ACIAD0571 / SwissProt Alignments

BLASTP 2.2.28+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: 6703c487816a2c8b538c4ddb8baeb8bc.SwissProt.fasta
           16 sequences; 23,303 total letters



Query= ACIAD0571

Length=556
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  Q4L3Q0 Putative long chain fatty acid-CoA ligase VraA [Staphylo...  57.4    2e-11
  O54075 4-coumarate--CoA ligase [Rhodobacter sphaeroides (strain...  55.8    6e-11
  P42516 4-coumarate--CoA ligase [Halorhodospira halophila]           52.8    5e-10
  Q7A769 Putative long chain fatty acid-CoA ligase VraA [Staphylo...  51.2    2e-09
  Q6GBR2 Putative long chain fatty acid-CoA ligase VraA [Staphylo...  51.2    2e-09
  Q7A1Q0 Putative long chain fatty acid-CoA ligase VraA [Staphylo...  51.2    2e-09
  Q9KWK5 Putative long chain fatty acid-CoA ligase VraA [Staphylo...  51.2    2e-09
  Q99W34 Putative long chain fatty acid-CoA ligase VraA [Staphylo...  51.2    2e-09
  A2R6H0 Ochratoxin nonribosomal peptide synthetase ota2 [Aspergi...  51.2    3e-09
  P0C063 ATP-dependent proline adenylase / ATP-dependent valine a...  51.2    3e-09
  Q6GJ94 Putative long chain fatty acid-CoA ligase VraA [Staphylo...  50.4    3e-09
  P11454 Enterobactin synthase component F [Escherichia coli (str...  50.8    4e-09
  P0C064 ATP-dependent proline adenylase / ATP-dependent valine a...  50.1    7e-09
  P31119 2-acylglycerophosphoethanolamine acyltransferase / Acyl-...  49.7    7e-09
  P29698 Enterobactin synthase component F [Shigella flexneri]        49.3    1e-08
  Q01886 HC-toxin synthetase [Cochliobolus carbonum]                  49.3    1e-08


> Q4L3Q0 Putative long chain fatty acid-CoA ligase VraA [Staphylococcus 
haemolyticus (strain JCSC1435)]
Length=461

 Score = 57.4 bits (137),  Expect = 2e-11
 Identities = 85/347 (24%), Positives = 152/347 (44%), Gaps = 53/347 (15%)

Query  116  HIDFYTSGSTGQPKRIERN-LAQLLSEVQGLDQTFGLAENSIALATVSHQHIYGLLFKVL  174
            HI F TSG+TG PK   RN  + + S V+     +   +   A   ++H      L+  +
Sbjct  132  HIGF-TSGTTGLPKAYYRNEPSWIASYVENEKLIYNYEKALAAPGPLAHSL---SLYTCI  187

Query  175  WPLATGRCFYSP-QLGFPEDVVIMQQRFTTSNRQNYVISSPALLKR-WNKDMVLQACEAV  232
            + L +GR F    Q      + I+ ++   SN   +++  P +L +  N D  +   +++
Sbjct  188  YALYSGRTFIGQRQFDAKRFISILNEQH--SNIALFLV--PTMLHQLLNVDTTITHIKSI  243

Query  233  FSSGGKLESGIRPQL-----NDAITEILGSSETGGIAYRHQD----HAAWQAFADVDIQI  283
            F SG KL   +   +     N  I E  G+SE   I Y        ++  Q F +V I++
Sbjct  244  FCSGAKLSESLFKTVSQQFKNANIIEFFGTSEASFITYNFNQTSPTNSVGQVFPNVSIKL  303

Query  284  EQAH------LQVKTAHAYT----------EQWIETGDLAQWQQLDNTTLGFELLGRADR  327
            E         L+V++   Y+            WIETGD A    + N  L + +  ++DR
Sbjct  304  EAQDNRKIGLLKVQSNMIYSGYVDVGVVQPHSWIETGDYA---YIQNNQL-YLVSRKSDR  359

Query  328  LIKLEEKRLSLDAIEQGIQSQPQVEQCHALVVEHEQRQLLACIVVLNADARASLKQLGKR  387
            LI +  K +  + IEQ ++S   +E+  A+VV    R+     V++          +G +
Sbjct  360  LI-IGGKNIYPNVIEQQVKSLDGIEE--AVVVGEPHRRFGEIAVLI---------YVGNQ  407

Query  388  QF-VSQLKHQLSHGLERIAIPRLWRFLTDIPHNSQSKRDKHYLKSLF  433
            +   + L+  L   L R  IP     + D+P  +  K  ++ +++L+
Sbjct  408  ELDYTTLRRYLRQTLSRYEIPSKLVRVKDLPFTNSGKVARNTVQTLY  454


> O54075 4-coumarate--CoA ligase [Rhodobacter sphaeroides (strain 
ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158)]
Length=411

 Score = 55.8 bits (133),  Expect = 6e-11
 Identities = 77/321 (24%), Positives = 129/321 (40%), Gaps = 44/321 (14%)

Query  114  QAHIDFYTSGSTGQPKRIERNLAQLLSEVQGLDQ--TFGLAENSIALATVSHQHIYGLLF  171
            +A   F TSGST  PK +  + A LLSE Q + +  T    E    L+ V   HIYG L+
Sbjct  120  KARFTFATSGSTAGPKPVTHSAAALLSEGQAIAKILTERPPEVRRVLSCVPAHHIYGFLW  179

Query  172  KVLWPLATGRCFYSPQLGFPEDVVIMQQRFTTSNRQNYVISSPALLKRW-NKDMVLQACE  230
              L+P   G    + QL       IM+     +   + V+ +P + +++ + D  L    
Sbjct  180  SCLFPSRRG--LEAKQLANLSASGIMRH----ARSGDLVVGTPFIWEQFADLDYRLPGDV  233

Query  231  AVFSSGG-------KLESGIRPQLNDAITEILGSSETGGIAYRHQDHAAWQAFADVDIQI  283
               +SG        +  S + P     + +I GS+ETGGI +R +    ++   D+    
Sbjct  234  VGVTSGAPSTAETWRCASALGPA---RMLDIYGSTETGGIGWRERRDDPFRTLPDLACFH  290

Query  284  EQAHLQVKTAHAYTE-QWIETGDLAQWQQLDNTTLGFELLGRADRLIKLEEKRLSLDAIE  342
            +      +      E  W + G             GF +LGR D ++++    +S  A+ 
Sbjct  291  DTLSRLGRRLDLQDEIAWDKDG-------------GFTILGRKDEILQVAGSNVSPAAVR  337

Query  343  QGIQSQPQVEQCHALVVEHEQRQLLACIVVLNADARASLKQLGKRQFVSQLKHQLSHGLE  402
              +   P+V       V  + R+L A I V      A ++         +L+   +  L 
Sbjct  338  DILLRNPRVRDA---AVRLDGRRLKAVISVAEGADEAEIE--------IELRATAARHLP  386

Query  403  RIAIPRLWRFLTDIPHNSQSK  423
              A P  + F T++P     K
Sbjct  387  APARPDRFLFATELPRTGAGK  407


> P42516 4-coumarate--CoA ligase [Halorhodospira halophila]
Length=391

 Score = 52.8 bits (125),  Expect = 5e-10
 Identities = 80/319 (25%), Positives = 122/319 (38%), Gaps = 41/319 (13%)

Query  117  IDFYTSGSTGQPKRIERNLAQLLSEVQGLDQTFGLAENSIALATVSHQHIYGLLFKVLWP  176
            + F TSGSTG P+    + A L  E + L    G     IA   V   H+YG +F V  P
Sbjct  100  LTFSTSGSTGTPQPHHHSWAALTQEAEALANALGSHPRVIAWLPV--HHLYGFVFGVALP  157

Query  177  LATG----RCFYSPQLGF----PEDVVIMQQRFTTSNRQNYVISSPALLKRWNKDMVLQA  228
             A G        +P   F    P+D++      T   R  Y+  S              A
Sbjct  158  RALGSTVIESHAAPTALFREPAPDDLIA-----TVPARWRYLFDSNHRFPGGTGISSTAA  212

Query  229  CEAVFSSGGKLESGIRPQLNDAITEILGSSETGGIAYRHQDHAAWQAFADVDIQIEQAHL  288
             E      G L++G+     DA+ E+ G++E GGI  R      W    D  +       
Sbjct  213  LETA-CRNGLLQAGL-----DALLEVYGATEAGGIGLR------WAPSEDYRLLPHWHGD  260

Query  289  QVKTAHAYTEQW--IETGDLAQWQQLDNTTLGFELLGRADRLIKLEEKRLSLDAIEQGIQ  346
               T+ A       +    L + Q  D     F   GR D +I++    +S   + + ++
Sbjct  261  ATATSSALNPDGAAVTVAPLDRLQWRDERV--FRPTGRIDDIIQIGGVNVSPGHVARRLE  318

Query  347  SQPQVEQCHALV-VEHEQRQLLACIVVLNADA-RASLKQLGKRQFVSQLKHQLSHGLERI  404
            S   V  C      E  +R+L A IV   +DA   +L+Q         L++ +   L  +
Sbjct  319  SHEAVAACAVRSHGEGSRRRLKAFIVPARSDADPETLRQ--------TLENWIWEHLPAV  370

Query  405  AIPRLWRFLTDIPHNSQSK  423
              P   R  T++P N+  K
Sbjct  371  ERPTDLRIGTELPRNAMGK  389


> Q7A769 Putative long chain fatty acid-CoA ligase VraA [Staphylococcus 
aureus (strain N315)]
Length=458

 Score = 51.2 bits (121),  Expect = 2e-09
 Identities = 50/167 (30%), Positives = 80/167 (48%), Gaps = 15/167 (9%)

Query  113  NQAHIDFYTSGSTGQPKRIERNLAQLLSEVQGLDQTFGLAENSIAL-ATVSHQHIYGLLF  171
            N  HI F TSG+TG PK   R+    L+  +  +      EN+IA    +SH      L+
Sbjct  127  NLLHIGF-TSGTTGLPKAYYRDEDSWLASFEVNEMLMLKNENAIAAPGPLSHSL---TLY  182

Query  172  KVLWPLATGRCFYSPQLGFPEDVVIMQQRFTTSNRQNYVISS--PALLKRWNKDMVLQAC  229
             +L+ L++GR F       PE ++    + ++     +++ +   +LL  +N +  +Q  
Sbjct  183  ALLFALSSGRTFIGQTTFHPEKLLNQCHKISSYKVAMFLVPTMIKSLLLVYNNEHTIQ--  240

Query  230  EAVFSSGGKLESG----IRPQLNDA-ITEILGSSETGGIAYRHQDHA  271
             + FSSG KL S     I+ Q ND  + E  G+SET  I+Y     A
Sbjct  241  -SFFSSGDKLHSSIFKKIKNQANDINLIEFFGTSETSFISYNLNQQA  286


> Q6GBR2 Putative long chain fatty acid-CoA ligase VraA [Staphylococcus 
aureus (strain MSSA476)]
Length=458

 Score = 51.2 bits (121),  Expect = 2e-09
 Identities = 50/167 (30%), Positives = 80/167 (48%), Gaps = 15/167 (9%)

Query  113  NQAHIDFYTSGSTGQPKRIERNLAQLLSEVQGLDQTFGLAENSIAL-ATVSHQHIYGLLF  171
            N  HI F TSG+TG PK   R+    L+  +  +      EN+IA    +SH      L+
Sbjct  127  NLLHIGF-TSGTTGLPKAYYRDEDSWLASFEVNEMLMLKNENAIAAPGPLSHSL---TLY  182

Query  172  KVLWPLATGRCFYSPQLGFPEDVVIMQQRFTTSNRQNYVISS--PALLKRWNKDMVLQAC  229
             +L+ L++GR F       PE ++    + ++     +++ +   +LL  +N +  +Q  
Sbjct  183  ALLFALSSGRTFIGQTTFHPEKLLNQCHKISSYKVAMFLVPTMIKSLLLVYNNEHTIQ--  240

Query  230  EAVFSSGGKLESG----IRPQLNDA-ITEILGSSETGGIAYRHQDHA  271
             + FSSG KL S     I+ Q ND  + E  G+SET  I+Y     A
Sbjct  241  -SFFSSGDKLHSSIFKKIKNQANDINLIEFFGTSETSFISYNLNQQA  286


> Q7A1Q0 Putative long chain fatty acid-CoA ligase VraA [Staphylococcus 
aureus (strain MW2)]
Length=458

 Score = 51.2 bits (121),  Expect = 2e-09
 Identities = 50/167 (30%), Positives = 80/167 (48%), Gaps = 15/167 (9%)

Query  113  NQAHIDFYTSGSTGQPKRIERNLAQLLSEVQGLDQTFGLAENSIAL-ATVSHQHIYGLLF  171
            N  HI F TSG+TG PK   R+    L+  +  +      EN+IA    +SH      L+
Sbjct  127  NLLHIGF-TSGTTGLPKAYYRDEDSWLASFEVNEMLMLKNENAIAAPGPLSHSL---TLY  182

Query  172  KVLWPLATGRCFYSPQLGFPEDVVIMQQRFTTSNRQNYVISS--PALLKRWNKDMVLQAC  229
             +L+ L++GR F       PE ++    + ++     +++ +   +LL  +N +  +Q  
Sbjct  183  ALLFALSSGRTFIGQTTFHPEKLLNQCHKISSYKVAMFLVPTMIKSLLLVYNNEHTIQ--  240

Query  230  EAVFSSGGKLESG----IRPQLNDA-ITEILGSSETGGIAYRHQDHA  271
             + FSSG KL S     I+ Q ND  + E  G+SET  I+Y     A
Sbjct  241  -SFFSSGDKLHSSIFKKIKNQANDINLIEFFGTSETSFISYNLNQQA  286


> Q9KWK5 Putative long chain fatty acid-CoA ligase VraA [Staphylococcus 
aureus (strain Mu3 / ATCC 700698)]
Length=458

 Score = 51.2 bits (121),  Expect = 2e-09
 Identities = 50/167 (30%), Positives = 80/167 (48%), Gaps = 15/167 (9%)

Query  113  NQAHIDFYTSGSTGQPKRIERNLAQLLSEVQGLDQTFGLAENSIAL-ATVSHQHIYGLLF  171
            N  HI F TSG+TG PK   R+    L+  +  +      EN+IA    +SH      L+
Sbjct  127  NLLHIGF-TSGTTGLPKAYYRDEDSWLASFEVNEMLMLKNENAIAAPGPLSHSL---TLY  182

Query  172  KVLWPLATGRCFYSPQLGFPEDVVIMQQRFTTSNRQNYVISS--PALLKRWNKDMVLQAC  229
             +L+ L++GR F       PE ++    + ++     +++ +   +LL  +N +  +Q  
Sbjct  183  ALLFALSSGRTFIGQTTFHPEKLLNQCHKISSYKVAMFLVPTMIKSLLLVYNNEHTIQ--  240

Query  230  EAVFSSGGKLESG----IRPQLNDA-ITEILGSSETGGIAYRHQDHA  271
             + FSSG KL S     I+ Q ND  + E  G+SET  I+Y     A
Sbjct  241  -SFFSSGDKLHSSIFKKIKNQANDINLIEFFGTSETSFISYNLNQQA  286


> Q99W34 Putative long chain fatty acid-CoA ligase VraA [Staphylococcus 
aureus (strain Mu50 / ATCC 700699)]
Length=458

 Score = 51.2 bits (121),  Expect = 2e-09
 Identities = 50/167 (30%), Positives = 80/167 (48%), Gaps = 15/167 (9%)

Query  113  NQAHIDFYTSGSTGQPKRIERNLAQLLSEVQGLDQTFGLAENSIAL-ATVSHQHIYGLLF  171
            N  HI F TSG+TG PK   R+    L+  +  +      EN+IA    +SH      L+
Sbjct  127  NLLHIGF-TSGTTGLPKAYYRDEDSWLASFEVNEMLMLKNENAIAAPGPLSHSL---TLY  182

Query  172  KVLWPLATGRCFYSPQLGFPEDVVIMQQRFTTSNRQNYVISS--PALLKRWNKDMVLQAC  229
             +L+ L++GR F       PE ++    + ++     +++ +   +LL  +N +  +Q  
Sbjct  183  ALLFALSSGRTFIGQTTFHPEKLLNQCHKISSYKVAMFLVPTMIKSLLLVYNNEHTIQ--  240

Query  230  EAVFSSGGKLESG----IRPQLNDA-ITEILGSSETGGIAYRHQDHA  271
             + FSSG KL S     I+ Q ND  + E  G+SET  I+Y     A
Sbjct  241  -SFFSSGDKLHSSIFKKIKNQANDINLIEFFGTSETSFISYNLNQQA  286


> A2R6H0 Ochratoxin nonribosomal peptide synthetase ota2 [Aspergillus 
niger (strain CBS 513.88 / FGSC A1513)]
Length=1880

 Score = 51.2 bits (121),  Expect = 3e-09
 Identities = 43/139 (31%), Positives = 67/139 (48%), Gaps = 13/139 (9%)

Query  302   ETGDLAQWQ-QLDNTTLGFELLGRADRLIKLEEKRLSLDAIEQGIQSQPQVEQCHALVVE  360
             +TGDL Q+  +LD + L    +GR DR +KL  +RL L  +E    +   +     LVVE
Sbjct  1637  KTGDLVQYSPKLDGSLL---FIGRKDRQVKLRGQRLELSEVEY--HAYHTLAGTWELVVE  1691

Query  361   HEQRQLLACIVVLNADARASLKQLGK-------RQFVSQLKHQLSHGLERIAIPRLWRFL  413
                 Q    + +  A+ + S K  G        R  +S+L+  L+  L    +P +W  +
Sbjct  1692  LINSQHNPALALFLAEKQDSPKPCGVLSMTPAWRSVMSRLRDTLASRLPPYMVPTVWIPI  1751

Query  414   TDIPHNSQSKRDKHYLKSL  432
             T IP +S  K D+  L+SL
Sbjct  1752  TQIPLSSSQKTDRRSLQSL  1770


 Score = 23.1 bits (48),  Expect = 1.2
 Identities = 8/12 (67%), Positives = 11/12 (92%), Gaps = 0/12 (0%)

Query  120   YTSGSTGQPKRI  131
             +TSGSTG+PK +
Sbjct  1409  FTSGSTGRPKAV  1420


 Score = 21.6 bits (44),  Expect = 3.7
 Identities = 8/12 (67%), Positives = 10/12 (83%), Gaps = 0/12 (0%)

Query  120  YTSGSTGQPKRI  131
            +TSGSTG PK +
Sbjct  347  WTSGSTGAPKGV  358


 Score = 20.8 bits (42),  Expect = 6.3
 Identities = 16/45 (36%), Positives = 24/45 (53%), Gaps = 2/45 (4%)

Query  122   SGSTGQPKRIERNLAQLLSEVQGLDQTFGLAENSIALATVSHQHI  166
             S S    +R  ++LA  LS  Q   QT+ LA +S A   ++H H+
Sbjct  1757  SSSQKTDRRSLQSLAGDLSAEQY--QTYILASSSEATPGLTHSHL  1799


> P0C063 ATP-dependent proline adenylase / ATP-dependent valine 
adenylase / ATP-dependent ornithine adenylase / ATP-dependent 
leucine adenylase [Aneurinibacillus migulanus]
Length=4451

 Score = 51.2 bits (121),  Expect = 3e-09
 Identities = 75/357 (21%), Positives = 134/357 (38%), Gaps = 64/357 (18%)

Query  120   YTSGSTGQPKRIERNLAQLLSEVQGLDQTFGLAENSIALATVSHQHIYGLLFKVLWPLAT  179
             YTSG+TG+PK +      +++ +Q   + +       AL   S     G +  +  P+  
Sbjct  3736  YTSGTTGKPKGVMIEHQSIINCLQWRKEEYEFGPGDTALQVFSFA-FDGFVASLFAPILA  3794

Query  180   GRCFYSPQLGFPEDVVIMQQRFTTSNRQNYV----ISSPALLKRWNKDMVLQACEAVFSS  235
             G     P+    +D V +++   +    +Y     + S  L    +KD  LQ    V   
Sbjct  3795  GATSVLPKEEEAKDPVALKKLIASEEITHYYGVPSLFSAILDVSSSKD--LQNLRCVTLG  3852

Query  236   GGKLESGIRPQLNDAITEILGSSETGGIAYR-----------HQDHAAWQAFADVDIQIE  284
             G KL + I  ++ +   EI  ++E G                 Q+    +  ++VD+ I 
Sbjct  3853  GEKLPAQIVKKIKEKNKEIEVNNEYGPTENSVVTTIMRDIQVEQEITIGRPLSNVDVYIV  3912

Query  285   QAHLQVK-------------------------TAHAYT-------EQWIETGDLAQWQQL  312
               + Q++                         TA  +        E+  +TGDLA+W+  
Sbjct  3913  NCNHQLQPVGVVGELCIGGQGLARGYLNKPELTADKFVVNPFVPGERMYKTGDLAKWRS-  3971

Query  313   DNTTLGFELLGRADRLIKLEEKRLSLDAIEQGIQSQPQVEQCHALVVEHEQRQLLACIVV  372
             D      E +GR D  +K+   R+ L  IE  I    ++++   +V EH   + + C  +
Sbjct  3972  DGM---IEYVGRVDEQVKVRGYRIELGEIESAILEYEKIKEAVVMVSEHTASEQMLCAYI  4028

Query  373   LNADARASLKQLGKRQFVSQLKHQLSHGLERIAIPRLWRFLTDIPHNSQSKRDKHYL  429
             +  +   +L           L+  L+  L    IP  +  L  IP     K D+  L
Sbjct  4029  VGEEDVLTL----------DLRSYLAKLLPSYMIPNYFIQLDSIPLTPNGKVDRKAL  4075


 Score = 39.3 bits (90),  Expect = 1e-05
 Identities = 35/136 (26%), Positives = 56/136 (41%), Gaps = 16/136 (12%)

Query  298  EQWIETGDLAQWQQLDNTTLGFELLGRADRLIKLEEKRLSLDAIEQGIQSQPQVEQCHAL  357
            E+   TGDLA+W    N     E LGRAD  +K+   R+ L  IE  + +   V++   +
Sbjct  839  ERMYRTGDLARWLPDGN----IEFLGRADHQVKIRGHRIELGEIEAQLLNCKGVKEAVVI  894

Query  358  -VVEHEQRQLLACIVVLNADARASLKQLGKRQFVSQLKHQLSHGLERIAIPRLWRFLTDI  416
               + +  + L   VV+  +              S+L+  L   L    IP  +  L  +
Sbjct  895  DKADDKGGKYLCAYVVMEVEVND-----------SELREYLGKALPDYMIPSFFVPLDQL  943

Query  417  PHNSQSKRDKHYLKSL  432
            P     K D+  L +L
Sbjct  944  PLTPNGKIDRKSLPNL  959


 Score = 38.1 bits (87),  Expect = 3e-05
 Identities = 35/134 (26%), Positives = 59/134 (44%), Gaps = 19/134 (14%)

Query  298   EQWIETGDLAQWQQLDNTTLGFELLGRADRLIKLEEKRLSLDAIEQGIQSQPQVEQCHAL  357
             E+   TGDLA+W    N     E LGR D  +K+   R+ L  IE  ++    +++   +
Sbjct  2921  EKLYRTGDLARWMPDGNV----EFLGRNDHQVKIRGIRIELGEIEAQLRKHDSIKEATVI  2976

Query  358   VVE-HEQRQLLACIVVLNADARASLKQLGKRQFVSQLKHQLSHGLERIA-IPRLWRFLTD  415
               E H + + L   +V   +             V++L+  L++  +R A IP  +  L  
Sbjct  2977  AREDHMKEKYLCAYMVTEGEVN-----------VAELRAYLAN--DRAAMIPSYFVSLEA  3023

Query  416   IPHNSQSKRDKHYL  429
             +P  +  K DK  L
Sbjct  3024  MPLTANGKIDKRSL  3037


 Score = 36.6 bits (83),  Expect = 9e-05
 Identities = 24/72 (33%), Positives = 37/72 (51%), Gaps = 4/72 (6%)

Query  298   EQWIETGDLAQWQQLDNTTLGFELLGRADRLIKLEEKRLSLDAIEQGIQSQPQVEQCHAL  357
             E+   TGDLA+W  L + T+  E LGR D+ +K+   R+    IE  +    +V++   +
Sbjct  1874  ERMYRTGDLARW--LPDGTI--EYLGRIDQQVKIRGYRIEPGEIETLLVKHKKVKESVIM  1929

Query  358   VVEHEQRQLLAC  369
             VVE    Q   C
Sbjct  1930  VVEDNNGQKALC  1941


 Score = 25.4 bits (54),  Expect = 0.25
 Identities = 12/23 (52%), Positives = 17/23 (74%), Gaps = 3/23 (13%)

Query  120   YTSGSTGQPKRI---ERNLAQLL  139
             YTSGSTG+PK +    RN+ +L+
Sbjct  1653  YTSGSTGKPKGVMVEHRNVIRLV  1675


 Score = 24.6 bits (52),  Expect = 0.42
 Identities = 11/23 (48%), Positives = 16/23 (70%), Gaps = 3/23 (13%)

Query  120  YTSGSTGQPKRI---ERNLAQLL  139
            YTSG+TG+PK +    +N+  LL
Sbjct  613  YTSGTTGKPKGVMLEHKNIVNLL  635


 Score = 23.5 bits (49),  Expect = 0.96
 Identities = 17/57 (30%), Positives = 25/57 (44%), Gaps = 3/57 (5%)

Query  78    LEQDFRRQDIHFLSRQLSISPVQMIPIPEWNTETLNQAHID---FYTSGSTGQPKRI  131
             L Q    Q I F    L +   + +     N E + + H      YTSG+TG+PK +
Sbjct  2644  LTQQKLTQQIAFSGDILYLDQEEWLHEEASNLEPIARPHYIAYIIYTSGTTGKPKGV  2700


 Score = 23.5 bits (49),  Expect = 0.96
 Identities = 15/53 (28%), Positives = 23/53 (43%), Gaps = 4/53 (8%)

Query  309   WQQLDNTTLGFELLGRADRLIKLEEKRLSLDAIEQGIQSQPQVEQCHALVVEH  361
             WQ++    LG EL+G  D   +L    L    +   I    Q+E    +V +H
Sbjct  4103  WQEV----LGIELIGITDNFFELGGHSLKATLLVAKIYEYMQIEMPLNVVFKH  4151


> Q6GJ94 Putative long chain fatty acid-CoA ligase VraA [Staphylococcus 
aureus (strain MRSA252)]
Length=458

 Score = 50.4 bits (119),  Expect = 3e-09
 Identities = 50/167 (30%), Positives = 81/167 (49%), Gaps = 15/167 (9%)

Query  113  NQAHIDFYTSGSTGQPKRIERNLAQLLSEVQGLDQTFGLAENSIAL-ATVSHQHIYGLLF  171
            N  HI F TSG+TG PK   R+    L+  +  +      EN+IA    +SH      L+
Sbjct  127  NLLHIGF-TSGTTGLPKAYYRDEDSWLASFEVNEMLMLKNENAIAAPGPLSHSL---TLY  182

Query  172  KVLWPLATGRCFYSPQLGFPEDVVIMQQRFTTSNRQNYVISS--PALLKRWNKDMVLQAC  229
             +L+ L++GR F       PE ++   ++ ++     +++ +   +LL  +N +  +Q  
Sbjct  183  ALLFALSSGRTFIGQTTFHPERLLNQCRKISSYKVAMFLVPTMIKSLLLVYNNEHTIQ--  240

Query  230  EAVFSSGGKLESG----IRPQLNDA-ITEILGSSETGGIAYRHQDHA  271
             + FSSG KL S     I+ Q ND  + E  G+SET  I+Y     A
Sbjct  241  -SFFSSGDKLYSSIFKKIKNQANDINLIEFFGTSETSFISYNLNQQA  286


> P11454 Enterobactin synthase component F [Escherichia coli (strain 
K12)]
Length=1293

 Score = 50.8 bits (120),  Expect = 4e-09
 Identities = 90/386 (23%), Positives = 148/386 (38%), Gaps = 86/386 (22%)

Query  112  LNQAHIDFY---TSGSTGQPKRIERNLAQLLSEVQGLDQTFGLA-ENSIALATVSHQHIY  167
            L+Q H   Y   TSGSTG+PK +      +++ +  +   + L  E+ +A  T     + 
Sbjct  591  LSQPHHTAYIIFTSGSTGRPKGVMVGQTAIVNRLLWMQNHYPLTGEDVVAQKTPCSFDVS  650

Query  168  GLLFKVLWPLATGRCFYSPQLGFPEDVVIMQQRF-----TTSNRQNYVISSPALLKRWNK  222
              +++  WP   G      +     D + MQQ F     TT++    +++  A +     
Sbjct  651  --VWEFFWPFIAGAKLVMAEPEAHRDPLAMQQFFAEYGVTTTHFVPSMLA--AFVASLTP  706

Query  223  DMVLQAC---EAVFSSGGKLESGI---------------------------RPQLNDAIT  252
                Q+C   + VF SG  L + +                            P   + + 
Sbjct  707  QTARQSCATLKQVFCSGEALPADLCREWQQLTGAPLHNLYGPTEAAVDVSWYPAFGEELA  766

Query  253  EILGSS--------ETGGIAYRHQDHAAWQAFAD----VDIQIEQAHLQ---------VK  291
            ++ GSS         TG        H      A       IQ+ Q +L          + 
Sbjct  767  QVRGSSVPIGYPVWNTGLRILDAMMHPVPPGVAGDLYLTGIQLAQGYLGRPDLTASRFIA  826

Query  292  TAHAYTEQWIETGDLAQWQQLDNTTLGFELLGRADRLIKLEEKRLSLDAIEQGIQSQPQV  351
               A  E+   TGD+A+W  LDN  +  E LGR+D  +K+  +R+ L  I++ +Q+ P V
Sbjct  827  DPFAPGERMYRTGDVARW--LDNGAV--EYLGRSDDQLKIRGQRIELGEIDRVMQALPDV  882

Query  352  EQC--HALVVEH------EQRQLLACIVVLNADARASLKQLGKRQFVSQLKHQLSHGLER  403
            EQ   HA V+        + RQL+  +V           Q G     S L+ QL   L  
Sbjct  883  EQAVTHACVINQAAATGGDARQLVGYLV----------SQSGLPLDTSALQAQLRETLPP  932

Query  404  IAIPRLWRFLTDIPHNSQSKRDKHYL  429
              +P +   L  +P ++  K D+  L
Sbjct  933  HMVPVVLLQLPQLPLSANGKLDRKAL  958


> P0C064 ATP-dependent proline adenylase / ATP-dependent valine 
adenylase / ATP-dependent ornithine adenylase / ATP-dependent 
leucine adenylase [Brevibacillus brevis]
Length=4450

 Score = 50.1 bits (118),  Expect = 7e-09
 Identities = 76/357 (21%), Positives = 134/357 (38%), Gaps = 64/357 (18%)

Query  120   YTSGSTGQPKRIERNLAQLLSEVQGLDQTFGLAENSIALATVSHQHIYGLLFKVLWPLAT  179
             YTSG+TG+PK +      +++ +Q   + +       AL   S     G +  +  P+  
Sbjct  3735  YTSGTTGKPKGVMIEHQSIINCLQWRKEEYEFGPGDTALQVFSFA-FDGFVASLFAPILA  3793

Query  180   GRCFYSPQLGFPEDVVIMQQRFTTSNRQNYV----ISSPALLKRWNKDMVLQACEAVFSS  235
             G     P+    +D V +++   +    +Y     + S  L    +KD  LQ    V   
Sbjct  3794  GATSVLPKEEEAKDPVALKKLIASEEITHYYGVPSLFSAILDVSSSKD--LQNLRCVTLG  3851

Query  236   GGKLESGIRPQLNDAITEI-----LGSSETGGIAYRHQDHAAWQAF------ADVDIQIE  284
             G KL + I  ++ +   EI      G +E   +    +D    Q        ++VD+ I 
Sbjct  3852  GEKLPAQIVKKIKEKNKEIEVNNEYGPTENSVVTTIMRDIQVEQEITIGCPLSNVDVYIV  3911

Query  285   QAHLQVK-------------------------TAHAYT-------EQWIETGDLAQWQQL  312
               + Q++                         TA  +        E+  +TGDLA+W+  
Sbjct  3912  NCNHQLQPVGVVGELCIGGQGLARGYLNKPELTADKFVVNPFVPGERMYKTGDLAKWRS-  3970

Query  313   DNTTLGFELLGRADRLIKLEEKRLSLDAIEQGIQSQPQVEQCHALVVEHEQRQLLACIVV  372
             D      E +GR D  +K+   R+ L  IE  I    ++++   +V EH   + + C  +
Sbjct  3971  DGM---IEYVGRVDEQVKVRGYRIELGEIESAILEYEKIKEAVVIVSEHTASEQMLCAYI  4027

Query  373   LNADARASLKQLGKRQFVSQLKHQLSHGLERIAIPRLWRFLTDIPHNSQSKRDKHYL  429
             +  +   +L           L+  L+  L    IP  +  L  IP     K D+  L
Sbjct  4028  VGEEDVLTL----------DLRSYLAKLLPSYMIPNYFIQLDSIPLTPNGKVDRKAL  4074


 Score = 42.4 bits (98),  Expect = 2e-06
 Identities = 34/133 (26%), Positives = 56/133 (42%), Gaps = 16/133 (12%)

Query  298   EQWIETGDLAQWQQLDNTTLGFELLGRADRLIKLEEKRLSLDAIEQGIQSQPQVEQCHAL  357
             E+   TGDLA+W    N     E LGR D  +K+   R+ L  IE  ++    +++   +
Sbjct  2919  EKLYRTGDLARWMPDGNV----EFLGRNDHQVKIRGIRIELGEIEAQLRKHDSIKEATVI  2974

Query  358   VVE-HEQRQLLACIVVLNADARASLKQLGKRQFVSQLKHQLSHGLERIAIPRLWRFLTDI  416
               E H + + L   +V   +             V++L+  L+  L    IP  +  L  +
Sbjct  2975  AREDHMKEKYLCAYMVTEGEVN-----------VAELRAYLATDLPAAMIPSYFVSLEAM  3023

Query  417   PHNSQSKRDKHYL  429
             P  +  K DK  L
Sbjct  3024  PLTANGKIDKRSL  3036


 Score = 39.3 bits (90),  Expect = 1e-05
 Identities = 35/136 (26%), Positives = 56/136 (41%), Gaps = 16/136 (12%)

Query  298  EQWIETGDLAQWQQLDNTTLGFELLGRADRLIKLEEKRLSLDAIEQGIQSQPQVEQCHAL  357
            E+   TGDLA+W    N     E LGRAD  +K+   R+ L  IE  + +   V++   +
Sbjct  839  ERMYRTGDLARWLPDGN----IEFLGRADHQVKIRGHRIELGEIEAQLLNCKGVKEAVVI  894

Query  358  -VVEHEQRQLLACIVVLNADARASLKQLGKRQFVSQLKHQLSHGLERIAIPRLWRFLTDI  416
               + +  + L   VV+  +              S+L+  L   L    IP  +  L  +
Sbjct  895  DKADDKGGKYLCAYVVMEVEVND-----------SELREYLGKALPDYMIPSFFVPLDQL  943

Query  417  PHNSQSKRDKHYLKSL  432
            P     K D+  L +L
Sbjct  944  PLTPNGKIDRKSLPNL  959


 Score = 36.6 bits (83),  Expect = 9e-05
 Identities = 24/72 (33%), Positives = 37/72 (51%), Gaps = 4/72 (6%)

Query  298   EQWIETGDLAQWQQLDNTTLGFELLGRADRLIKLEEKRLSLDAIEQGIQSQPQVEQCHAL  357
             E+   TGDLA+W  L + T+  E LGR D+ +K+   R+    IE  +    +V++   +
Sbjct  1874  ERMYRTGDLARW--LPDGTI--EYLGRIDQQVKIRGYRIEPGEIETLLVKHKKVKESVIM  1929

Query  358   VVEHEQRQLLAC  369
             VVE    Q   C
Sbjct  1930  VVEDNNGQKALC  1941


 Score = 25.4 bits (54),  Expect = 0.25
 Identities = 12/23 (52%), Positives = 17/23 (74%), Gaps = 3/23 (13%)

Query  120   YTSGSTGQPKRI---ERNLAQLL  139
             YTSGSTG+PK +    RN+ +L+
Sbjct  1653  YTSGSTGKPKGVMVEHRNVIRLV  1675


 Score = 24.6 bits (52),  Expect = 0.42
 Identities = 11/23 (48%), Positives = 16/23 (70%), Gaps = 3/23 (13%)

Query  120  YTSGSTGQPKRI---ERNLAQLL  139
            YTSG+TG+PK +    +N+  LL
Sbjct  613  YTSGTTGKPKGVMLEHKNIVNLL  635


 Score = 23.5 bits (49),  Expect = 0.96
 Identities = 15/53 (28%), Positives = 23/53 (43%), Gaps = 4/53 (8%)

Query  309   WQQLDNTTLGFELLGRADRLIKLEEKRLSLDAIEQGIQSQPQVEQCHALVVEH  361
             WQ++    LG EL+G  D   +L    L    +   I    Q+E    +V +H
Sbjct  4102  WQEV----LGIELIGITDNFFELGGHSLKATLLVAKIYEYMQIEMPLNVVFKH  4150


 Score = 23.1 bits (48),  Expect = 1.3
 Identities = 8/12 (67%), Positives = 11/12 (92%), Gaps = 0/12 (0%)

Query  120   YTSGSTGQPKRI  131
             YTSG+TG+PK +
Sbjct  2689  YTSGTTGKPKGV  2700


> P31119 2-acylglycerophosphoethanolamine acyltransferase / Acyl-[acyl-carrier-protein] 
synthetase [Escherichia coli (strain 
K12)]
Length=719

 Score = 49.7 bits (117),  Expect = 7e-09
 Identities = 76/363 (21%), Positives = 139/363 (38%), Gaps = 76/363 (21%)

Query  120  YTSGSTGQPKRIERNLAQLLSEVQGLDQTFGLAENSIALATVSHQHIYGLLFKVLWPLAT  179
            +TSGS G PK +  +   +L+ V+ +        N   ++ +   H +GL   +  PL T
Sbjct  372  FTSGSEGHPKGVVHSHKSILANVEQIKTIADFTTNDRFMSALPLFHSFGLTVGLFTPLLT  431

Query  180  GRCFYS----------PQLGFPEDVVIMQQRFTTSN---------------RQNYVISSP  214
            G   +           P+L +     ++   F TS                R  YV++  
Sbjct  432  GAEVFLYPSPLHYRIVPELVYDRSCTVL---FGTSTFLGHYARFANPYDFYRLRYVVAGA  488

Query  215  ALLKRWNKDM--------VLQA-----CEAVFSSGGKLESG------IRPQLNDAITEIL  255
              L+   K +        +L+      C  V S    + +       I P ++  +  + 
Sbjct  489  EKLQESTKQLWQDKFGLRILEGYGVTECAPVVSINVPMAAKPGTVGRILPGMDARLLSVP  548

Query  256  GSSETGGIAYRHQDHAAWQAFADVDIQIEQAH-LQVKTAHAYTEQ----WIETGDLAQWQ  310
            G  E G +  +  +        +  +++E+   L+V TA     +    W +TGD+ ++ 
Sbjct  549  GIEEGGRLQLKGPN------IMNGYLRVEKPGVLEVPTAENVRGEMERGWYDTGDIVRFD  602

Query  311  QLDNTTLGF-ELLGRADRLIKLEEKRLSLDAIEQ-GIQSQPQVEQCHALVVEHEQRQLLA  368
            +      GF ++ GRA R  K+  + +SL+ +EQ  +   P      A+  +  + + L 
Sbjct  603  EQ-----GFVQIQGRAKRFAKIAGEMVSLEMVEQLALGVSPDKVHATAIKSDASKGEALV  657

Query  369  CIVVLNADARASLKQLGKRQFVSQLKHQLSHGLERIAIPRLWRFLTDIPHNSQSKRDKHY  428
                 N   R  L+Q  +            HG+  +A+PR  R+L  +P     K D   
Sbjct  658  LFTTDNELTRDKLQQYARE-----------HGVPELAVPRDIRYLKQMPLLGSGKPDFVT  706

Query  429  LKS  431
            LKS
Sbjct  707  LKS  709


> P29698 Enterobactin synthase component F [Shigella flexneri]
Length=1281

 Score = 49.3 bits (116),  Expect = 1e-08
 Identities = 89/386 (23%), Positives = 148/386 (38%), Gaps = 86/386 (22%)

Query  112  LNQAHIDFY---TSGSTGQPKRIERNLAQLLSEVQGLDQTFGLA-ENSIALATVSHQHIY  167
            L+Q H   Y   TSGSTG+PK +      +++ +  +   + L  E+ +A  T     + 
Sbjct  595  LSQPHHTAYIIFTSGSTGRPKGVMVGQTAIVNRLLWMQNHYPLTGEDVVAQKTPCSFDVS  654

Query  168  GLLFKVLWPLATGRCFYSPQLGFPEDVVIMQQRF-----TTSNRQNYVISSPALLKRWNK  222
              +++  WP   G      +     D + MQQ F     TT++    +++  A +     
Sbjct  655  --VWEFFWPFIAGAKLVMAEPEAHRDPLAMQQFFAEYGVTTTHFVPSMLA--AFVASLTP  710

Query  223  DMVLQAC---EAVFSSGGKLESGI---------------------------RPQLNDAIT  252
                Q+C   + VF SG  L + +                            P   + + 
Sbjct  711  QTARQSCVTLKQVFCSGEALPADLCREWQQLTGAPLHNLYGPTEAAVDVSWYPAFGEELA  770

Query  253  EILGSS--------ETGGIAYRHQDHAAWQAFAD----VDIQIEQAHLQ---------VK  291
            ++ GSS         TG        H      A       IQ+ Q +L          + 
Sbjct  771  QVRGSSVPIGYPVWNTGLRILDAMMHPVPPGVAGDLYLTGIQLAQGYLGRPDLTASRFIA  830

Query  292  TAHAYTEQWIETGDLAQWQQLDNTTLGFELLGRADRLIKLEEKRLSLDAIEQGIQSQPQV  351
               A  E+   TGD+A+W  LDN  +  E LGR+D  +K+  +R+ L  I++ +Q+ P V
Sbjct  831  DPFAPGERMYRTGDVARW--LDNGAV--EYLGRSDDQLKIRGQRIELGEIDRVMQALPDV  886

Query  352  EQC--HALVVEH------EQRQLLACIVVLNADARASLKQLGKRQFVSQLKHQLSHGLER  403
            +Q   HA V+        + RQL+  +V           Q G     S L+ QL   L  
Sbjct  887  KQAVTHACVINQAAATGGDARQLVGYLV----------SQSGLPLDTSALQAQLRETLPP  936

Query  404  IAIPRLWRFLTDIPHNSQSKRDKHYL  429
              +P +   L  +P ++  K D+  L
Sbjct  937  HMVPVVLLQLPQLPLSANGKLDRKAL  962


> Q01886 HC-toxin synthetase [Cochliobolus carbonum]
Length=5218

 Score = 49.3 bits (116),  Expect = 1e-08
 Identities = 94/395 (24%), Positives = 147/395 (37%), Gaps = 77/395 (19%)

Query  120  YTSGSTGQPKRIERNLAQLLSEVQGLDQTFGLAENSIALATVSHQHIYGLLFKVLWPLAT  179
            +TSGSTG PK I    +Q+ + VQ     FG+   +  L   S+       F +      
Sbjct  367  FTSGSTGVPKCIVVTHSQICTAVQAYKDRFGVTSETRVLQFSSYT------FDISIADTF  420

Query  180  GRCFYSPQLGFP--EDVVIMQQRFTTSNRQNYVISSPALLKRWNKDMVLQACEAVFSSGG  237
               FY   L  P  ED +   Q +  S R N+ + +P + +  +  +V      +  +G 
Sbjct  421  TALFYGGTLCIPSEEDRMSNLQDYMVSVRPNWAVLTPTVSRFLDPGVVKDFISTLIFTGE  480

Query  238  K---------LESGIR------PQLNDAITEIL----GSSETGGIAYRHQDHAAWQAFAD  278
                      +E+G+       P  N  IT       G S   G     +      + A 
Sbjct  481  ASREADTVPWIEAGVNLYNVYGPAENTLITTATRIRKGKSSNIGYGVNTRTWVTDVSGAC  540

Query  279  V-------DIQIEQAHLQVK-------TAHAYTEQ--WI---------------ETGDLA  307
            +       ++ IE  HL  K       T  A+     WI                TGDL 
Sbjct  541  LVPVGSIGELLIESGHLADKYLNRPDRTEAAFLSDLPWIPNYEGDSVRRGRRFYRTGDLV  600

Query  308  QWQQLDNTTLGFELLGRADRLIKLEEKRLSLDAIEQGIQSQPQVEQCHALVVEHE---QR  364
            ++   D+ +L    +GR+D  IKL  +R+ L  +E  +QS P   Q  A+V       + 
Sbjct  601  RY--CDDGSL--ICVGRSDTQIKLAGQRVELGDVEAHLQSDPTTSQA-AVVFPRSGPLEA  655

Query  365  QLLACIVVLNADARASLKQ-LGKRQF-------VSQLKHQLSHGLERIAIPRLWRFLTDI  416
            +L+A +V  N D     +Q L K  F       V      L   L    +P +W  +  +
Sbjct  656  RLIALLVTGNKDGTPHNQQSLPKPAFAQCPPDLVKYATSSLQQRLPSYMVPSVWLGIDFL  715

Query  417  PHNSQSKRDKHYLKSLFQ---PMLYPVVLQRTALE  448
            P +   K D+  L+   +   P  Y  +L  T LE
Sbjct  716  PMSVSGKLDRAVLQDQLESLSPSDYAEILGTTGLE  750


 Score = 34.3 bits (77),  Expect = 5e-04
 Identities = 79/386 (20%), Positives = 137/386 (35%), Gaps = 69/386 (18%)

Query  113   NQAHIDFYTSGSTGQPKRIERNLAQLLSEVQGLDQTFGLAENSIALATVSHQHIYGLLFK  172
             NQA    +TSGSTG+PK +      + S +  L +  GL   S  L   S+     +L  
Sbjct  4274  NQAAYILFTSGSTGKPKGVVMEHHSVCSALIALGKRMGLGPQSRVLQFNSYWFDV-MLLD  4332

Query  173   VLWPLATGRCFYSPQ-------------------LGFPEDVVIMQQRFTTSNRQNYVISS  213
             +   L  G C   P+                   +     V  + Q   T + +   ++ 
Sbjct  4333  IFGTLVYGGCLCIPKEEQRMSNLSGWVQKFKVNTMLLSTSVSRLMQPADTPSLETLCLTG  4392

Query  214   PALLK----RWNKDMVLQAC-----EAVFSSGGKL------------------------E  240
              A+L+    RW   + L A        + S  G+L                        E
Sbjct  4393  EAVLQSDVDRWAPKLHLIAGYGPTETCIMSVSGELTPSSPANLIGKPVSCQAWVINPLKE  4452

Query  241   SGIRPQLNDAITEILGSSETGGIAYRHQDHAAWQAFADVDIQIEQAHLQVKTAHAYTEQW  300
             + + P    A  E+     T    Y H D    +AF  VD Q    +      + ++ + 
Sbjct  4453  TELAPY--GATGELYIQGPTVARGYLHDDVLTSKAFI-VDPQWLTGY--KTNENQWSRRA  4507

Query  301   IETGDLAQWQQLDNTTLGFELLGRADRLIKLEEKRLSLDAIEQGIQSQ--PQVEQCHALV  358
              +TGDL  W    N    + +  +    +K+  +R+ L  IE+ I+    P V  C  L+
Sbjct  4508  YKTGDLVFWGPQSNL---YYVRRKDSSQVKIRGQRVELAEIEEVIRQHIPPDVTVCVDLL  4564

Query  359   VEHEQ--RQLLACIVVLNADARASLKQLGKRQFVSQLKHQLSHGLE----RIAIPRLWRF  412
                +Q  R +L  ++ +   A    + L    ++  LK  +   LE       IP  +  
Sbjct  4565  SSDDQNTRIILGAVLGIGDRALGGPEDLEVIGYMDDLKSHIIPALEASLPHHMIPEAYVP  4624

Query  413   LTDIPHNSQSKRDKHYLKSLFQPMLY  438
                +P     K D+  ++ +  P+ +
Sbjct  4625  FVQLPTLGSGKLDRKTVRRVAGPLAF  4650


 Score = 28.1 bits (61),  Expect = 0.037
 Identities = 37/167 (22%), Positives = 67/167 (40%), Gaps = 33/167 (20%)

Query  303   TGDLAQWQQLDNTTLGFELLGRADRLIKLEEKRLSLDAIEQGIQS---------------  347
             TGDL ++    + TL F  LGR D  IKL  +R+ L  IE  I+                
Sbjct  3361  TGDLVRYAS--DGTLDF--LGRKDGQIKLRGQRIELGEIEHHIRRLMSDDPRFHEASVQL  3416

Query  348   -QPQVEQCHALVVEHEQRQ-LLACIVVLN------------ADARASLKQLGKRQFVSQL  393
               P  +      V+ + R+  LA ++VL+                ++      +  V++L
Sbjct  3417  YNPATDPDRDATVDVQMREPYLAGLLVLDLVFTDEVMGIPCTSLTSANTSENLQTLVTEL  3476

Query  394   KHQLSHGLERIAIPRLWRFLTDIPHNSQSKRDKHYLKSLFQPMLYPV  440
             K  L   L    +P  +  ++ +P  S  K D  ++++  + +  P+
Sbjct  3477  KKSLRGVLPHYMVPLHFVAVSRLPTGSSGKLDHAFVRACLRELTAPL  3523


 Score = 26.9 bits (58),  Expect = 0.084
 Identities = 32/124 (26%), Positives = 57/124 (46%), Gaps = 18/124 (15%)

Query  108   NTETLNQAHIDFYTSGSTGQPKRI--ERNLAQL----LSEVQGLDQTFGLAENSIALATV  161
             +T+  + A++  YTSG++G+PK +  E     L     +E  G +    + + S  +  +
Sbjct  3122  DTDPSSPAYL-LYTSGTSGKPKGVVMEHRAWSLGFTCHAEYMGFNSCTRILQFSSLMFDL  3180

Query  162   SHQHIYGLLFKVLWPLATGRCFYSPQLGFPEDVVIMQQRFTTSNRQNYVISSPALLKRWN  221
             S   I+ +L+        G C + P     ++ V   Q FT  N  N V  +P++ K  N
Sbjct  3181  SILEIWAVLY-------AGGCLFIPS---DKERVNNLQDFTRINDINTVFLTPSIGKLLN  3230

Query  222   -KDM  224
              KD+
Sbjct  3231  PKDL  3234


 Score = 22.7 bits (47),  Expect = 1.7
 Identities = 17/61 (28%), Positives = 30/61 (49%), Gaps = 4/61 (7%)

Query  73    NRVAQLEQDFRRQDIHFLSRQLSISPVQMIPIP-EWNTETLNQAHIDFY---TSGSTGQP  128
             +R+  L+    +    F   +L    ++ +P+P + N + +   + D Y   TSGSTG P
Sbjct  1929  SRMGALQNISTQMGTEFKIVELEPEFIRSLPLPPKPNHQPMVGLNDDLYVVFTSGSTGVP  1988

Query  129   K  129
             K
Sbjct  1989  K  1989


 Score = 22.3 bits (46),  Expect = 2.2
 Identities = 10/21 (48%), Positives = 11/21 (52%), Gaps = 0/21 (0%)

Query  92   RQLSISPVQMIPIPEWNTETL  112
            R LSISP  +  I  WN   L
Sbjct  190  RNLSISPRDLAQIMRWNDRKL  210



Lambda      K        H        a         alpha
   0.323    0.135    0.413    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 11021634


  Database: 6703c487816a2c8b538c4ddb8baeb8bc.SwissProt.fasta
    Posted date:  Sep 24, 2020  3:38 AM
  Number of letters in database: 23,303
  Number of sequences in database:  16



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40