ACIAD0566 / TrEMBL Alignments

BLASTP 2.2.28+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: 3080b4af9bf19028b112cf6df41c233e.TrEMBL.fasta
           11 sequences; 2,164 total letters



Query= ACIAD0566

Length=206
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  Q6FEL8 Ketoacyl_synth_N domain-containing protein [Acinetobacte...   405    2e-148
  N9QW91 Ketoacyl_synth_N domain-containing protein [Acinetobacte...   270    1e-95 
  A0A009YF14 Beta-ketoacyl synthase, N-terminal domain protein [A...   270    1e-95 
  N9DHL9 Ketoacyl_synth_N domain-containing protein [Acinetobacte...   268    8e-95 
  A0A1P8EMD0 Beta-ketoacyl synthase [Acinetobacter soli]               251    9e-88 
  N9AIG4 Ketoacyl_synth_N domain-containing protein [Acinetobacte...   251    1e-87 
  A0A0M1I6M5 Beta-ketoacyl synthase [Acinetobacter sp. C15]            251    1e-87 
  N9THS8 Ketoacyl_synth_N domain-containing protein [Acinetobacte...   242    4e-84 
  R9BB61 Ketoacyl_synth_N domain-containing protein [Acinetobacte...   241    7e-84 
  N8PFQ8 Ketoacyl_synth_N domain-containing protein [Acinetobacte...   239    3e-83 
  A0A2N0WIQ0 Beta-ketoacyl synthase [Acinetobacter proteolyticus]      239    3e-83 


> Q6FEL8 Ketoacyl_synth_N domain-containing protein [Acinetobacter 
baylyi (strain ATCC 33305 / BD413 / ADP1)]
Length=205

 Score =  405 bits (1041),  Expect = 2e-148
 Identities = 205/205 (100%), Positives = 205/205 (100%), Gaps = 0/205 (0%)

Query  1    MLQLHLSNLRVYDAQQGLPVLEHIPAIQRRRLSALAKLALSAASEAKQQQSVDYIVWASR  60
            MLQLHLSNLRVYDAQQGLPVLEHIPAIQRRRLSALAKLALSAASEAKQQQSVDYIVWASR
Sbjct  1    MLQLHLSNLRVYDAQQGLPVLEHIPAIQRRRLSALAKLALSAASEAKQQQSVDYIVWASR  60

Query  61   YGDEAKTLNILKDVLTEQTPSPTQFSTSVHNAIAGLYSILCKDETVSTSLSCSWTQAMIE  120
            YGDEAKTLNILKDVLTEQTPSPTQFSTSVHNAIAGLYSILCKDETVSTSLSCSWTQAMIE
Sbjct  61   YGDEAKTLNILKDVLTEQTPSPTQFSTSVHNAIAGLYSILCKDETVSTSLSCSWTQAMIE  120

Query  121  AYAILKAQPDIQQVLLVYYEAALPDIYQDREDFEPFALSTVLSLNQANIKLLSIEQTDQL  180
            AYAILKAQPDIQQVLLVYYEAALPDIYQDREDFEPFALSTVLSLNQANIKLLSIEQTDQL
Sbjct  121  AYAILKAQPDIQQVLLVYYEAALPDIYQDREDFEPFALSTVLSLNQANIKLLSIEQTDQL  180

Query  181  DVIDFYHFWQDKNRSKLLGWQKCSS  205
            DVIDFYHFWQDKNRSKLLGWQKCSS
Sbjct  181  DVIDFYHFWQDKNRSKLLGWQKCSS  205


> N9QW91 Ketoacyl_synth_N domain-containing protein [Acinetobacter 
ursingii NIPH 706]
Length=177

 Score =  270 bits (691),  Expect = 1e-95
 Identities = 128/177 (72%), Positives = 153/177 (86%), Gaps = 0/177 (0%)

Query  27   IQRRRLSALAKLALSAASEAKQQQSVDYIVWASRYGDEAKTLNILKDVLTEQTPSPTQFS  86
            +QRRRLS LAKLA++AA +   QQS DYIVWAS+YGDEAKTL IL+DVLT QTPSPTQFS
Sbjct  1    MQRRRLSPLAKLAINAAMQTLAQQSADYIVWASQYGDEAKTLGILQDVLTHQTPSPTQFS  60

Query  87   TSVHNAIAGLYSILCKDETVSTSLSCSWTQAMIEAYAILKAQPDIQQVLLVYYEAALPDI  146
            TSVHNAIAGLYSILCKDET+STSLSC W++AMIEAYAILK QP I+ VL+VYY+A LP+I
Sbjct  61   TSVHNAIAGLYSILCKDETISTSLSCGWSEAMIEAYAILKTQPQIKSVLVVYYDAPLPEI  120

Query  147  YQDREDFEPFALSTVLSLNQANIKLLSIEQTDQLDVIDFYHFWQDKNRSKLLGWQKC  203
            YQDR+ FEPFALST+LSL  AN++L ++EQT  +D + FY FWQD++++  LGWQKC
Sbjct  121  YQDRQAFEPFALSTLLSLEHANVELSAVEQTQDIDALSFYSFWQDQHQTAWLGWQKC  177


> A0A009YF14 Beta-ketoacyl synthase, N-terminal domain protein 
[Acinetobacter sp. 479375]
Length=177

 Score =  270 bits (691),  Expect = 1e-95
 Identities = 128/177 (72%), Positives = 153/177 (86%), Gaps = 0/177 (0%)

Query  27   IQRRRLSALAKLALSAASEAKQQQSVDYIVWASRYGDEAKTLNILKDVLTEQTPSPTQFS  86
            +QRRRLS LAKLA++AA +   QQS DYIVWAS+YGDEAKTL IL+DVLT QTPSPTQFS
Sbjct  1    MQRRRLSPLAKLAINAAMQTLAQQSADYIVWASQYGDEAKTLGILQDVLTHQTPSPTQFS  60

Query  87   TSVHNAIAGLYSILCKDETVSTSLSCSWTQAMIEAYAILKAQPDIQQVLLVYYEAALPDI  146
            TSVHNAIAGLYSILCKDET+STSLSC W++AMIEAYAILK QP I+ VL+VYY+A LP+I
Sbjct  61   TSVHNAIAGLYSILCKDETISTSLSCGWSEAMIEAYAILKTQPQIKSVLVVYYDAPLPEI  120

Query  147  YQDREDFEPFALSTVLSLNQANIKLLSIEQTDQLDVIDFYHFWQDKNRSKLLGWQKC  203
            YQDR+ FEPFALST+LSL  AN++L ++EQT  +D + FY FWQD++++  LGWQKC
Sbjct  121  YQDRQAFEPFALSTLLSLEHANVELSAVEQTQDIDALSFYSFWQDQHQTAWLGWQKC  177


> N9DHL9 Ketoacyl_synth_N domain-containing protein [Acinetobacter 
ursingii ANC 3649]
Length=177

 Score =  268 bits (685),  Expect = 8e-95
 Identities = 127/177 (72%), Positives = 151/177 (85%), Gaps = 0/177 (0%)

Query  27   IQRRRLSALAKLALSAASEAKQQQSVDYIVWASRYGDEAKTLNILKDVLTEQTPSPTQFS  86
            +QRRRLS LAKLA++AA +   QQS DYIVWAS+YGDEAKTL IL+DVLT QTPSPTQFS
Sbjct  1    MQRRRLSPLAKLAINAAMQTLAQQSADYIVWASQYGDEAKTLGILQDVLTHQTPSPTQFS  60

Query  87   TSVHNAIAGLYSILCKDETVSTSLSCSWTQAMIEAYAILKAQPDIQQVLLVYYEAALPDI  146
            TSVHNAIAGLYSILCKDET+STSLSC W++AMIEAYAILK QP I+ VL+VYY+A LP+I
Sbjct  61   TSVHNAIAGLYSILCKDETISTSLSCGWSEAMIEAYAILKTQPQIKTVLVVYYDAPLPEI  120

Query  147  YQDREDFEPFALSTVLSLNQANIKLLSIEQTDQLDVIDFYHFWQDKNRSKLLGWQKC  203
            YQDR+ FEPF LST+LSL  AN++L ++EQT  +D + FY FWQD+ ++  LGWQKC
Sbjct  121  YQDRQPFEPFTLSTLLSLEHANVELNAVEQTQDIDALSFYSFWQDQQQTAWLGWQKC  177


> A0A1P8EMD0 Beta-ketoacyl synthase [Acinetobacter soli]
Length=204

 Score =  251 bits (641),  Expect = 9e-88
 Identities = 122/202 (60%), Positives = 155/202 (77%), Gaps = 0/202 (0%)

Query  1    MLQLHLSNLRVYDAQQGLPVLEHIPAIQRRRLSALAKLALSAASEAKQQQSVDYIVWASR  60
            ML+LHLS+LR   A +GL  LE +PA+QRRRLSALAKLAL+ A E   +Q+VDYIVWAS 
Sbjct  1    MLKLHLSSLRHCYAGEGLSALESVPAMQRRRLSALAKLALNVAIETVNEQAVDYIVWASC  60

Query  61   YGDEAKTLNILKDVLTEQTPSPTQFSTSVHNAIAGLYSILCKDETVSTSLSCSWTQAMIE  120
            YGDE KT  ILKDVLT+QTPSPTQFSTSVHNAI GLYSILC+D+T+STSLSCSW++AMIE
Sbjct  61   YGDETKTYGILKDVLTDQTPSPTQFSTSVHNAIGGLYSILCQDDTISTSLSCSWSKAMIE  120

Query  121  AYAILKAQPDIQQVLLVYYEAALPDIYQDREDFEPFALSTVLSLNQANIKLLSIEQTDQL  180
            AYAILK QP +++V++V+YE  LP+IY D+  F+ FA+S V+SL   N+ L  +  + ++
Sbjct  121  AYAILKTQPQVKRVMVVFYEEPLPEIYDDKVTFDAFAMSAVVSLEAPNLSLEGLISSQEI  180

Query  181  DVIDFYHFWQDKNRSKLLGWQK  202
            + + FY FW    +    GW K
Sbjct  181  EALGFYAFWNASEQHAWRGWHK  202


> N9AIG4 Ketoacyl_synth_N domain-containing protein [Acinetobacter 
soli NIPH 2899]
Length=204

 Score =  251 bits (640),  Expect = 1e-87
 Identities = 121/202 (60%), Positives = 155/202 (77%), Gaps = 0/202 (0%)

Query  1    MLQLHLSNLRVYDAQQGLPVLEHIPAIQRRRLSALAKLALSAASEAKQQQSVDYIVWASR  60
            ML+LHLS+LR   A +GL  LE +PA+QRRRLSALAKLAL+ A E   +Q++DYIVWAS 
Sbjct  1    MLKLHLSSLRHCYAGEGLSALESVPAMQRRRLSALAKLALNVAIETVNEQAIDYIVWASC  60

Query  61   YGDEAKTLNILKDVLTEQTPSPTQFSTSVHNAIAGLYSILCKDETVSTSLSCSWTQAMIE  120
            YGDE KT  ILKDVLT+QTPSPTQFSTSVHNAI GLYSILC+D+T+STSLSCSW++AMIE
Sbjct  61   YGDETKTYGILKDVLTDQTPSPTQFSTSVHNAIGGLYSILCQDDTISTSLSCSWSKAMIE  120

Query  121  AYAILKAQPDIQQVLLVYYEAALPDIYQDREDFEPFALSTVLSLNQANIKLLSIEQTDQL  180
            AYAILK QP +++V++V+YE  LP+IY D+  F+ FA+S V+SL   N+ L  +  + ++
Sbjct  121  AYAILKTQPQVKRVMVVFYEEPLPEIYDDKVTFDAFAMSAVVSLEAPNLSLEGLISSQEI  180

Query  181  DVIDFYHFWQDKNRSKLLGWQK  202
            + + FY FW    +    GW K
Sbjct  181  EALGFYAFWNASEQHAWRGWHK  202


> A0A0M1I6M5 Beta-ketoacyl synthase [Acinetobacter sp. C15]
Length=204

 Score =  251 bits (640),  Expect = 1e-87
 Identities = 121/202 (60%), Positives = 155/202 (77%), Gaps = 0/202 (0%)

Query  1    MLQLHLSNLRVYDAQQGLPVLEHIPAIQRRRLSALAKLALSAASEAKQQQSVDYIVWASR  60
            ML+LHLS+LR   A +GL  LE +PA+QRRRLSALAKLAL+ A E   +Q++DYIVWAS 
Sbjct  1    MLKLHLSSLRHCYAGEGLSALESVPAMQRRRLSALAKLALNVAIETVNEQAIDYIVWASC  60

Query  61   YGDEAKTLNILKDVLTEQTPSPTQFSTSVHNAIAGLYSILCKDETVSTSLSCSWTQAMIE  120
            YGDE KT  ILKDVLT+QTPSPTQFSTSVHNAI GLYSILC+D+T+STSLSCSW++AMIE
Sbjct  61   YGDETKTYGILKDVLTDQTPSPTQFSTSVHNAIGGLYSILCQDDTISTSLSCSWSKAMIE  120

Query  121  AYAILKAQPDIQQVLLVYYEAALPDIYQDREDFEPFALSTVLSLNQANIKLLSIEQTDQL  180
            AYAILK QP +++V++V+YE  LP+IY D+  F+ FA+S V+SL   N+ L  +  + ++
Sbjct  121  AYAILKTQPQVKRVMVVFYEEPLPEIYDDKVTFDAFAMSAVVSLEAPNLSLEGLISSQEI  180

Query  181  DVIDFYHFWQDKNRSKLLGWQK  202
            + + FY FW    +    GW K
Sbjct  181  EALGFYAFWNASEQHAWRGWHK  202


> N9THS8 Ketoacyl_synth_N domain-containing protein [Acinetobacter 
sp. ANC 3880]
Length=204

 Score =  242 bits (617),  Expect = 4e-84
 Identities = 122/204 (60%), Positives = 155/204 (76%), Gaps = 1/204 (0%)

Query  1    MLQLHLSNLRVYDAQQGLPVLEHIPAIQRRRLSALAKLALSAASEAKQQQSVDYIVWASR  60
            ML+LHL+  ++ DAQQ    L+ IPA+QRRRLSALAK+ALS+A  +   Q VDYIVWASR
Sbjct  1    MLKLHLTQPQLIDAQQNYAALDAIPAMQRRRLSALAKMALSSALTSLNGQHVDYIVWASR  60

Query  61   YGDEAKTLNILKDVLTEQTPSPTQFSTSVHNAIAGLYSILCKDETVSTSLSCSWTQAMIE  120
            YGDE KTL+IL+DVL +QTPSPTQFSTSVHNAIAGLYSILC+D T STSLSC WT+A+IE
Sbjct  61   YGDEQKTLDILQDVLQQQTPSPTQFSTSVHNAIAGLYSILCQDATPSTSLSCEWTEALIE  120

Query  121  AYAILKAQPDIQQVLLVYYEAALPDIYQDREDFEPFALSTVLSLNQANIKLLSIEQTDQL  180
            AYAILK+    Q+VL+V Y+ ALP +Y D  +F  FAL+TV+SL   N+++L +  ++ L
Sbjct  121  AYAILKSTTTAQRVLVVAYDQALPSVYADAIEFSTFALATVVSLENPNLEVLQLSGSESL  180

Query  181  DVIDFYHFWQDKN-RSKLLGWQKC  203
            + + FY FWQ       +L W+KC
Sbjct  181  ESLTFYQFWQAAEVGQSVLRWKKC  204


> R9BB61 Ketoacyl_synth_N domain-containing protein [Acinetobacter 
sp. CIP 110321]
Length=204

 Score =  241 bits (615),  Expect = 7e-84
 Identities = 120/204 (59%), Positives = 157/204 (77%), Gaps = 1/204 (0%)

Query  1    MLQLHLSNLRVYDAQQGLPVLEHIPAIQRRRLSALAKLALSAASEAKQQQSVDYIVWASR  60
            ML+LHL+  ++ +AQQ    L+ IPA+QRRRLSALAK+ALS+A  +   Q VDYIVWASR
Sbjct  1    MLKLHLTQPQLIEAQQNYAALDAIPAMQRRRLSALAKMALSSALTSLNGQQVDYIVWASR  60

Query  61   YGDEAKTLNILKDVLTEQTPSPTQFSTSVHNAIAGLYSILCKDETVSTSLSCSWTQAMIE  120
            YGDE KTL+IL+DVL +QTPSPTQFSTSVHNAIAGLYSILC+D T STSLSC WT+A+IE
Sbjct  61   YGDEQKTLDILQDVLQQQTPSPTQFSTSVHNAIAGLYSILCQDATPSTSLSCEWTEALIE  120

Query  121  AYAILKAQPDIQQVLLVYYEAALPDIYQDREDFEPFALSTVLSLNQANIKLLSIEQTDQL  180
            AYAILK+    Q+VL+V Y+ ALP++Y D  +F  FAL+T++SL   N+++L +  ++ L
Sbjct  121  AYAILKSTATAQRVLVVAYDQALPNVYADTVEFPAFALATIVSLEHPNLEVLQLSGSESL  180

Query  181  DVIDFYHFWQDKNRSK-LLGWQKC  203
            + + FY FWQ     + +L W+KC
Sbjct  181  ESLAFYQFWQAAEAGQSVLRWKKC  204


> N8PFQ8 Ketoacyl_synth_N domain-containing protein [Acinetobacter 
sp. NIPH 809]
Length=204

 Score =  239 bits (611),  Expect = 3e-83
 Identities = 121/204 (59%), Positives = 155/204 (76%), Gaps = 1/204 (0%)

Query  1    MLQLHLSNLRVYDAQQGLPVLEHIPAIQRRRLSALAKLALSAASEAKQQQSVDYIVWASR  60
            ML+LHL+  ++ +AQQ    L+ IPA+QRRRLSALAK+ALS+A  +   Q VDYIVWASR
Sbjct  1    MLKLHLTQPQLIEAQQNYTALDAIPAMQRRRLSALAKMALSSALTSLNGQRVDYIVWASR  60

Query  61   YGDEAKTLNILKDVLTEQTPSPTQFSTSVHNAIAGLYSILCKDETVSTSLSCSWTQAMIE  120
            YGDE KTL+IL+DVL +QTPSPTQFSTSVHNAIAGLYSILC+D T STSLSC WT+A+IE
Sbjct  61   YGDEQKTLDILQDVLQQQTPSPTQFSTSVHNAIAGLYSILCQDATPSTSLSCEWTEALIE  120

Query  121  AYAILKAQPDIQQVLLVYYEAALPDIYQDREDFEPFALSTVLSLNQANIKLLSIEQTDQL  180
            AYAILK+    Q+VL+V Y+ ALP +Y D  +F  FAL+TV+SL   N+++L +  ++ L
Sbjct  121  AYAILKSTATAQRVLVVAYDQALPRVYVDATEFSAFALATVVSLENPNLEVLQLSGSESL  180

Query  181  DVIDFYHFWQDKN-RSKLLGWQKC  203
            + + FY FWQ       +L W+KC
Sbjct  181  ESLAFYQFWQAAEVGQSVLRWKKC  204


> A0A2N0WIQ0 Beta-ketoacyl synthase [Acinetobacter proteolyticus]
Length=204

 Score =  239 bits (611),  Expect = 3e-83
 Identities = 121/204 (59%), Positives = 155/204 (76%), Gaps = 1/204 (0%)

Query  1    MLQLHLSNLRVYDAQQGLPVLEHIPAIQRRRLSALAKLALSAASEAKQQQSVDYIVWASR  60
            ML+LHL+  ++ +AQQ    L+ IPA+QRRRLSALAK+ALS+A  +   Q VDYIVWASR
Sbjct  1    MLKLHLTQPQLIEAQQNYTALDAIPAMQRRRLSALAKMALSSALTSLNGQRVDYIVWASR  60

Query  61   YGDEAKTLNILKDVLTEQTPSPTQFSTSVHNAIAGLYSILCKDETVSTSLSCSWTQAMIE  120
            YGDE KTL+IL+DVL +QTPSPTQFSTSVHNAIAGLYSILC+D T STSLSC WT+A+IE
Sbjct  61   YGDEQKTLDILQDVLQQQTPSPTQFSTSVHNAIAGLYSILCQDATPSTSLSCEWTEALIE  120

Query  121  AYAILKAQPDIQQVLLVYYEAALPDIYQDREDFEPFALSTVLSLNQANIKLLSIEQTDQL  180
            AYAILK+    Q+VL+V Y+ ALP +Y D  +F  FAL+TV+SL   N+++L +  ++ L
Sbjct  121  AYAILKSTATAQRVLVVAYDQALPRVYVDATEFSAFALATVVSLENPNLEVLQLSGSESL  180

Query  181  DVIDFYHFWQDKN-RSKLLGWQKC  203
            + + FY FWQ       +L W+KC
Sbjct  181  ESLAFYQFWQAAEVGQSVLRWKKC  204



Lambda      K        H        a         alpha
   0.321    0.132    0.384    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 300560


  Database: 3080b4af9bf19028b112cf6df41c233e.TrEMBL.fasta
    Posted date:  Sep 21, 2020  5:15 AM
  Number of letters in database: 2,164
  Number of sequences in database:  11



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40