ACIAD0566 / SwissProt Alignments

BLASTP 2.2.28+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: ae5d4a4e5c0532688627986be151bdc3.SwissProt.fasta
           1 sequences; 346 total letters



Query= ACIAD0566

Length=206
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  Q874K0 3-keto-steroid reductase [Candida albicans]                  34.7    8e-07


> Q874K0 3-keto-steroid reductase [Candida albicans]
Length=346

 Score = 34.7 bits (78),  Expect = 8e-07
 Identities = 20/89 (22%), Positives = 40/89 (45%), Gaps = 1/89 (1%)

Query  100  LCKDETVSTSLSCSWTQAMIEAYAILKAQPDIQQVLLVYYEAALPDIYQDREDFEPFALS  159
            L KD TV+     S       A  +L+  PD +++ LV     LP + +   D + + + 
Sbjct  3    LLKDSTVAVITGTSSNLGFNIAVRLLEGLPDNKEITLVVTSRTLPKVKEVISDIKKYIVE  62

Query  160  TV-LSLNQANIKLLSIEQTDQLDVIDFYH  187
             +   +N+     L ++ TD + ++  Y+
Sbjct  63   KIPTKVNKVEFDYLLVDFTDMVSILSAYY  91


 Score = 13.9 bits (24),  Expect = 4.2
 Identities = 4/13 (31%), Positives = 11/13 (85%), Gaps = 0/13 (0%)

Query  65  AKTLNILKDVLTE  77
           ++TL  +K+V+++
Sbjct  43  SRTLPKVKEVISD  55



Lambda      K        H        a         alpha
   0.321    0.132    0.384    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 58101


  Database: ae5d4a4e5c0532688627986be151bdc3.SwissProt.fasta
    Posted date:  Sep 19, 2020  2:30 PM
  Number of letters in database: 346
  Number of sequences in database:  1



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40