLAGRF----EQRIIKNKAVVFDAGHNGHGVD----FLLKQLRNFLEYN  328
                 SG+  A+L GR     +  + +      D  H+   ++    +  KQ++   E N
Sbjct  290  PEKFISGLSNAYLMGRAMIVPDSELPEEIVYYLDGAHSPESMEACAIWFSKQIKQNQERN  349

Query  329  KQYTEVIAVFSMLADKDIKAVVNLLKPAVLHWKV---AALSVPRAAPVTQL  376
            ++ +E I +F+ ++ +D   ++  L+   +   V    A+ VP  +   Q+
Sbjct  350  QKRSEQILLFNCMSVRDPSLLLPRLRSKCIDQGVDFKRAVFVPNVSVYNQV  400


 Score = 21.9 bits (45),  Expect = 0.62
 Identities = 13/47 (28%), Positives = 24/47 (51%), Gaps = 2/47 (4%)

Query  8    IQDDLMTWLTYWGHVHVTGIDLGLERVIPVAEKLGVTQTSAKVFTVA  54
            IQ  ++  ++  G+ H+  +   L  +   AEK G+ ++    FTVA
Sbjct  174  IQKPVVCGISSLGYDHMEILGYTLAEI--AAEKAGIFKSGVPAFTVA  218


> F4J2K2 Folylpolyglutamate synthase [Arabidopsis thaliana]
Length=625

 Score =  115 bits (288),  Expect = 7e-31
 Identities = 68/166 (41%), Positives = 101/166 (61%), Gaps = 10/166 (6%)

Query  49   KVFTVAGTNGKGSTTTTLASILTEQGYRVGLYQSPHIYRFNERVKLNGQEASDQQLIEAF  108
            KV  VAGT GKGST     +IL   G+R G++ SPH+    ER +++G + S+++ ++ F
Sbjct  132  KVIHVAGTKGKGSTCVFSEAILRNCGFRTGMFTSPHLIDVRERFRIDGLDISEEKFLQYF  191

Query  109  VKVDQVRRE---CGLSL-SFFEATTLAAFLIFQQQACDIWVLEVGLGGRLDVVNVID-PD  163
             +  ++ +E    GL++   F+  T+ AF IF  +  D+ V+EVGLGG+LD  NVI  P 
Sbjct  192  WECWKLLKEKAVDGLTMPPLFQFLTVLAFKIFVCEKVDVAVIEVGLGGKLDSTNVIQKPV  251

Query  164  VAVITNIGLDHTDWLGDTIEKIAFEKAGIIRSNIPVIFGGVQTLPQ  209
            V  I ++G+DH D LG+T+  IAF KAGI +  IP       T+PQ
Sbjct  252  VCGIASLGMDHMDILGNTLADIAFHKAGIFKPQIPAF-----TVPQ  292


 Score = 20.8 bits (42),  Expect = 1.5
 Identities = 18/61 (30%), Positives = 27/61 (44%), Gaps = 9/61 (15%)

Query  368  PRAAPVTQ--LLDALDGEITQQYDSIREAFSVALEESRPHQLILVCGSFHTLEAVWEYLE  425
            P   PVT   ++ +L   I    D +R   S+ LE       +LV GS H +  V   L+
Sbjct  572  PAGTPVTSSAVMPSLPLTINWLRDCVRRNPSLKLE-------VLVTGSLHLVGDVLRLLK  624

Query  426  K  426
            +
Sbjct  625  R  625


 Score = 20.0 bits (40),  Expect = 2.5
 Identities = 13/48 (27%), Positives = 16/48 (33%), Gaps = 0/48 (0%)

Query  378  DALDGEITQQYDSIREAFSVALEESRPHQLILVCGSFHTLEAVWEYLE  425
            D  D      YD   EA S  +            G+   LE V  YL+
Sbjct  73   DKADNPALSSYDDAMEALSTLISRRNRGDRTPTKGNRDKLEQVVTYLK  120



Lambda      K        H        a         alpha
   0.322    0.136    0.399    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2572271


  Database: 2f74d9bb696d5c4f4be6b9665608d68c.SwissProt.fasta
    Posted date:  Sep 28, 2020  1:30 PM
  Number of letters in database: 7,603
  Number of sequences in database:  15



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40