ACIAD0571 / TrEMBL Alignments

BLASTP 2.2.28+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: 7d65447aeb1f049d8e0d9ba1d0aae9a8.TrEMBL.fasta
           24 sequences; 18,652 total letters



Query= ACIAD0571

Length=556
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  Q6FEL3 AMP-binding domain-containing protein [Acinetobacter bay...  1118    0.0  
  N9QW87 Uncharacterized protein [Acinetobacter ursingii NIPH 706]     736    0.0  
  N9DHM5 AMP-binding_C domain-containing protein [Acinetobacter u...   736    0.0  
  A0A009YF18 AMP-binding enzyme family protein [Acinetobacter sp....   735    0.0  
  A0A2N6VG52 Acyl-CoA synthetase [Acinetobacter ursingii]              723    0.0  
  A0A1U9S4P0 Acyl-CoA synthetase [Acinetobacter pittii]                667    0.0  
  A0A013SI07 AMP-binding enzyme family protein [Acinetobacter sp....   667    0.0  
  A0A1E3MA15 Acyl-CoA synthetase [Acinetobacter baumannii]             667    0.0  
  A0A013T9Y8 AMP-binding enzyme family protein [Acinetobacter sp....   667    0.0  
  F0KMQ8 Aconitate hydratase [Acinetobacter calcoaceticus (strain...   667    0.0  
  Q25B38 Peptide synthetase [Planktothrix rubescens]                  58.9    6e-12
  Q25B37 Peptide synthetase [Planktothrix rubescens]                  58.9    6e-12
  Q2EYY6 Putative caffeoyl CoA-ligase [Saccharothrix espanaensis]     57.4    1e-11
  Q25B43 Peptide synthetase [Planktothrix rubescens]                  57.8    1e-11
  Q25B41 Peptide synthetase [Planktothrix rubescens]                  57.8    1e-11
  Q25B47 Peptide synthetase [Planktothrix rubescens]                  57.8    1e-11
  U5TSR1 McyC [Nostoc sp. 152]                                        57.0    4e-11
  A0A223PIJ7 SulM [Pseudomonas acidophila]                            56.6    5e-11
  Q25B40 Peptide synthetase [Planktothrix rubescens]                  55.8    5e-11
  Q25B36 Peptide synthetase [Planktothrix rubescens]                  55.5    7e-11
  Q25B33 Peptide synthetase [Planktothrix rubescens]                  55.5    7e-11
  D0V1Z0 SrfAA [Bacillus sp. CS93]                                    54.3    1e-10
  A0A2D1VNM3 Non-ribosomal peptide synthetase [Nostoc sp. CENA543]    55.1    2e-10
  A0A2D1VNN8 NdaB [Nostoc sp. CENA543]                                53.1    5e-10


> Q6FEL3 AMP-binding domain-containing protein [Acinetobacter baylyi 
(strain ATCC 33305 / BD413 / ADP1)]
Length=555

 Score = 1118 bits (2893),  Expect = 0.0
 Identities = 554/555 (99%), Positives = 555/555 (100%), Gaps = 0/555 (0%)

Query  1    LNDFIRSPRTLAINAQLKAISFAEFWQDVAAQAAWIQPSPQSVWALWEQDSYDFLVLLFA  60
            +NDFIRSPRTLAINAQLKAISFAEFWQDVAAQAAWIQPSPQSVWALWEQDSYDFLVLLFA
Sbjct  1    MNDFIRSPRTLAINAQLKAISFAEFWQDVAAQAAWIQPSPQSVWALWEQDSYDFLVLLFA  60

Query  61   GLVAKKRILLPPNRVAQLEQDFRRQDIHFLSRQLSISPVQMIPIPEWNTETLNQAHIDFY  120
            GLVAKKRILLPPNRVAQLEQDFRRQDIHFLSRQLSISPVQMIPIPEWNTETLNQAHIDFY
Sbjct  61   GLVAKKRILLPPNRVAQLEQDFRRQDIHFLSRQLSISPVQMIPIPEWNTETLNQAHIDFY  120

Query  121  TSGSTGQPKRIERNLAQLLSEVQGLDQTFGLAENSIALATVSHQHIYGLLFKVLWPLATG  180
            TSGSTGQPKRIERNLAQLLSEVQGLDQTFGLAENSIALATVSHQHIYGLLFKVLWPLATG
Sbjct  121  TSGSTGQPKRIERNLAQLLSEVQGLDQTFGLAENSIALATVSHQHIYGLLFKVLWPLATG  180

Query  181  RCFYSPQLGFPEDVVIMQQRFTTSNRQNYVISSPALLKRWNKDMVLQACEAVFSSGGKLE  240
            RCFYSPQLGFPEDVVIMQQRFTTSNRQNYVISSPALLKRWNKDMVLQACEAVFSSGGKLE
Sbjct  181  RCFYSPQLGFPEDVVIMQQRFTTSNRQNYVISSPALLKRWNKDMVLQACEAVFSSGGKLE  240

Query  241  SGIRPQLNDAITEILGSSETGGIAYRHQDHAAWQAFADVDIQIEQAHLQVKTAHAYTEQW  300
            SGIRPQLNDAITEILGSSETGGIAYRHQDHAAWQAFADVDIQIEQAHLQVKTAHAYTEQW
Sbjct  241  SGIRPQLNDAITEILGSSETGGIAYRHQDHAAWQAFADVDIQIEQAHLQVKTAHAYTEQW  300

Query  301  IETGDLAQWQQLDNTTLGFELLGRADRLIKLEEKRLSLDAIEQGIQSQPQVEQCHALVVE  360
            IETGDLAQWQQLDNTTLGFELLGRADRLIKLEEKRLSLDAIEQGIQSQPQVEQCHALVVE
Sbjct  301  IETGDLAQWQQLDNTTLGFELLGRADRLIKLEEKRLSLDAIEQGIQSQPQVEQCHALVVE  360

Query  361  HEQRQLLACIVVLNADARASLKQLGKRQFVSQLKHQLSHGLERIAIPRLWRFLTDIPHNS  420
            HEQRQLLACIVVLNADARASLKQLGKRQFVSQLKHQLSHGLERIAIPRLWRFLTDIPHNS
Sbjct  361  HEQRQLLACIVVLNADARASLKQLGKRQFVSQLKHQLSHGLERIAIPRLWRFLTDIPHNS  420

Query  421  QSKRDKHYLKSLFQPMLYPVVLQRTALENEHCWTLEFSPELECFKGHFPTQPIYPGVGQI  480
            QSKRDKHYLKSLFQPMLYPVVLQRTALENEHCWTLEFSPELECFKGHFPTQPIYPGVGQI
Sbjct  421  QSKRDKHYLKSLFQPMLYPVVLQRTALENEHCWTLEFSPELECFKGHFPTQPIYPGVGQI  480

Query  481  GFVEAFAKQIWADLDWCSGYEQLKFQHVIVPYSVIAMKLTRKQHKISFELHQQDQTMASG  540
            GFVEAFAKQIWADLDWCSGYEQLKFQHVIVPYSVIAMKLTRKQHKISFELHQQDQTMASG
Sbjct  481  GFVEAFAKQIWADLDWCSGYEQLKFQHVIVPYSVIAMKLTRKQHKISFELHQQDQTMASG  540

Query  541  RLLFALKIAGEERST  555
            RLLFALKIAGEERST
Sbjct  541  RLLFALKIAGEERST  555


> N9QW87 Uncharacterized protein [Acinetobacter ursingii NIPH 706]
Length=558

 Score =  736 bits (1901),  Expect = 0.0
 Identities = 373/551 (68%), Positives = 434/551 (79%), Gaps = 1/551 (0%)

Query  2    NDFIRSPRTLAINAQLKAISFAEFWQDVAAQAAWIQPSPQSVWALWEQDSYDFLVLLFAG  61
            N FI+S +TLAI    + ISFA FWQDV+ QA  +   P+S+WALW QDSY+FLVLLFA 
Sbjct  7    NPFIQSQQTLAITFDQQQISFAAFWQDVSQQAQLLSLRPESIWALWHQDSYEFLVLLFAA  66

Query  62   LVAKKRILLPPNRVAQLEQDFRRQDIHFLSRQLSISPVQMIPIPEWNTETLNQAHIDFYT  121
            L AKKRI+LPP+RVAQLEQ+   Q I+FLSRQ + + V      + +   L+QA IDFYT
Sbjct  67   LQAKKRIVLPPHRVAQLEQNLASQHIYFLSRQ-TFTDVNSNFSLDLSQTFLDQAQIDFYT  125

Query  122  SGSTGQPKRIERNLAQLLSEVQGLDQTFGLAENSIALATVSHQHIYGLLFKVLWPLATGR  181
            SGSTG+PKRIER LAQL  EVQGLDQTF L E  IALATVSHQHIYGLLFK+LWPL TGR
Sbjct  126  SGSTGEPKRIERTLAQLFKEVQGLDQTFCLTEQVIALATVSHQHIYGLLFKLLWPLFTGR  185

Query  182  CFYSPQLGFPEDVVIMQQRFTTSNRQNYVISSPALLKRWNKDMVLQACEAVFSSGGKLES  241
             FY PQL FPEDV+ +Q++F     QNYVISSPALLKRW  D+ L   +AVFSSGGKLE+
Sbjct  186  SFYIPQLAFPEDVIAIQKQFAEFRLQNYVISSPALLKRWTLDLKLVDSQAVFSSGGKLEN  245

Query  242  GIRPQLNDAITEILGSSETGGIAYRHQDHAAWQAFADVDIQIEQAHLQVKTAHAYTEQWI  301
            G+RP LN  ITEILGSSETGGIAYR +D +AWQAFADV+I I+Q  L V+T HA+   WI
Sbjct  246  GVRPLLNYTITEILGSSETGGIAYRIEDESAWQAFADVNINIQQQLLNVQTEHAFCSDWI  305

Query  302  ETGDLAQWQQLDNTTLGFELLGRADRLIKLEEKRLSLDAIEQGIQSQPQVEQCHALVVEH  361
            ETGDLA+W+  +N   GF+LLGRADRLIKLEEKRLSLDAIEQ IQ+   V+QCHAL++E 
Sbjct  306  ETGDLAEWENANNPKTGFKLLGRADRLIKLEEKRLSLDAIEQTIQALAAVKQCHALLIEQ  365

Query  362  EQRQLLACIVVLNADARASLKQLGKRQFVSQLKHQLSHGLERIAIPRLWRFLTDIPHNSQ  421
            EQRQ LACIVVL+  AR  L+ +GK  FVS++K QL  GLE IA PRLWRFLT++P N+Q
Sbjct  366  EQRQFLACIVVLHDAARQQLQCIGKHAFVSEIKQQLRSGLENIATPRLWRFLTELPQNTQ  425

Query  422  SKRDKHYLKSLFQPMLYPVVLQRTALENEHCWTLEFSPELECFKGHFPTQPIYPGVGQIG  481
            SK DKHYLKSLFQPML PVVL R  ++  H   LEF+PEL CFKGHFPTQPIYPGVGQIG
Sbjct  426  SKLDKHYLKSLFQPMLQPVVLSRLQVDECHQLKLEFTPELLCFKGHFPTQPIYPGVGQIG  485

Query  482  FVEAFAKQIWADLDWCSGYEQLKFQHVIVPYSVIAMKLTRKQHKISFELHQQDQTMASGR  541
            F++ FA+QIW DLDWC+GYEQLKFQH+I PY VI +KLTRKQHK+SFEL    QT+ASGR
Sbjct  486  FIQTFARQIWGDLDWCNGYEQLKFQHLIQPYHVIELKLTRKQHKVSFELSGVQQTLASGR  545

Query  542  LLFALKIAGEE  552
            LLFALK + EE
Sbjct  546  LLFALKDSDEE  556


> N9DHM5 AMP-binding_C domain-containing protein [Acinetobacter 
ursingii ANC 3649]
Length=558

 Score =  736 bits (1900),  Expect = 0.0
 Identities = 368/551 (67%), Positives = 434/551 (79%), Gaps = 1/551 (0%)

Query  2    NDFIRSPRTLAINAQLKAISFAEFWQDVAAQAAWIQPSPQSVWALWEQDSYDFLVLLFAG  61
            N FI+S +TLAI    + ISFA FWQDV+ QA  +   P+ +WALW QDSY+FLVLLFA 
Sbjct  7    NPFIQSQQTLAITVDQQQISFAAFWQDVSQQAQLLSLRPECIWALWHQDSYEFLVLLFAA  66

Query  62   LVAKKRILLPPNRVAQLEQDFRRQDIHFLSRQLSISPVQMIPIPEWNTETLNQAHIDFYT  121
            L AKKRI+LPP+RVAQLEQ+   Q I+FLSRQ + + +    + +++   L QA IDFYT
Sbjct  67   LQAKKRIVLPPHRVAQLEQNLASQHIYFLSRQ-TFTEINSNFVLDFSQNFLEQAQIDFYT  125

Query  122  SGSTGQPKRIERNLAQLLSEVQGLDQTFGLAENSIALATVSHQHIYGLLFKVLWPLATGR  181
            SGSTG+PKRIER LAQL  EVQGLDQTF L E  +ALATVSHQHIYGLLFK+LWPL TGR
Sbjct  126  SGSTGEPKRIERTLAQLFKEVQGLDQTFCLTEQVLALATVSHQHIYGLLFKLLWPLFTGR  185

Query  182  CFYSPQLGFPEDVVIMQQRFTTSNRQNYVISSPALLKRWNKDMVLQACEAVFSSGGKLES  241
             FYSPQL FPEDV+ +Q++F     QNYVISSPALLKRW  ++ L   +AVFSSGGKLE+
Sbjct  186  SFYSPQLAFPEDVIAIQKQFAEFGLQNYVISSPALLKRWTLNLKLVDSQAVFSSGGKLEN  245

Query  242  GIRPQLNDAITEILGSSETGGIAYRHQDHAAWQAFADVDIQIEQAHLQVKTAHAYTEQWI  301
            G+RP  N  ITEILGSSETGGIAYR +D +AWQAFADV+I I+Q  L V+T HA+   WI
Sbjct  246  GVRPLFNYTITEILGSSETGGIAYRTEDESAWQAFADVNINIQQQLLNVQTEHAFCSDWI  305

Query  302  ETGDLAQWQQLDNTTLGFELLGRADRLIKLEEKRLSLDAIEQGIQSQPQVEQCHALVVEH  361
            ETGDLA+W+  +N   GF+LLGRADRLIKLEEKRLSLDAIEQ I++ P V+QCHAL+VE 
Sbjct  306  ETGDLAEWENANNPKTGFKLLGRADRLIKLEEKRLSLDAIEQTIKTLPAVKQCHALLVEQ  365

Query  362  EQRQLLACIVVLNADARASLKQLGKRQFVSQLKHQLSHGLERIAIPRLWRFLTDIPHNSQ  421
            EQRQ LACIVVL+  AR  L+ +GK  FVS++K QLS GLE IAIPRLWRFLT++P N+Q
Sbjct  366  EQRQFLACIVVLHDAARQQLQCIGKHAFVSEIKQQLSDGLENIAIPRLWRFLTELPQNTQ  425

Query  422  SKRDKHYLKSLFQPMLYPVVLQRTALENEHCWTLEFSPELECFKGHFPTQPIYPGVGQIG  481
            SK DKHYLKSLF+PML PV+L R  +   H   LEF+PEL CFKGHFP  PIYPGVGQIG
Sbjct  426  SKLDKHYLKSLFEPMLQPVILSRLQVNECHQLKLEFTPELLCFKGHFPNHPIYPGVGQIG  485

Query  482  FVEAFAKQIWADLDWCSGYEQLKFQHVIVPYSVIAMKLTRKQHKISFELHQQDQTMASGR  541
            F++ FA+QIW DLDWC+GYEQLKFQH+I PY VI +KLTRKQHK+SFEL    QT+ASGR
Sbjct  486  FIQTFARQIWGDLDWCNGYEQLKFQHLIQPYHVIELKLTRKQHKVSFELSGVQQTLASGR  545

Query  542  LLFALKIAGEE  552
            LLFALK + EE
Sbjct  546  LLFALKDSDEE  556


> A0A009YF18 AMP-binding enzyme family protein [Acinetobacter sp. 
479375]
Length=557

 Score =  735 bits (1897),  Expect = 0.0
 Identities = 373/551 (68%), Positives = 433/551 (79%), Gaps = 1/551 (0%)

Query  2    NDFIRSPRTLAINAQLKAISFAEFWQDVAAQAAWIQPSPQSVWALWEQDSYDFLVLLFAG  61
            N FI+S +TLAI    + ISFA FWQDV+ QA  +   P+S+WALW QDSY+FLVLLFA 
Sbjct  6    NPFIQSQQTLAITFDQQQISFAAFWQDVSQQAQLLSLRPESIWALWHQDSYEFLVLLFAA  65

Query  62   LVAKKRILLPPNRVAQLEQDFRRQDIHFLSRQLSISPVQMIPIPEWNTETLNQAHIDFYT  121
            L AKKRI+LPP+RVAQLEQ+   Q I+FLSRQ + + V      + +   L+QA IDFYT
Sbjct  66   LQAKKRIVLPPHRVAQLEQNLASQHIYFLSRQ-TFTDVNSNFSLDLSQTFLDQAQIDFYT  124

Query  122  SGSTGQPKRIERNLAQLLSEVQGLDQTFGLAENSIALATVSHQHIYGLLFKVLWPLATGR  181
            SGSTG+PKRIER LAQL  EVQGLDQTF L E  IALATVSHQHIYGLLFK+LWPL TGR
Sbjct  125  SGSTGEPKRIERTLAQLFKEVQGLDQTFCLTEQVIALATVSHQHIYGLLFKLLWPLFTGR  184

Query  182  CFYSPQLGFPEDVVIMQQRFTTSNRQNYVISSPALLKRWNKDMVLQACEAVFSSGGKLES  241
             FY PQL FPEDV+ +Q++F     QNYVISSPALLKRW  D+ L   +AVFSSGGKLE+
Sbjct  185  SFYIPQLAFPEDVIAIQKQFAEFRLQNYVISSPALLKRWTLDLKLVDSQAVFSSGGKLEN  244

Query  242  GIRPQLNDAITEILGSSETGGIAYRHQDHAAWQAFADVDIQIEQAHLQVKTAHAYTEQWI  301
            G+RP LN  ITEILGSSETGGIAYR +D +AWQAFADV+I I+Q  L V+T HA+   WI
Sbjct  245  GVRPLLNYTITEILGSSETGGIAYRIEDESAWQAFADVNINIQQQLLNVQTEHAFCSDWI  304

Query  302  ETGDLAQWQQLDNTTLGFELLGRADRLIKLEEKRLSLDAIEQGIQSQPQVEQCHALVVEH  361
            ETGDLA+W+  +N   GF+LLGRADRLIKLEEKRLSLDAIEQ IQ+   V+QCHAL++E 
Sbjct  305  ETGDLAEWENANNPKTGFKLLGRADRLIKLEEKRLSLDAIEQTIQALAAVKQCHALLIEQ  364

Query  362  EQRQLLACIVVLNADARASLKQLGKRQFVSQLKHQLSHGLERIAIPRLWRFLTDIPHNSQ  421
            EQRQ LACIVVL+  AR  L+  GK  FVS++K QL  GLE IA PRLWRFLT++P N+Q
Sbjct  365  EQRQFLACIVVLHDAARQQLQCKGKHAFVSEIKQQLRSGLENIATPRLWRFLTELPQNTQ  424

Query  422  SKRDKHYLKSLFQPMLYPVVLQRTALENEHCWTLEFSPELECFKGHFPTQPIYPGVGQIG  481
            SK DKHYLKSLFQPML PVVL R  ++  H   LEF+PEL CFKGHFPTQPIYPGVGQIG
Sbjct  425  SKLDKHYLKSLFQPMLQPVVLSRLQVDECHQLKLEFTPELLCFKGHFPTQPIYPGVGQIG  484

Query  482  FVEAFAKQIWADLDWCSGYEQLKFQHVIVPYSVIAMKLTRKQHKISFELHQQDQTMASGR  541
            F++ FA+QIW DLDWC+GYEQLKFQH+I PY VI +KLTRKQHK+SFEL    QT+ASGR
Sbjct  485  FIQTFARQIWGDLDWCNGYEQLKFQHLIQPYHVIELKLTRKQHKVSFELSGVQQTLASGR  544

Query  542  LLFALKIAGEE  552
            LLFALK + EE
Sbjct  545  LLFALKDSDEE  555


> A0A2N6VG52 Acyl-CoA synthetase [Acinetobacter ursingii]
Length=541

 Score =  723 bits (1866),  Expect = 0.0
 Identities = 364/533 (68%), Positives = 420/533 (79%), Gaps = 1/533 (0%)

Query  20   ISFAEFWQDVAAQAAWIQPSPQSVWALWEQDSYDFLVLLFAGLVAKKRILLPPNRVAQLE  79
            ISFA FWQDV+ QA  +   P+ +WALW QDSY+FLVLLFA L AKKRI+LPP+RVAQLE
Sbjct  8    ISFAAFWQDVSQQAQLLSLRPECIWALWHQDSYEFLVLLFAALQAKKRIVLPPHRVAQLE  67

Query  80   QDFRRQDIHFLSRQLSISPVQMIPIPEWNTETLNQAHIDFYTSGSTGQPKRIERNLAQLL  139
            Q+   Q I+FLSRQ + + V    + + +   L QA IDFYTSGSTG+PKRIER LAQL 
Sbjct  68   QNLASQHIYFLSRQ-TFTDVNSNFVLDLSQNFLEQAQIDFYTSGSTGEPKRIERTLAQLF  126

Query  140  SEVQGLDQTFGLAENSIALATVSHQHIYGLLFKVLWPLATGRCFYSPQLGFPEDVVIMQQ  199
             EVQGLDQTF L +  IALATVSHQHIYGLLFK+LWPL TGR FYSPQL FPEDV+ +Q+
Sbjct  127  KEVQGLDQTFCLTKQVIALATVSHQHIYGLLFKLLWPLFTGRSFYSPQLAFPEDVIAIQK  186

Query  200  RFTTSNRQNYVISSPALLKRWNKDMVLQACEAVFSSGGKLESGIRPQLNDAITEILGSSE  259
            +F     QNYVISSPALLKRW  D+ L   +AVFSSGGKLE+G+RP LN  ITEILGSSE
Sbjct  187  KFAEFGLQNYVISSPALLKRWTLDLKLVDSQAVFSSGGKLENGVRPLLNYTITEILGSSE  246

Query  260  TGGIAYRHQDHAAWQAFADVDIQIEQAHLQVKTAHAYTEQWIETGDLAQWQQLDNTTLGF  319
            TGGIAYR +D + WQAFADV+I I+Q  L V+T HA+   WIETGDLA+W+  +N   GF
Sbjct  247  TGGIAYRTEDESVWQAFADVNINIQQQLLNVQTEHAFCSDWIETGDLAEWENANNPKTGF  306

Query  320  ELLGRADRLIKLEEKRLSLDAIEQGIQSQPQVEQCHALVVEHEQRQLLACIVVLNADARA  379
            +LLGRADRLIKLEEKRLSLDAIEQ IQ+   V+QCHAL+VE EQRQ LACIVVL+  AR 
Sbjct  307  KLLGRADRLIKLEEKRLSLDAIEQTIQTLAAVKQCHALLVEQEQRQFLACIVVLHDAARQ  366

Query  380  SLKQLGKRQFVSQLKHQLSHGLERIAIPRLWRFLTDIPHNSQSKRDKHYLKSLFQPMLYP  439
             L+ +GK  FVS++K QLS GLE IAIPRLWRFLT++P N+QSK DKHYLKSLFQPML P
Sbjct  367  QLQCIGKHAFVSEIKQQLSDGLENIAIPRLWRFLTELPQNTQSKLDKHYLKSLFQPMLQP  426

Query  440  VVLQRTALENEHCWTLEFSPELECFKGHFPTQPIYPGVGQIGFVEAFAKQIWADLDWCSG  499
            VVL +      H   LEF PEL CFKGHFP QPIYPGVGQIGF++ FA+QIW DLDWC+G
Sbjct  427  VVLSQLQASECHQLKLEFMPELLCFKGHFPNQPIYPGVGQIGFIQTFARQIWGDLDWCNG  486

Query  500  YEQLKFQHVIVPYSVIAMKLTRKQHKISFELHQQDQTMASGRLLFALKIAGEE  552
            YEQLKFQH+I PY VI +KLTRKQHK+SFEL    QT+ASGRLLFALK + EE
Sbjct  487  YEQLKFQHLIEPYHVIELKLTRKQHKVSFELSDVQQTLASGRLLFALKDSDEE  539


> A0A1U9S4P0 Acyl-CoA synthetase [Acinetobacter pittii]
Length=552

 Score =  667 bits (1722),  Expect = 0.0
 Identities = 337/545 (62%), Positives = 410/545 (75%), Gaps = 6/545 (1%)

Query  4    FIRSPRTLAINAQLKAISFAEFWQDVAAQAAWIQPSPQSVWALWEQDSYDFLVLLFAGLV  63
            FI S + L I+  L + SF +FWQDVA QAA I       WALWE DSY+FLVL FA L+
Sbjct  8    FIDSAQPLCIDGTLNSTSFNQFWQDVALQAAAIAQMENLTWALWEADSYEFLVLFFAALL  67

Query  64   AKKRILLPPNRVAQLEQDFRRQDIHFLSRQLSISPVQMIPIPEWNTET-LNQAHIDFYTS  122
            AKK+ILLPPNRV +LEQDF  Q I+FL RQ      +++P+     +T L QA + FYTS
Sbjct  68   AKKQILLPPNRVRELEQDFAAQQIYFLKRQ---EIGEVVPLSLTLDDTFLEQAQLYFYTS  124

Query  123  GSTGQPKRIERNLAQLLSEVQGLDQTFGLAENSIALATVSHQHIYGLLFKVLWPLATGRC  182
            GSTG+PK+I R L QLL+EVQGL Q+F   E++ A+ATVSHQHIYGLLFK+L PLATGR 
Sbjct  125  GSTGEPKKIPRTLRQLLNEVQGLSQSFSFDEHATAIATVSHQHIYGLLFKLLLPLATGRS  184

Query  183  FYSPQLGFPEDVVIMQQRFTTSNRQNYVISSPALLKRWNKDMVLQACEAVFSSGGKLESG  242
            FY+PQ+ FPEDVV  Q++  T    NY+ISSPALLKRW  D+VLQ C+ VFSSGGKLESG
Sbjct  185  FYNPQMAFPEDVVQAQKQLETMGLSNYLISSPALLKRWTTDVVLQHCQMVFSSGGKLESG  244

Query  243  IRPQLNDAITEILGSSETGGIAYRHQDHAAWQAFADVDIQIEQAHLQVKTAHAYTEQWIE  302
            +RP LN  I E+LGSSETGGIA+R +D  AW AF++V I+IE   L VK+ HA+   WI 
Sbjct  245  VRPFLNRLIIEVLGSSETGGIAHRAKDEDAWTAFSNVAIRIEDQQLMVKSNHAFENDWIT  304

Query  303  TGDLAQWQQLDNTTLGFELLGRADRLIKLEEKRLSLDAIEQGIQSQPQVEQCHALVVEHE  362
            TGD A W   D T   F+LLGR DR++KLEEKRLSLDAIEQ IQ+   V+QCH LV EHE
Sbjct  305  TGDGAAWT--DATCQIFKLLGRTDRIVKLEEKRLSLDAIEQSIQALDVVKQCHVLVFEHE  362

Query  363  QRQLLACIVVLNADARASLKQLGKRQFVSQLKHQLSHGLERIAIPRLWRFLTDIPHNSQS  422
            QRQ+L CIVVL   AR  L+Q GK  FV+ LK QL  GLE IAIPR WRFL+ +P N+QS
Sbjct  363  QRQMLGCIVVLTEQAREQLQQQGKSAFVNHLKQQLKDGLETIAIPRQWRFLSQLPQNTQS  422

Query  423  KRDKHYLKSLFQPMLYPVVLQRTALENEHCWTLEFSPELECFKGHFPTQPIYPGVGQIGF  482
            K +K+YLK+LF+PML PVVL ++   +++ W LEF PEL CFKGHFPTQPIYPGVGQIGF
Sbjct  423  KLNKNYLKTLFKPMLQPVVLSQSQNSDDYIWELEFPPELACFKGHFPTQPIYPGVGQIGF  482

Query  483  VEAFAKQIWADLDWCSGYEQLKFQHVIVPYSVIAMKLTRKQHKISFELHQQDQTMASGRL  542
            ++ FAK IW+DL+WC GYEQLKFQ++I PY+V+ +K +RK HK+SFELH  +Q +ASGRL
Sbjct  483  LQQFAKSIWSDLNWCQGYEQLKFQNLIRPYAVVQLKFSRKDHKVSFELHDSEQILASGRL  542

Query  543  LFALK  547
            LFAL+
Sbjct  543  LFALQ  547


> A0A013SI07 AMP-binding enzyme family protein [Acinetobacter sp. 
826659]
Length=552

 Score =  667 bits (1721),  Expect = 0.0
 Identities = 338/550 (61%), Positives = 409/550 (74%), Gaps = 6/550 (1%)

Query  4    FIRSPRTLAINAQLKAISFAEFWQDVAAQAAWIQPSPQSVWALWEQDSYDFLVLLFAGLV  63
            FI S + L I+  L + SF +FWQDVA QAA I       WALWE DSY+FLVL FA L+
Sbjct  8    FIDSSQPLCIDGTLNSTSFNQFWQDVAVQAAAIAQMENLTWALWEADSYEFLVLFFAALL  67

Query  64   AKKRILLPPNRVAQLEQDFRRQDIHFLSRQLSISPVQMIPIPEWNTET-LNQAHIDFYTS  122
            AKK+ILLPPNRV +LEQDF  Q I+FL RQ      +++P+     +T L QA + FYTS
Sbjct  68   AKKQILLPPNRVRELEQDFSAQQIYFLKRQ---EIGEVVPLSLMLDDTFLEQAQLYFYTS  124

Query  123  GSTGQPKRIERNLAQLLSEVQGLDQTFGLAENSIALATVSHQHIYGLLFKVLWPLATGRC  182
            GSTG+PK+I R L QLL+EVQGL Q+F   E++ A+ATVSHQHIYGLLFK+L PLATGR 
Sbjct  125  GSTGEPKKIPRTLRQLLNEVQGLSQSFSFDEHATAIATVSHQHIYGLLFKLLLPLATGRS  184

Query  183  FYSPQLGFPEDVVIMQQRFTTSNRQNYVISSPALLKRWNKDMVLQACEAVFSSGGKLESG  242
            FY+PQ+ FPEDVV  Q++  T    NY+ISSPALLKRW  D++LQ C+ VFSSGGKLESG
Sbjct  185  FYNPQMAFPEDVVQAQKQLETMGLSNYLISSPALLKRWTTDVILQHCQMVFSSGGKLESG  244

Query  243  IRPQLNDAITEILGSSETGGIAYRHQDHAAWQAFADVDIQIEQAHLQVKTAHAYTEQWIE  302
            +RP LN  I E+LGSSETGGIA+R +D  AW AF++V I+IE   L VK+ HA+   WI 
Sbjct  245  VRPLLNRPIIEVLGSSETGGIAHRAKDEDAWTAFSNVAIRIEDQQLMVKSNHAFENDWIT  304

Query  303  TGDLAQWQQLDNTTLGFELLGRADRLIKLEEKRLSLDAIEQGIQSQPQVEQCHALVVEHE  362
            TGD A W   D T   F+LLGR DR++KLEEKRLSLDAIEQ IQ+   V+QCH LV EHE
Sbjct  305  TGDGAAWT--DATCQIFKLLGRTDRIVKLEEKRLSLDAIEQSIQALDVVKQCHVLVFEHE  362

Query  363  QRQLLACIVVLNADARASLKQLGKRQFVSQLKHQLSHGLERIAIPRLWRFLTDIPHNSQS  422
            QRQ+L CIVVL   A   L+Q GK  FVS LK QL   LE IAIPR WRFL+ +P N+QS
Sbjct  363  QRQMLGCIVVLTEQAHEQLQQQGKSAFVSHLKQQLKDSLETIAIPRQWRFLSQLPQNTQS  422

Query  423  KRDKHYLKSLFQPMLYPVVLQRTALENEHCWTLEFSPELECFKGHFPTQPIYPGVGQIGF  482
            K +K+YLK+LF+PML PVVL ++   + H W LEF PEL CFKGHFPTQPIYPGVGQIGF
Sbjct  423  KLNKNYLKTLFKPMLQPVVLSQSQNSDNHIWELEFPPELACFKGHFPTQPIYPGVGQIGF  482

Query  483  VEAFAKQIWADLDWCSGYEQLKFQHVIVPYSVIAMKLTRKQHKISFELHQQDQTMASGRL  542
            ++ FAK IW+DL WC GYEQLKFQ++I PY+V+ +KL RK+HK+SFEL   +Q +ASGRL
Sbjct  483  LQQFAKSIWSDLSWCQGYEQLKFQNLIRPYAVVQLKLARKEHKVSFELRVSEQILASGRL  542

Query  543  LFALKIAGEE  552
            LFAL+I  E+
Sbjct  543  LFALQIEVED  552


> A0A1E3MA15 Acyl-CoA synthetase [Acinetobacter baumannii]
Length=552

 Score =  667 bits (1721),  Expect = 0.0
 Identities = 339/550 (62%), Positives = 409/550 (74%), Gaps = 6/550 (1%)

Query  4    FIRSPRTLAINAQLKAISFAEFWQDVAAQAAWIQPSPQSVWALWEQDSYDFLVLLFAGLV  63
            FI S + L I+  L + SF +FWQDVA QAA I       WALWE DSY+FLVL FA L+
Sbjct  8    FIDSAQPLCIDGTLNSTSFNQFWQDVALQAAAIAQMENLTWALWEADSYEFLVLFFAALL  67

Query  64   AKKRILLPPNRVAQLEQDFRRQDIHFLSRQLSISPVQMIPIPEWNTET-LNQAHIDFYTS  122
            AKK+ILLPPNRV +LEQDF  Q I+FL RQ      +++P+     +T L QA + FYTS
Sbjct  68   AKKQILLPPNRVRELEQDFSAQQIYFLKRQ---EIGEVVPLSLTLDDTFLEQAQLYFYTS  124

Query  123  GSTGQPKRIERNLAQLLSEVQGLDQTFGLAENSIALATVSHQHIYGLLFKVLWPLATGRC  182
            GSTG+PK+I R L QLL+EVQGL Q+F   E++ A+ATVSHQHIYGLLFK+L PLA GR 
Sbjct  125  GSTGEPKKIPRTLRQLLNEVQGLSQSFSFDEHATAIATVSHQHIYGLLFKLLLPLARGRS  184

Query  183  FYSPQLGFPEDVVIMQQRFTTSNRQNYVISSPALLKRWNKDMVLQACEAVFSSGGKLESG  242
            FY+PQ+ FPEDVV  Q++  T    NY+ISSPALLKRW  D+VLQ C+ VFSSGGKLESG
Sbjct  185  FYNPQMAFPEDVVQAQKQLETMGLSNYLISSPALLKRWTTDVVLQDCQMVFSSGGKLESG  244

Query  243  IRPQLNDAITEILGSSETGGIAYRHQDHAAWQAFADVDIQIEQAHLQVKTAHAYTEQWIE  302
            +RP LN  I E+LGSSETGGIA+R +D  AW AF++V I+IE   L VK+ HAY   WI 
Sbjct  245  VRPLLNRPIIEVLGSSETGGIAHRAKDEDAWTAFSNVAIRIEDQQLMVKSNHAYENDWIT  304

Query  303  TGDLAQWQQLDNTTLGFELLGRADRLIKLEEKRLSLDAIEQGIQSQPQVEQCHALVVEHE  362
            TGD A W   D T   F+LLGR DR++KLEEKRLSLDAIEQ IQ+   V+QCH LV EHE
Sbjct  305  TGDGAAWT--DATCQIFKLLGRTDRIVKLEEKRLSLDAIEQSIQALDVVKQCHVLVFEHE  362

Query  363  QRQLLACIVVLNADARASLKQLGKRQFVSQLKHQLSHGLERIAIPRLWRFLTDIPHNSQS  422
            QRQ+L CIVVL   AR  L+Q GK  FVS LK QL  GLE IAIPR WRFL+ +P N+QS
Sbjct  363  QRQMLGCIVVLTEQAREQLQQQGKLAFVSHLKQQLKDGLETIAIPRQWRFLSQLPQNTQS  422

Query  423  KRDKHYLKSLFQPMLYPVVLQRTALENEHCWTLEFSPELECFKGHFPTQPIYPGVGQIGF  482
            K +K+YLK+LF+PML PVVL ++   ++H W LEF PEL CFKGHFPTQPIYPGVGQIGF
Sbjct  423  KLNKNYLKTLFKPMLQPVVLSQSQNSDDHIWELEFPPELACFKGHFPTQPIYPGVGQIGF  482

Query  483  VEAFAKQIWADLDWCSGYEQLKFQHVIVPYSVIAMKLTRKQHKISFELHQQDQTMASGRL  542
            ++ FAK IW+DL WC GYEQLKFQ++I PY+V+ +KL RK+HK+SFEL   +  +ASGRL
Sbjct  483  LQHFAKSIWSDLSWCQGYEQLKFQNLIRPYAVVQLKLARKEHKVSFELRDSEHILASGRL  542

Query  543  LFALKIAGEE  552
            LFAL+   E+
Sbjct  543  LFALQTEVED  552


> A0A013T9Y8 AMP-binding enzyme family protein [Acinetobacter sp. 
742879]
Length=552

 Score =  667 bits (1720),  Expect = 0.0
 Identities = 337/545 (62%), Positives = 408/545 (75%), Gaps = 6/545 (1%)

Query  4    FIRSPRTLAINAQLKAISFAEFWQDVAAQAAWIQPSPQSVWALWEQDSYDFLVLLFAGLV  63
            FI S + L I+  L + SF +FWQDVA QAA I       WALWE DSY+FLVL FA L+
Sbjct  8    FIDSAQPLCIDGTLNSTSFNQFWQDVALQAAAIAQMENLTWALWEADSYEFLVLFFAALL  67

Query  64   AKKRILLPPNRVAQLEQDFRRQDIHFLSRQLSISPVQMIPIPEWNTET-LNQAHIDFYTS  122
            AKK+ILLPPNRV +LEQDF  Q I+FL  Q      +++P+     +T L QA + FYTS
Sbjct  68   AKKQILLPPNRVRELEQDFAAQQIYFLKHQ---EIGEVVPLSLTLDDTFLEQAQLYFYTS  124

Query  123  GSTGQPKRIERNLAQLLSEVQGLDQTFGLAENSIALATVSHQHIYGLLFKVLWPLATGRC  182
            GSTG+PK+I R L QLL+EVQGL Q+F   E++ A+ATVSHQHIYGLLFK+L PLATGR 
Sbjct  125  GSTGEPKKIPRTLRQLLNEVQGLSQSFSFDEHATAIATVSHQHIYGLLFKLLLPLATGRS  184

Query  183  FYSPQLGFPEDVVIMQQRFTTSNRQNYVISSPALLKRWNKDMVLQACEAVFSSGGKLESG  242
            FY+PQ+ FPEDVV  Q++  T    NY+ISSPALLKRW  D+VLQ C+ VFSSGGKLESG
Sbjct  185  FYNPQMAFPEDVVQAQKQLETIGLSNYLISSPALLKRWTTDVVLQHCQMVFSSGGKLESG  244

Query  243  IRPQLNDAITEILGSSETGGIAYRHQDHAAWQAFADVDIQIEQAHLQVKTAHAYTEQWIE  302
            +RP LN  I E+LGSSETGGIA+R +D  AW AF++V I+IE   L VK+ HAY   WI 
Sbjct  245  VRPLLNRPIIEVLGSSETGGIAHRAKDEDAWTAFSNVAIRIEDQQLMVKSNHAYENDWIT  304

Query  303  TGDLAQWQQLDNTTLGFELLGRADRLIKLEEKRLSLDAIEQGIQSQPQVEQCHALVVEHE  362
            TGD A W   D T   F+LLGR DR++KLEEKRLSLDAIEQ IQ+   V+QCH LV EHE
Sbjct  305  TGDGAAWT--DATCQIFKLLGRTDRIVKLEEKRLSLDAIEQSIQALDVVKQCHVLVFEHE  362

Query  363  QRQLLACIVVLNADARASLKQLGKRQFVSQLKHQLSHGLERIAIPRLWRFLTDIPHNSQS  422
            QRQ+L CIVVL   AR  L+Q GK  FV+ LK QL  GLE IAIPR WRFL+ +P N+QS
Sbjct  363  QRQMLGCIVVLTEQAREQLQQQGKSAFVNHLKQQLKDGLETIAIPRQWRFLSQLPQNTQS  422

Query  423  KRDKHYLKSLFQPMLYPVVLQRTALENEHCWTLEFSPELECFKGHFPTQPIYPGVGQIGF  482
            K +K+YLK+LF+PML PVVL ++   ++H W LEF PEL CFKGHFPTQPIYPGVGQIGF
Sbjct  423  KLNKNYLKTLFKPMLQPVVLSQSQNSDDHIWELEFPPELACFKGHFPTQPIYPGVGQIGF  482

Query  483  VEAFAKQIWADLDWCSGYEQLKFQHVIVPYSVIAMKLTRKQHKISFELHQQDQTMASGRL  542
            ++ FAK IW+DL WC GYEQLKFQ++I PY+V+ +K +RK+HK+SFEL   +Q +ASGRL
Sbjct  483  LQQFAKSIWSDLSWCQGYEQLKFQNLIRPYAVVQLKFSRKEHKVSFELRDSEQILASGRL  542

Query  543  LFALK  547
            LFAL+
Sbjct  543  LFALQ  547


> F0KMQ8 Aconitate hydratase [Acinetobacter calcoaceticus (strain 
PHEA-2)]
Length=552

 Score =  667 bits (1720),  Expect = 0.0
 Identities = 337/545 (62%), Positives = 410/545 (75%), Gaps = 6/545 (1%)

Query  4    FIRSPRTLAINAQLKAISFAEFWQDVAAQAAWIQPSPQSVWALWEQDSYDFLVLLFAGLV  63
            FI S + L I+  L + SF +FWQDVA QAA I       WALWE DSY+FLVL FA L+
Sbjct  8    FIDSAQPLCIDGTLNSTSFNQFWQDVALQAAAIAQMDNLTWALWEADSYEFLVLFFAALL  67

Query  64   AKKRILLPPNRVAQLEQDFRRQDIHFLSRQLSISPVQMIPIPEWNTET-LNQAHIDFYTS  122
            AKK+ILLPPNRV +LEQDF  Q I+FL RQ      +++P+     +T L QA + FYTS
Sbjct  68   AKKQILLPPNRVRELEQDFSAQQIYFLKRQ---EIGEVVPLSLTLDDTFLEQAQLYFYTS  124

Query  123  GSTGQPKRIERNLAQLLSEVQGLDQTFGLAENSIALATVSHQHIYGLLFKVLWPLATGRC  182
            GSTG+PK+I R L QLL+EVQGL Q+F   E++IA+ATVSHQHIYGLLFK+L PLATGR 
Sbjct  125  GSTGEPKKIPRTLKQLLNEVQGLSQSFSFDEHAIAIATVSHQHIYGLLFKLLLPLATGRS  184

Query  183  FYSPQLGFPEDVVIMQQRFTTSNRQNYVISSPALLKRWNKDMVLQACEAVFSSGGKLESG  242
            FY PQ+ FPEDVV  Q++  T    NY+ISSPALLKRW  D+VLQ C+ VFSSGGKLESG
Sbjct  185  FYVPQMAFPEDVVQAQKQLETMGLSNYLISSPALLKRWTTDVVLQHCQMVFSSGGKLESG  244

Query  243  IRPQLNDAITEILGSSETGGIAYRHQDHAAWQAFADVDIQIEQAHLQVKTAHAYTEQWIE  302
            +RP LN  I E+LGSSETGGIA+R +D  AW AF++V I+IE+  L VK+ HA+   WI 
Sbjct  245  VRPFLNRPIIEVLGSSETGGIAHRAKDEDAWTAFSNVAIRIEEQQLMVKSNHAFENSWIT  304

Query  303  TGDLAQWQQLDNTTLGFELLGRADRLIKLEEKRLSLDAIEQGIQSQPQVEQCHALVVEHE  362
            TGD A W   D T   F+L+GR DR++KLEEKRLSLDAIEQ IQ+   V+QCH LV EHE
Sbjct  305  TGDGAVWT--DTTCQIFKLMGRTDRIVKLEEKRLSLDAIEQSIQALDVVKQCHVLVFEHE  362

Query  363  QRQLLACIVVLNADARASLKQLGKRQFVSQLKHQLSHGLERIAIPRLWRFLTDIPHNSQS  422
            QRQ+L CIVVL   AR  L+Q GK  FV+ LK QL  GLE IAIPR WRFL+ +P N+QS
Sbjct  363  QRQMLGCIVVLTEQAREQLQQQGKSAFVNHLKQQLKDGLETIAIPRQWRFLSLLPQNTQS  422

Query  423  KRDKHYLKSLFQPMLYPVVLQRTALENEHCWTLEFSPELECFKGHFPTQPIYPGVGQIGF  482
            K +K+YLK+LF+PML PVVL ++   ++H W LEF PEL CFKGHFPTQPIYPGVGQIGF
Sbjct  423  KLNKNYLKTLFKPMLQPVVLSQSQNSDDHIWELEFPPELACFKGHFPTQPIYPGVGQIGF  482

Query  483  VEAFAKQIWADLDWCSGYEQLKFQHVIVPYSVIAMKLTRKQHKISFELHQQDQTMASGRL  542
            ++ FAK IW+DL WC GYEQLKFQ++I PY+V+ +K +RK+HK+SFEL   +Q +ASGRL
Sbjct  483  LQQFAKSIWSDLSWCQGYEQLKFQNLIRPYAVVQLKFSRKEHKVSFELRDSEQILASGRL  542

Query  543  LFALK  547
            LFAL+
Sbjct  543  LFALQ  547


> Q25B38 Peptide synthetase [Planktothrix rubescens]
Length=484

 Score = 58.9 bits (141),  Expect = 6e-12
 Identities = 90/384 (23%), Positives = 140/384 (36%), Gaps = 79/384 (21%)

Query  105  PEWNTETLNQAHIDFYTSGSTGQPKRIERNLAQLLSEVQGLDQTFGLAENSIALATVSHQ  164
            P  + ++ N A++  YTSGSTG+PK +      + + +     ++    N   L  +S  
Sbjct  83   PSSSVQSENLAYL-IYTSGSTGKPKGVMNLHQGICNNILRTKDSYPTT-NRDRLLQISSL  140

Query  165  HIYGLLFKVLWPLATGRCFYSPQLGFPEDVVIMQQRFTTSNRQNYVISSPALLKRWNKDM  224
                 +  + W L++G     P+    +D   + Q      + + V   P+LL+   +  
Sbjct  141  AFDASVLDIFWSLSSGMALIIPKPEGNKDPAYLIQ-LMIEKKVSQVFFVPSLLRLLLQQP  199

Query  225  VLQAC---EAVFSSGGKLESGIRPQL----NDAITEILGSSETGGIAYRHQDHAAWQA--  275
             L+ C   + VF  G  L S +  Q     N  +  + G +ET        D   WQ   
Sbjct  200  NLENCRYLKRVFCGGEALSSELMQQFFQHFNCELHNLYGPTETS------VDATCWQCPP  253

Query  276  ------------FADVDIQIEQAHLQ--------------VKTAHAYTEQW---------  300
                         A+  I I   HLQ              ++ A  Y  Q          
Sbjct  254  RTDDPAIAIGRPIANTQIYILDRHLQPVPVGIVGELHIGGIQLARGYLNQLELTAEKFIP  313

Query  301  --------IETGDLAQWQQLDNTTLGFELLGRADRLIKLEEKRLSLDAIEQGIQSQPQVE  352
                     +TGDL ++    N     E LGR D  +KL   R+ L  I+  + S PQ+ 
Sbjct  314  NPFAGGRLYKTGDLVRYLADGN----IEYLGRIDNQVKLRGLRIELGEIQTILDSHPQIN  369

Query  353  QCHALV-VEHEQRQLLACIVVLNADARASLKQLGKRQFVSQLKHQLSHGLERIAIPRLWR  411
            Q   ++  + E  Q L   +   A    +L     RQF       L   L    IP  + 
Sbjct  370  QSVVIIQTDSEDNQRLVAYI---ASQHQALTPKELRQF-------LQPKLPAYMIPSAFV  419

Query  412  FLTDIPHNSQSKRDKHYLKSLFQP  435
             L + P N+  K D   LK L QP
Sbjct  420  ILPEFPLNANGKVD---LKKLPQP  440


> Q25B37 Peptide synthetase [Planktothrix rubescens]
Length=484

 Score = 58.9 bits (141),  Expect = 6e-12
 Identities = 90/384 (23%), Positives = 140/384 (36%), Gaps = 79/384 (21%)

Query  105  PEWNTETLNQAHIDFYTSGSTGQPKRIERNLAQLLSEVQGLDQTFGLAENSIALATVSHQ  164
            P  + ++ N A++  YTSGSTG+PK +      + + +     ++    N   L  +S  
Sbjct  83   PSSSVQSENLAYL-IYTSGSTGKPKGVMNLHQGICNNILRTKDSYPTT-NRDRLLQISSL  140

Query  165  HIYGLLFKVLWPLATGRCFYSPQLGFPEDVVIMQQRFTTSNRQNYVISSPALLKRWNKDM  224
                 +  + W L++G     P+    +D   + Q      + + V   P+LL+   +  
Sbjct  141  AFDASVLDIFWSLSSGMALIIPKPEGNKDPAYLIQ-LMIEKKVSQVFFVPSLLRLLLQQP  199

Query  225  VLQAC---EAVFSSGGKLESGIRPQL----NDAITEILGSSETGGIAYRHQDHAAWQA--  275
             L+ C   + VF  G  L S +  Q     N  +  + G +ET        D   WQ   
Sbjct  200  NLENCRYLKRVFCGGEALSSELMQQFFQHFNCELHNLYGPTETS------VDATCWQCPP  253

Query  276  ------------FADVDIQIEQAHLQ--------------VKTAHAYTEQW---------  300
                         A+  I I   HLQ              ++ A  Y  Q          
Sbjct  254  RTDDPAIAIGRPIANTQIYILDRHLQPVPVGIVGELHIGGIQLARGYLNQLELTAEKFIP  313

Query  301  --------IETGDLAQWQQLDNTTLGFELLGRADRLIKLEEKRLSLDAIEQGIQSQPQVE  352
                     +TGDL ++    N     E LGR D  +KL   R+ L  I+  + S PQ+ 
Sbjct  314  NPFAGGRLYKTGDLVRYLADGN----IEYLGRIDNQVKLRGLRIELGEIQTILDSHPQIN  369

Query  353  QCHALV-VEHEQRQLLACIVVLNADARASLKQLGKRQFVSQLKHQLSHGLERIAIPRLWR  411
            Q   ++  + E  Q L   +   A    +L     RQF       L   L    IP  + 
Sbjct  370  QSVVIIQTDSEDNQRLVAYI---ASQHQALTPKELRQF-------LQPKLPAYMIPSAFV  419

Query  412  FLTDIPHNSQSKRDKHYLKSLFQP  435
             L + P N+  K D   LK L QP
Sbjct  420  ILPEFPLNANGKVD---LKKLPQP  440


> Q2EYY6 Putative caffeoyl CoA-ligase [Saccharothrix espanaensis]
Length=363

 Score = 57.4 bits (137),  Expect = 1e-11
 Identities = 72/262 (27%), Positives = 108/262 (41%), Gaps = 48/262 (18%)

Query  117  IDFYTSGSTGQPKRIERNLAQLLSEVQGLDQTFGLAEN-SIALATVSHQHIYGLLFKVLW  175
            +DF TSGSTG P R  R L + L    G+       +    A+      H+YG L  VL 
Sbjct  37   VDFRTSGSTG-PSRSRRRLRENLWLEAGMLADLVAPDGPEAAVCFAPPTHVYGALASVLV  95

Query  176  PLATG-RCFYSPQL--GFPEDVVIMQQRFTTSNRQNYVISSP----ALLKR--WNKDM--  224
            P   G   +Y P      PE              +  V+++P     LL+   W + +  
Sbjct  96   PARLGIPAWYRPTFFGAMPE----------VGRGRVLVVATPWIFTLLLQHLDWVRGLEH  145

Query  225  --VLQACEAVFSSGGKLESGIRPQLNDAITEILGSSETGGIAYRHQDHA---AWQAFADV  279
              VL +   + ++ G+  +   P+    I E+LGS+E GGIA+R        AW  F DV
Sbjct  146  VTVLYSSAVLPAAAGEFLAEAGPE-RTRIVEVLGSTEAGGIAFRQWRAGTPPAWTLFPDV  204

Query  280  --------------DIQIEQAHLQVKTAHAYTEQWIETGDLAQWQQLDNTTLGFELLGRA  325
                           + +    L  +        W ET D      LD  T  F L+GRA
Sbjct  205  AFAGGPGEGPDDEVPLVVSSPRLAFEPGRPPPATW-ETDDRVV--PLDGRT--FRLVGRA  259

Query  326  DRLIKLEEKRLSLDAIEQGIQS  347
             RL+K+  +R++LD  E  +++
Sbjct  260  GRLVKVNGRRINLDEAEHSVRA  281


> Q25B43 Peptide synthetase [Planktothrix rubescens]
Length=484

 Score = 57.8 bits (138),  Expect = 1e-11
 Identities = 88/384 (23%), Positives = 138/384 (36%), Gaps = 79/384 (21%)

Query  105  PEWNTETLNQAHIDFYTSGSTGQPKRIERNLAQLLSEVQGLDQTFGLAENSIALATVSHQ  164
            P  + ++ N A++  YTSGSTG+PK +      + + +     ++    N   L  +S  
Sbjct  83   PSSSVQSENLAYL-IYTSGSTGKPKGVMNLHQGICNNILRTKDSYPTT-NRDRLLQISSL  140

Query  165  HIYGLLFKVLWPLATGRCFYSPQLGFPEDVVIMQQRFTTSNRQNYVISSPALLKRWNKDM  224
                 +  + W L++G     P+    +D   + Q      + + V   P+LL+   +  
Sbjct  141  AFDASVLDIFWSLSSGMALIIPKPEGNKDPAYLIQ-LMIEKKVSQVFFVPSLLRLLLQQP  199

Query  225  VLQAC---EAVFSSGGKLESGIRPQL----NDAITEILGSSETGGIAYRHQDHAAWQA--  275
             L+ C   + VF  G  L S +  Q     N  +  + G +ET        D   WQ   
Sbjct  200  NLENCRYLKRVFCGGEALSSELMQQFFQHFNCELHNVYGPTETS------VDATCWQCPP  253

Query  276  ------------FADVDIQIEQAHLQ--------------VKTAHAYTEQW---------  300
                         A+  I I   HLQ              ++ A  Y  Q          
Sbjct  254  RTDDPAIAIGRPIANTQIYILDRHLQPVPVGIVGELHIGGIQLARGYLNQLELTAEKFIP  313

Query  301  --------IETGDLAQWQQLDNTTLGFELLGRADRLIKLEEKRLSLDAIEQGIQSQPQVE  352
                     +TGDL ++    N     E LGR D  +KL   R+ L  I+  + S PQ+ 
Sbjct  314  NPFGQGKLYKTGDLVRYLADGN----IEYLGRIDNQVKLRGLRIELGEIQTILDSHPQIN  369

Query  353  QCHALV-VEHEQRQLLACIVVLNADARASLKQLGKRQFVSQLKHQLSHGLERIAIPRLWR  411
            Q   ++  + E  Q L   V     A              +L+  L   L    IP  + 
Sbjct  370  QSVVIIQTDSEDNQRLVAYVDSQNQALTP----------KELRQFLQPKLPAYMIPSAFV  419

Query  412  FLTDIPHNSQSKRDKHYLKSLFQP  435
             L + P N+  K D   LK L QP
Sbjct  420  ILPEFPLNANGKVD---LKKLPQP  440


> Q25B41 Peptide synthetase [Planktothrix rubescens]
Length=484

 Score = 57.8 bits (138),  Expect = 1e-11
 Identities = 88/384 (23%), Positives = 138/384 (36%), Gaps = 79/384 (21%)

Query  105  PEWNTETLNQAHIDFYTSGSTGQPKRIERNLAQLLSEVQGLDQTFGLAENSIALATVSHQ  164
            P  + ++ N A++  YTSGSTG+PK +      + + +     ++    N   L  +S  
Sbjct  83   PSSSVQSENLAYL-IYTSGSTGKPKGVMNLHQGICNNILRTKDSYPTT-NRDRLLQISSL  140

Query  165  HIYGLLFKVLWPLATGRCFYSPQLGFPEDVVIMQQRFTTSNRQNYVISSPALLKRWNKDM  224
                 +  + W L++G     P+    +D   + Q      + + V   P+LL+   +  
Sbjct  141  AFDASVLDIFWSLSSGMALIIPKPEGNKDPAYLIQ-LMIEKKVSQVFFVPSLLRLLLQQP  199

Query  225  VLQAC---EAVFSSGGKLESGIRPQL----NDAITEILGSSETGGIAYRHQDHAAWQA--  275
             L+ C   + VF  G  L S +  Q     N  +  + G +ET        D   WQ   
Sbjct  200  NLENCRYLKRVFCGGEALSSELMQQFFQHFNCELHNVYGPTETS------VDATCWQCPP  253

Query  276  ------------FADVDIQIEQAHLQ--------------VKTAHAYTEQW---------  300
                         A+  I I   HLQ              ++ A  Y  Q          
Sbjct  254  RTDDPAIAIGRPIANTQIYILDRHLQPVPVGIVGELHIGGIQLARGYLNQLELTAEKFIP  313

Query  301  --------IETGDLAQWQQLDNTTLGFELLGRADRLIKLEEKRLSLDAIEQGIQSQPQVE  352
                     +TGDL ++    N     E LGR D  +KL   R+ L  I+  + S PQ+ 
Sbjct  314  NPFGQGKLYKTGDLVRYLADGN----IEYLGRIDNQVKLRGLRIELGEIQTILDSHPQIN  369

Query  353  QCHALV-VEHEQRQLLACIVVLNADARASLKQLGKRQFVSQLKHQLSHGLERIAIPRLWR  411
            Q   ++  + E  Q L   V     A              +L+  L   L    IP  + 
Sbjct  370  QSVVIIQTDSEDNQRLVAYVDSQNQALTP----------KELRQFLQPKLPAYMIPSAFV  419

Query  412  FLTDIPHNSQSKRDKHYLKSLFQP  435
             L + P N+  K D   LK L QP
Sbjct  420  ILPEFPLNANGKVD---LKKLPQP  440


> Q25B47 Peptide synthetase [Planktothrix rubescens]
Length=484

 Score = 57.8 bits (138),  Expect = 1e-11
 Identities = 88/384 (23%), Positives = 138/384 (36%), Gaps = 79/384 (21%)

Query  105  PEWNTETLNQAHIDFYTSGSTGQPKRIERNLAQLLSEVQGLDQTFGLAENSIALATVSHQ  164
            P  + ++ N A++  YTSGSTG+PK +      + + +     ++    N   L  +S  
Sbjct  83   PSSSVQSENLAYL-IYTSGSTGKPKGVMNLHQGICNNILRTKDSYPTT-NRDRLLQISSL  140

Query  165  HIYGLLFKVLWPLATGRCFYSPQLGFPEDVVIMQQRFTTSNRQNYVISSPALLKRWNKDM  224
                 +  + W L++G     P+    +D   + Q      + + V   P+LL+   +  
Sbjct  141  AFDASVLDIFWSLSSGMALIIPKPEGNKDPAYLIQ-LMIEKKVSQVFFVPSLLRLLLQQP  199

Query  225  VLQAC---EAVFSSGGKLESGIRPQL----NDAITEILGSSETGGIAYRHQDHAAWQA--  275
             L+ C   + VF  G  L S +  Q     N  +  + G +ET        D   WQ   
Sbjct  200  NLENCRYLKRVFCGGEALSSELMQQFFQHFNCELHNVYGPTETS------VDATCWQCPP  253

Query  276  ------------FADVDIQIEQAHLQ--------------VKTAHAYTEQW---------  300
                         A+  I I   HLQ              ++ A  Y  Q          
Sbjct  254  RTDDPAIAIGRPIANTQIYILDRHLQPVPVGIVGELHIGGIQLARGYLNQLELTAEKFIP  313

Query  301  --------IETGDLAQWQQLDNTTLGFELLGRADRLIKLEEKRLSLDAIEQGIQSQPQVE  352
                     +TGDL ++    N     E LGR D  +KL   R+ L  I+  + S PQ+ 
Sbjct  314  NPFAGGKLYKTGDLVRYLADGN----IEYLGRIDNQVKLRGLRIELGEIQTILDSHPQIN  369

Query  353  QCHALV-VEHEQRQLLACIVVLNADARASLKQLGKRQFVSQLKHQLSHGLERIAIPRLWR  411
            Q   ++  + E  Q L   V     A              +L+  L   L    IP  + 
Sbjct  370  QSVVIIQTDSEDNQRLVAYVDSQNQALTP----------KELRQFLQPKLPAYMIPSAFV  419

Query  412  FLTDIPHNSQSKRDKHYLKSLFQP  435
             L + P N+  K D   LK L QP
Sbjct  420  ILPEFPLNANGKVD---LKKLPQP  440


> U5TSR1 McyC [Nostoc sp. 152]
Length=1297

 Score = 57.0 bits (136),  Expect = 4e-11
 Identities = 98/382 (26%), Positives = 146/382 (38%), Gaps = 79/382 (21%)

Query  113  NQAHIDFYTSGSTGQPKRIERNLAQLLSEVQGLDQTFGLAENSIALATVSHQHIYGLLFK  172
            N A++  YTSGSTG+PK +      + + +     T  L  N   L          + ++
Sbjct  622  NLAYV-IYTSGSTGKPKGVMNIQRGICNNLLQAISTHSLTANKRILQITPFSFDVSV-WE  679

Query  173  VLWPLATGRCFYSPQLGFPEDV-----VIMQQRFTTSNRQNYVISSPALLKRWNKDMVLQ  227
            +  PL  G      +    +D      +I QQ+ T     N+V   P++L+ + ++  L+
Sbjct  680  IFCPLIAGATLVVAKPEGHKDTNYLINLIAQQKVT---HINFV---PSMLRVFLQEANLE  733

Query  228  ACEA---VFSSGGKLESGIRPQL----NDAITEILGSSETG--GIAYR------HQDHAA  272
             C A   VF  G  L   +  Q     N  +    G +ET      Y+      HQ    
Sbjct  734  NCHALQQVFCGGEALSYELTQQFFERFNCELYNFYGPTETAIDATCYQCTPQSSHQIIPI  793

Query  273  WQAFADVDIQIEQAHLQ--------------VKTAHAYTEQ-----------------WI  301
             +  A+  I I  AHLQ                 A  Y  Q                   
Sbjct  794  GRPIANTQIYILDAHLQPVPIGIIGELHIGGYPLARGYLNQPELTAKKFIYNPFGNGKLY  853

Query  302  ETGDLAQWQQLDNTTLGFELLGRADRLIKLEEKRLSLDAIEQGIQSQPQVEQCHALVVEH  361
            +TGDLA++    N     E +GR D  +KL   R+ L  IE  + S PQV Q  A+V E 
Sbjct  854  KTGDLARYLPDGN----IEFVGRIDHQVKLRGLRIELGEIESILDSHPQVAQTVAIVRED  909

Query  362  --EQRQLLACIVVLNADARASLKQLGKRQFVSQLKHQLSHGLERIAIPRLWRFLTDIPHN  419
              + +QL+  +        A+  QL      S L+  L   L    IP  +  L+D+P N
Sbjct  910  TVQNQQLVGYV--------AAKDQL---LTPSDLRRFLQQKLPSYMIPSAFVILSDLPLN  958

Query  420  SQSKRDKHYLKSLFQPMLYPVV  441
               K D    K L +P   P+V
Sbjct  959  PSGKID---YKKLPKPDEIPIV  977


> A0A223PIJ7 SulM [Pseudomonas acidophila]
Length=1800

 Score = 56.6 bits (135),  Expect = 5e-11
 Identities = 44/151 (29%), Positives = 75/151 (50%), Gaps = 17/151 (11%)

Query  285   QAHLQVKTAHAYTEQWIETGDLAQWQQLDNTTLGFELLGRADRLIKLEEKRLSLDAIEQG  344
             QA ++      Y  +   TGDL   ++  +  L F   GR DR +K+   R+ L+ +E  
Sbjct  1331  QAFVKSPFPDRYKGRLYRTGDLGAMRE--DGVLMFH--GRKDRQVKVRGMRIELEEVEAS  1386

Query  345   IQSQPQVEQCHALVVEHEQRQLLACI-VVLNADARASLKQLGKRQFVSQLKHQLSHGLER  403
             +++ P V Q   LV++ E R+   C  VV +AD R ++        V+ LK +L   +  
Sbjct  1387  LRAIPTVRQAAVLVIQPENREAFLCAYVVPHADERDAI--------VNALKAKLPPYM--  1436

Query  404   IAIPRLWRFLTDIPHNSQSKRDKHYLKSLFQ  434
               +P ++RF T++P     K D++ L+  FQ
Sbjct  1437  --VPSVFRFETELPQLPSGKVDRNRLREQFQ  1465


 Score = 22.3 bits (46),  Expect = 1.7
 Identities = 8/10 (80%), Positives = 10/10 (100%), Gaps = 0/10 (0%)

Query  120   YTSGSTGQPK  129
             +TSGSTG+PK
Sbjct  1113  FTSGSTGKPK  1122


> Q25B40 Peptide synthetase [Planktothrix rubescens]
Length=484

 Score = 55.8 bits (133),  Expect = 5e-11
 Identities = 85/374 (23%), Positives = 134/374 (36%), Gaps = 76/374 (20%)

Query  105  PEWNTETLNQAHIDFYTSGSTGQPKRIERNLAQLLSEVQGLDQTFGLAENSIALATVSHQ  164
            P  + ++ N A++  YTSGSTG+PK +      + + +     ++    N   L  +S  
Sbjct  83   PSSSVQSENLAYL-IYTSGSTGKPKGVMNLHQGICNNILRTKDSYPTT-NRDRLLQISSL  140

Query  165  HIYGLLFKVLWPLATGRCFYSPQLGFPEDVVIMQQRFTTSNRQNYVISSPALLKRWNKDM  224
                 +  + W L++G     P+    +D   + Q      + + V   P+LL+   +  
Sbjct  141  AFDASVLDIFWSLSSGMALIIPKPEGNKDPAYLIQ-LMIEKKVSQVFFVPSLLRLLLQQP  199

Query  225  VLQAC---EAVFSSGGKLESGIRPQL----NDAITEILGSSETGGIAYRHQDHAAWQA--  275
             L+ C   + VF  G  L S +  Q     N  +  + G +ET        D   WQ   
Sbjct  200  NLENCRYLKRVFCGGEALSSELMQQFFQHFNCELHNVYGPTETS------VDATCWQCPP  253

Query  276  ------------FADVDIQIEQAHLQ--------------VKTAHAYTEQW---------  300
                         A+  I I   HLQ              ++ A  Y  Q          
Sbjct  254  RTDDPAIAIGRPIANTQIYILDRHLQPVPVGIVGELHIGGIQLARGYLNQLELTAEKFIP  313

Query  301  --------IETGDLAQWQQLDNTTLGFELLGRADRLIKLEEKRLSLDAIEQGIQSQPQVE  352
                     +TGDL ++    N     E LGR D  +KL   R+ L  I+  + S PQ+ 
Sbjct  314  NPFAGGKLYKTGDLVRYLADGN----IEYLGRIDNQVKLRGLRIELGEIQTILDSHPQIN  369

Query  353  QCHALV-VEHEQRQLLACIVVLNADARASLKQLGKRQFVSQLKHQLSHGLERIAIPRLWR  411
            Q   ++  + E  Q L   +   A    +L     RQF       L   L    IP  + 
Sbjct  370  QSVVIIQTDSEDNQRLVAYI---ASQHQALTPKELRQF-------LQPKLPAYMIPSAFV  419

Query  412  FLTDIPHNSQSKRD  425
             L + P N   K D
Sbjct  420  ILPEFPLNPNGKVD  433


> Q25B36 Peptide synthetase [Planktothrix rubescens]
Length=484

 Score = 55.5 bits (132),  Expect = 7e-11
 Identities = 85/374 (23%), Positives = 134/374 (36%), Gaps = 76/374 (20%)

Query  105  PEWNTETLNQAHIDFYTSGSTGQPKRIERNLAQLLSEVQGLDQTFGLAENSIALATVSHQ  164
            P  + ++ N A++  YTSGSTG+PK +      + + +     ++    N   L  +S  
Sbjct  83   PSSSVQSENLAYL-IYTSGSTGKPKGVMNLHQGICNNILRTKDSYPTT-NRDRLLQISSL  140

Query  165  HIYGLLFKVLWPLATGRCFYSPQLGFPEDVVIMQQRFTTSNRQNYVISSPALLKRWNKDM  224
                 +  + W L++G     P+    +D   + Q      + + V   P+LL+   +  
Sbjct  141  AFDASVLDIFWSLSSGMALIIPKPEGNKDPAYLIQ-LMIEKKVSQVFFVPSLLRLLLQQP  199

Query  225  VLQAC---EAVFSSGGKLESGIRPQL----NDAITEILGSSETGGIAYRHQDHAAWQA--  275
             L+ C   + VF  G  L S +  Q     N  +  + G +ET        D   WQ   
Sbjct  200  NLENCRYLKRVFCGGEALSSELMQQFFQHFNCELHNLYGPTETS------VDATCWQCPP  253

Query  276  ------------FADVDIQIEQAHLQ--------------VKTAHAYTEQW---------  300
                         A+  I I   HLQ              ++ A  Y  Q          
Sbjct  254  RTDDPAIAIGRPIANTQIYILDRHLQPVPVGIVGELHIGGIQLARGYLNQLELTAEKFIP  313

Query  301  --------IETGDLAQWQQLDNTTLGFELLGRADRLIKLEEKRLSLDAIEQGIQSQPQVE  352
                     +TGDL ++    N     E LGR D  +KL   R+ L  I+  + S PQ+ 
Sbjct  314  NPFAGGKLYKTGDLVRYLADGN----IEYLGRIDNQVKLRGLRIELGEIQTILDSHPQIN  369

Query  353  QCHALV-VEHEQRQLLACIVVLNADARASLKQLGKRQFVSQLKHQLSHGLERIAIPRLWR  411
            Q   ++  + E  Q L   +   A    +L     RQF       L   L    IP  + 
Sbjct  370  QSVVIIQTDSEDNQRLVAYI---ASQHQALTPKELRQF-------LQPKLPAYMIPSAFV  419

Query  412  FLTDIPHNSQSKRD  425
             L + P N   K D
Sbjct  420  ILPEFPLNPNGKVD  433


> Q25B33 Peptide synthetase [Planktothrix rubescens]
Length=484

 Score = 55.5 bits (132),  Expect = 7e-11
 Identities = 85/374 (23%), Positives = 134/374 (36%), Gaps = 76/374 (20%)

Query  105  PEWNTETLNQAHIDFYTSGSTGQPKRIERNLAQLLSEVQGLDQTFGLAENSIALATVSHQ  164
            P  + ++ N A++  YTSGSTG+PK +      + + +     ++    N   L  +S  
Sbjct  83   PSSSVQSENLAYL-IYTSGSTGKPKGVMNLHQGICNNILRTKDSYPTT-NRDRLLQISSL  140

Query  165  HIYGLLFKVLWPLATGRCFYSPQLGFPEDVVIMQQRFTTSNRQNYVISSPALLKRWNKDM  224
                 +  + W L++G     P+    +D   + Q      + + V   P+LL+   +  
Sbjct  141  AFDASVLDIFWSLSSGMALIIPKPEGNKDPAYLIQ-LMIEKKVSQVFFVPSLLRLLLQQP  199

Query  225  VLQAC---EAVFSSGGKLESGIRPQL----NDAITEILGSSETGGIAYRHQDHAAWQA--  275
             L+ C   + VF  G  L S +  Q     N  +  + G +ET        D   WQ   
Sbjct  200  NLENCRYLKRVFCGGEALSSELMQQFFQHFNCELHNLYGPTETS------VDATCWQCPP  253

Query  276  ------------FADVDIQIEQAHLQ--------------VKTAHAYTEQW---------  300
                         A+  I I   HLQ              ++ A  Y  Q          
Sbjct  254  RTDDPAIAIGRPIANTQIYILDRHLQPVPVGIVGELHIGGIQLARGYLNQLELTAEKFIP  313

Query  301  --------IETGDLAQWQQLDNTTLGFELLGRADRLIKLEEKRLSLDAIEQGIQSQPQVE  352
                     +TGDL ++    N     E LGR D  +KL   R+ L  I+  + S PQ+ 
Sbjct  314  NPFAGGRLYKTGDLVRYLADGN----IEYLGRIDNQVKLRGLRIELGEIQTILDSHPQIN  369

Query  353  QCHALV-VEHEQRQLLACIVVLNADARASLKQLGKRQFVSQLKHQLSHGLERIAIPRLWR  411
            Q   ++  + E  Q L   +   A    +L     RQF       L   L    IP  + 
Sbjct  370  QSVVIIQTDSEDNQRLVAYI---ASQHQALTPKELRQF-------LQPKLPAYMIPSAFV  419

Query  412  FLTDIPHNSQSKRD  425
             L + P N   K D
Sbjct  420  ILPEFPLNPNGKVD  433


> D0V1Z0 SrfAA [Bacillus sp. CS93]
Length=391

 Score = 54.3 bits (129),  Expect = 1e-10
 Identities = 37/132 (28%), Positives = 63/132 (48%), Gaps = 14/132 (11%)

Query  298  EQWIETGDLAQWQQLDNTTLGFELLGRADRLIKLEEKRLSLDAIEQGIQSQPQVEQCHAL  357
            E+  +TGDLA+W  L N  +  E +GR D  +K+  +R+ L  IE  +QS  Q+++C  L
Sbjct  224  ERMYKTGDLARW--LPNGDI--EFIGRIDHQVKIRGQRIELGEIEHQLQSHDQIQECIVL  279

Query  358  VVEHEQRQLLACIVVLNADARASLKQLGKRQFVSQLKHQLSHGLERIAIPRLWRFLTDIP  417
             V+      L C   +       L+++  R    +L+   +  L    IP ++  L ++P
Sbjct  280  AVDQGAGDKLLCAYFV------GLREISSR----ELREHTAKDLPAYMIPSVFIQLDELP  329

Query  418  HNSQSKRDKHYL  429
                 K D+  L
Sbjct  330  LTGNGKIDRRAL  341


 Score = 20.8 bits (42),  Expect = 4.5
 Identities = 7/10 (70%), Positives = 9/10 (90%), Gaps = 0/10 (0%)

Query  120  YTSGSTGQPK  129
            YT+G+TG PK
Sbjct  1    YTTGTTGTPK  10


> A0A2D1VNM3 Non-ribosomal peptide synthetase [Nostoc sp. CENA543]
Length=4116

 Score = 55.1 bits (131),  Expect = 2e-10
 Identities = 89/418 (21%), Positives = 152/418 (36%), Gaps = 89/418 (21%)

Query  68    ILLPPNRVAQLEQDFRRQDIHFLSRQLSISPVQMIPIPEWNTETLNQAHIDFYTSGSTGQ  127
             +L   + ++QL  D R      +    +   + +   P   T+  N A++  YTSGSTG+
Sbjct  630   LLSQKSLLSQLPLDNRENPCQVICLDQNTFNLALTENPSRQTQPDNLAYV-IYTSGSTGR  688

Query  128   PKRIERNLAQLLSEVQGLDQTFGLAENSIALATVSHQHIYGLLFKVLWPLATGRCFYSPQ  187
             PK +      +++      +TF +  +S  L   S      +  ++     TG C Y   
Sbjct  689   PKGVMIEHRAIVNLSLTWAKTFQVQNHSRLLQFGSFSFDLSVA-EITTAFVTGACLY---  744

Query  188   LGFPEDVVIMQQR--FTTSNRQNYVISSPALLK--------------------------R  219
             L   E ++  Q    F T+N+  +   SP+ L                           +
Sbjct  745   LANKETLLPSQSLVDFLTANKITHSFLSPSALSVLPKASLPDLQCLTAGGEACTTEIVNQ  804

Query  220   WNKDMVLQACEAVFSSG-----------------GKLESGIRPQLNDAITEILGSSETG-  261
             W  +     C     S                  GK  S +R  + DA  ++L     G 
Sbjct  805   WGTERRFYNCYGPTESTVTATIFLCQPNGKKPPIGKPISNLRIYILDAHHQVLPPGIPGE  864

Query  262   ------GIA--YRHQDHAAWQAFADVDIQIEQAHLQVKTAHAYTEQWIETGDLAQWQQLD  313
                   G+A  Y ++     + F ++D+                E+  +TGDLA+W    
Sbjct  865   LCIAGVGLARGYLNRPEITAEKFIEIDL------------FGQVERIYKTGDLARWGADG  912

Query  314   NTTLGFELLGRADRLIKLEEKRLSLDAIEQGIQSQPQVEQCHALVVEH--EQRQLLACIV  371
             N     E LGR D  +K+   R+ LD +E  +   P+V+    +V E    Q+QL+A +V
Sbjct  913   N----IEYLGRIDNQVKIRGFRIELDEVETALNRNPEVQTSCVIVREDIPGQKQLVAYVV  968

Query  372   VLNADARASLKQLGKRQFVSQLKHQLSHGLERIAIPRLWRFLTDIPHNSQSKRDKHYL  429
               +               +S+L+  L   L    +P  +  L  +P     K D+  L
Sbjct  969   PHHTVT------------MSELRQYLKEKLPEYMLPHAFVILESLPVTPNGKIDRRAL  1014


 Score = 37.7 bits (86),  Expect = 3e-05
 Identities = 35/131 (27%), Positives = 61/131 (47%), Gaps = 19/131 (15%)

Query  302   ETGDLAQWQQLDNTTLGFELLGRADRLIKLEEKRLSLDAIEQGIQSQPQVEQCHALVVEH  361
             +TGDLA++    N     E +GR D ++K+   R+++  +E  +   P V  C  ++V  
Sbjct  3498  KTGDLARYLPDGN----IEFIGRLDDVVKIRGFRVAIGEVESLLVQHPDV-ICQVVMVRE  3552

Query  362   EQ---RQLLACIVVLNADARASLKQLGKRQFVSQLKHQLSHGLERIAIPRLWRFLTDIPH  418
             +Q   +QL+A +V  N     SL Q       ++L+  L   L    +P  +  L  +P 
Sbjct  3553  DQPGNKQLVAYVVSDN----PSLTQ-------NELQSFLKQKLPSYMVPTAFVMLEGLPV  3601

Query  419   NSQSKRDKHYL  429
              +  K D+  L
Sbjct  3602  TTNGKVDRRAL  3612


 Score = 32.0 bits (71),  Expect = 0.002
 Identities = 15/39 (38%), Positives = 21/39 (54%), Gaps = 0/39 (0%)

Query  120   YTSGSTGQPKRIERNLAQLLSEVQGLDQTFGLAENSIAL  158
             YTSGSTG+PK +    A L+S    + + F L  +   L
Sbjct  3262  YTSGSTGRPKGVMLTHAALVSHCSAISEAFSLTSSDRVL  3300


 Score = 24.6 bits (52),  Expect = 0.34
 Identities = 11/17 (65%), Positives = 13/17 (76%), Gaps = 1/17 (6%)

Query  115   AHIDFYTSGSTGQPKRI  131
             AH+  YTSGSTG PK +
Sbjct  2199  AHV-IYTSGSTGTPKGV  2214


 Score = 24.3 bits (51),  Expect = 0.45
 Identities = 7/13 (54%), Positives = 12/13 (92%), Gaps = 0/13 (0%)

Query  98    PVQMIPIPEWNTE  110
             PVQ+IP+ +W++E
Sbjct  4018  PVQLIPVEQWHSE  4030


 Score = 22.7 bits (47),  Expect = 1.3
 Identities = 7/27 (26%), Positives = 15/27 (56%), Gaps = 0/27 (0%)

Query  106  EWNTETLNQAHIDFYTSGSTGQPKRIE  132
            EW T+ + +  ++++T    G P  +E
Sbjct  250  EWLTQEVQEKQLEYWTQQLAGAPPLLE  276


 Score = 20.0 bits (40),  Expect = 8.8
 Identities = 15/47 (32%), Positives = 23/47 (49%), Gaps = 6/47 (13%)

Query  322   LGRADRLIKLEEKRLS-----LDAIEQGIQSQPQVEQCHALVVEHEQ  363
             LG+A  L+  +   L      L A+   +Q  P VEQ H+ +  H+Q
Sbjct  3991  LGKAFHLVNPDSTPLKHLFKLLCALGYPVQLIP-VEQWHSEITHHQQ  4036


> A0A2D1VNN8 NdaB [Nostoc sp. CENA543]
Length=1284

 Score = 53.1 bits (126),  Expect = 5e-10
 Identities = 85/389 (22%), Positives = 150/389 (39%), Gaps = 73/389 (19%)

Query  85   QDIHFLSRQLSISPVQMIPIPEWNTETLNQAHIDFYTSGSTGQPKRIERNLAQLLSEVQG  144
            +D H ++     +PV++      N+E L  A++  YTSGSTG+PK +      + + +  
Sbjct  595  RDWHIIANHSQHNPVKLA-----NSENL--AYV-IYTSGSTGKPKGVMNIHKAICNNLLR  646

Query  145  LDQTFGLAENSIALATVSHQHIYGLLFKVLWPLATGRCFYSPQLGFPEDVVIMQQRFTTS  204
                + L      L  ++       ++++ W L +G      +    +D+  +       
Sbjct  647  TLDAYPLTIGDCILQ-ITPLSFDASVWEIFWSLTSGTTLVVAKPEGHKDIAYLMN-LIAE  704

Query  205  NRQNYVISSPALLKRWNKDMVLQACEA---VFSSGGKLESGIRPQL----NDAITEILGS  257
             +   V   P++L+ + +   L++C     VFS    L   +  +     N  +  + G 
Sbjct  705  QKITQVSFVPSMLRIFLQQPNLESCRCLKRVFSGAETLSYELTQRFFENFNCELHNLYGP  764

Query  258  SETG--GIAYRHQDHA------AWQAFADVDIQIEQAHLQ--------------VKTAHA  295
            +ET      ++ Q H+        +  A+    I   +LQ              V  A  
Sbjct  765  TETAVDATCWQCQPHSHSRIIPIGRPIANTQTYILDEYLQPVPIGVAGELYIGGVSLARG  824

Query  296  YTEQ-----------------WIETGDLAQWQQLDNTTLGFELLGRADRLIKLEEKRLSL  338
            Y  Q                   +TGDLA++    N     E LGR D  +KL   R+ L
Sbjct  825  YLNQPELTHEKFISHPFGEGKLYKTGDLARYLSDGN----IEYLGRIDHQVKLRGLRIEL  880

Query  339  DAIEQGIQSQPQVEQCHALVV--EHEQRQLLACIVVLNADARASLKQLGKRQFVSQLKHQ  396
              IE  + + PQVEQ    +     E ++L+A +V  N+  +            S+L+  
Sbjct  881  GEIESVLDTHPQVEQTVVFLQGDTSENQRLVAYVVGKNSLLKP-----------SELRLF  929

Query  397  LSHGLERIAIPRLWRFLTDIPHNSQSKRD  425
            L H L    IP  +  L+++P N   K D
Sbjct  930  LQHKLPAYMIPSAFVVLSELPLNPNGKID  958



Lambda      K        H        a         alpha
   0.323    0.135    0.413    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 8537152


  Database: 7d65447aeb1f049d8e0d9ba1d0aae9a8.TrEMBL.fasta
    Posted date:  Sep 18, 2020  3:50 PM
  Number of letters in database: 18,652
  Number of sequences in database:  24



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40