ACIAD0561 / TrEMBL Alignments

BLASTP 2.2.28+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: 0c4265b40ba4b3184c435dc54aa3b23e.TrEMBL.fasta
           36 sequences; 16,135 total letters



Query= ACIAD0561

Length=372
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  A0A1P8EMD9 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase...   706    0.0   
  A0A0M1I502 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase...   706    0.0   
  N9AIG8 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (fl...   706    0.0   
  A0A2T5QF34 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase...   699    0.0   
  A0A242SCX0 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase...   699    0.0   
  A0A0B2XZL5 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase...   699    0.0   
  N8QZQ1 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (fl...   699    0.0   
  A0A013U068 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase...   699    0.0   
  N9S7Z8 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (fl...   699    0.0   
  R8YDZ4 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (fl...   699    0.0   
  N9PRE8 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (fl...   699    0.0   
  A0A0B0KJ14 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase...   699    0.0   
  N9RB37 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (fl...   699    0.0   
  N8W9S3 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (fl...   698    0.0   
  N8QR85 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (fl...   698    0.0   
  A0A1Q3NQ29 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase...   698    0.0   
  A0A0M2ZVA4 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase...   698    0.0   
  N9K8J3 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (fl...   698    0.0   
  N9M6X5 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (fl...   698    0.0   
  N9MU58 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (fl...   697    0.0   
  A0A009L3D9 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase...   697    0.0   
  N9RDT6 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (fl...   697    0.0   
  A0A022IBY6 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase...   697    0.0   
  N9QW94 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (fl...   697    0.0   
  N9DHL4 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (fl...   697    0.0   
  A0A009YF10 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase...   697    0.0   
  A0A1W6GWT3 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase...   303    2e-102
  A0A2D1CNW4 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase...   229    4e-73 
  B6DXA0 Putative chloroplast 4-hydroxy-3-methylbut-2-en-1-yl dip...   226    2e-71 
  Q4VKB7 Putative chloroplast 1-hydroxy-2-methyl-2-(E)-butenyl-4-...   192    2e-57 
  A0A1D8H2T4 4-hydroxy-3-methylbut-2-enyl diphosphate synthase [O...   185    9e-55 
  B1Q2Q6 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Pe...   183    5e-54 
  Q84XR5 GCPE protein [Catharanthus roseus]                            180    3e-53 
  A9ZN14 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [He...   178    2e-52 
  A9CBE3 (E)-4-hydroxy-3-methyl-but-2-enyl diphosphate synthase [...   178    2e-52 
  B6DX96 Putative chloroplast 4-hydroxy-3-methylbut-2-en-1-yl dip...   175    3e-51 


> A0A1P8EMD9 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
(flavodoxin) [Acinetobacter soli]
Length=371

 Score =  706 bits (1823),  Expect = 0.0
 Identities = 361/371 (97%), Positives = 369/371 (99%), Gaps = 0/371 (0%)

Query  1    MIENPIKRRPTRKIRVGSVYVGGDAPISIQSMTNTETCDVDATVAQIQRCADAGVDIMRV  60
            MIENPIKRRPTRKIRVGSVYVGGDAPISIQSMTNTETCDVDATVAQIQRCADAGVDIMRV
Sbjct  1    MIENPIKRRPTRKIRVGSVYVGGDAPISIQSMTNTETCDVDATVAQIQRCADAGVDIMRV  60

Query  61   SVPSMEAAEAFGKIRQRVSVPLVADIHFDHRIALAVADYGADCLRINPGNIGSDQKVREV  120
            SVPSMEAAEAFG+IR+RVSVPLVADIHFDH+IALAVADYGADCLRINPGNIGSDQKVREV
Sbjct  61   SVPSMEAAEAFGQIRKRVSVPLVADIHFDHKIALAVADYGADCLRINPGNIGSDQKVREV  120

Query  121  VAAARHHGISIRIGVNAGSLEKDLQKKYGEPTGAALLESAMRHIDILDRLDFHEFKVSVK  180
            VAAARHH ISIRIGVNAGSLEKDLQKKYGEPTGAALLESAMRHIDILDRL+FHEFKVSVK
Sbjct  121  VAAARHHDISIRIGVNAGSLEKDLQKKYGEPTGAALLESAMRHIDILDRLNFHEFKVSVK  180

Query  181  ASNVFLTMDAYRLLSQQIDNPLHLGVTEAGIYRTGTVKSAIALGGLLMEGIGDTMRISLA  240
            ASNVFLTMDAYRLLSQQIDNPLHLGVTEAGIYRTGTVKSAIALGGLLMEGIGDTMRISLA
Sbjct  181  ASNVFLTMDAYRLLSQQIDNPLHLGVTEAGIYRTGTVKSAIALGGLLMEGIGDTMRISLA  240

Query  241  AEPEDEVKIGFDILKSLGLRSNGINFIACPSCSRQEFNVIKVMQALEERLEDIRTPMDLS  300
            AEPEDEVKIGFDILKSLGLRSNGINFIACPSCSRQEF+VIKVMQ+LEERLED+RTPMDLS
Sbjct  241  AEPEDEVKIGFDILKSLGLRSNGINFIACPSCSRQEFDVIKVMQSLEERLEDVRTPMDLS  300

Query  301  VIGCKVNGPGEAKEADIGIVGASPRSLVYRNGEKSHLIDTDQLVDEIEDMVRQRVKEIEE  360
            VIGCKVNGPGEAKEADIG+VGASPRSLVYRNGEKSHLIDTDQLVDEIE MVRQRVKEIEE
Sbjct  301  VIGCKVNGPGEAKEADIGVVGASPRSLVYRNGEKSHLIDTDQLVDEIESMVRQRVKEIEE  360

Query  361  AKSKEIIRSSS  371
            AKSKEIIRSSS
Sbjct  361  AKSKEIIRSSS  371


> A0A0M1I502 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
(flavodoxin) [Acinetobacter sp. C15]
Length=371

 Score =  706 bits (1823),  Expect = 0.0
 Identities = 361/371 (97%), Positives = 369/371 (99%), Gaps = 0/371 (0%)

Query  1    MIENPIKRRPTRKIRVGSVYVGGDAPISIQSMTNTETCDVDATVAQIQRCADAGVDIMRV  60
            MIENPIKRRPTRKIRVGSVYVGGDAPISIQSMTNTETCDVDATVAQIQRCADAGVDIMRV
Sbjct  1    MIENPIKRRPTRKIRVGSVYVGGDAPISIQSMTNTETCDVDATVAQIQRCADAGVDIMRV  60

Query  61   SVPSMEAAEAFGKIRQRVSVPLVADIHFDHRIALAVADYGADCLRINPGNIGSDQKVREV  120
            SVPSMEAAEAFG+IR+RVSVPLVADIHFDH+IALAVADYGADCLRINPGNIGSDQKVREV
Sbjct  61   SVPSMEAAEAFGQIRKRVSVPLVADIHFDHKIALAVADYGADCLRINPGNIGSDQKVREV  120

Query  121  VAAARHHGISIRIGVNAGSLEKDLQKKYGEPTGAALLESAMRHIDILDRLDFHEFKVSVK  180
            VAAARHH ISIRIGVNAGSLEKDLQKKYGEPTGAALLESAMRHIDILDRL+FHEFKVSVK
Sbjct  121  VAAARHHDISIRIGVNAGSLEKDLQKKYGEPTGAALLESAMRHIDILDRLNFHEFKVSVK  180

Query  181  ASNVFLTMDAYRLLSQQIDNPLHLGVTEAGIYRTGTVKSAIALGGLLMEGIGDTMRISLA  240
            ASNVFLTMDAYRLLSQQIDNPLHLGVTEAGIYRTGTVKSAIALGGLLMEGIGDTMRISLA
Sbjct  181  ASNVFLTMDAYRLLSQQIDNPLHLGVTEAGIYRTGTVKSAIALGGLLMEGIGDTMRISLA  240

Query  241  AEPEDEVKIGFDILKSLGLRSNGINFIACPSCSRQEFNVIKVMQALEERLEDIRTPMDLS  300
            AEPEDEVKIGFDILKSLGLRSNGINFIACPSCSRQEF+VIKVMQ+LEERLED+RTPMDLS
Sbjct  241  AEPEDEVKIGFDILKSLGLRSNGINFIACPSCSRQEFDVIKVMQSLEERLEDVRTPMDLS  300

Query  301  VIGCKVNGPGEAKEADIGIVGASPRSLVYRNGEKSHLIDTDQLVDEIEDMVRQRVKEIEE  360
            VIGCKVNGPGEAKEADIG+VGASPRSLVYRNGEKSHLIDTDQLVDEIE MVRQRVKEIEE
Sbjct  301  VIGCKVNGPGEAKEADIGVVGASPRSLVYRNGEKSHLIDTDQLVDEIESMVRQRVKEIEE  360

Query  361  AKSKEIIRSSS  371
            AKSKEIIRSSS
Sbjct  361  AKSKEIIRSSS  371


> N9AIG8 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) 
[Acinetobacter soli NIPH 2899]
Length=371

 Score =  706 bits (1823),  Expect = 0.0
 Identities = 361/371 (97%), Positives = 369/371 (99%), Gaps = 0/371 (0%)

Query  1    MIENPIKRRPTRKIRVGSVYVGGDAPISIQSMTNTETCDVDATVAQIQRCADAGVDIMRV  60
            MIENPIKRRPTRKIRVGSVYVGGDAPISIQSMTNTETCDVDATVAQIQRCADAGVDIMRV
Sbjct  1    MIENPIKRRPTRKIRVGSVYVGGDAPISIQSMTNTETCDVDATVAQIQRCADAGVDIMRV  60

Query  61   SVPSMEAAEAFGKIRQRVSVPLVADIHFDHRIALAVADYGADCLRINPGNIGSDQKVREV  120
            SVPSMEAAEAFG+IR+RVSVPLVADIHFDH+IALAVADYGADCLRINPGNIGSDQKVREV
Sbjct  61   SVPSMEAAEAFGQIRKRVSVPLVADIHFDHKIALAVADYGADCLRINPGNIGSDQKVREV  120

Query  121  VAAARHHGISIRIGVNAGSLEKDLQKKYGEPTGAALLESAMRHIDILDRLDFHEFKVSVK  180
            VAAARHH ISIRIGVNAGSLEKDLQKKYGEPTGAALLESAMRHIDILDRL+FHEFKVSVK
Sbjct  121  VAAARHHDISIRIGVNAGSLEKDLQKKYGEPTGAALLESAMRHIDILDRLNFHEFKVSVK  180

Query  181  ASNVFLTMDAYRLLSQQIDNPLHLGVTEAGIYRTGTVKSAIALGGLLMEGIGDTMRISLA  240
            ASNVFLTMDAYRLLSQQIDNPLHLGVTEAGIYRTGTVKSAIALGGLLMEGIGDTMRISLA
Sbjct  181  ASNVFLTMDAYRLLSQQIDNPLHLGVTEAGIYRTGTVKSAIALGGLLMEGIGDTMRISLA  240

Query  241  AEPEDEVKIGFDILKSLGLRSNGINFIACPSCSRQEFNVIKVMQALEERLEDIRTPMDLS  300
            AEPEDEVKIGFDILKSLGLRSNGINFIACPSCSRQEF+VIKVMQ+LEERLED+RTPMDLS
Sbjct  241  AEPEDEVKIGFDILKSLGLRSNGINFIACPSCSRQEFDVIKVMQSLEERLEDVRTPMDLS  300

Query  301  VIGCKVNGPGEAKEADIGIVGASPRSLVYRNGEKSHLIDTDQLVDEIEDMVRQRVKEIEE  360
            VIGCKVNGPGEAKEADIG+VGASPRSLVYRNGEKSHLIDTDQLVDEIE MVRQRVKEIEE
Sbjct  301  VIGCKVNGPGEAKEADIGVVGASPRSLVYRNGEKSHLIDTDQLVDEIESMVRQRVKEIEE  360

Query  361  AKSKEIIRSSS  371
            AKSKEIIRSSS
Sbjct  361  AKSKEIIRSSS  371


> A0A2T5QF34 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
(flavodoxin) [Acinetobacter oleivorans]
Length=371

 Score =  699 bits (1805),  Expect = 0.0
 Identities = 355/371 (96%), Positives = 366/371 (99%), Gaps = 0/371 (0%)

Query  1    MIENPIKRRPTRKIRVGSVYVGGDAPISIQSMTNTETCDVDATVAQIQRCADAGVDIMRV  60
            MIENPIKRRPTRKIRVGSVYVGGDAPIS+QSMTNTETCDVDATVAQI+RC DAG DIMRV
Sbjct  1    MIENPIKRRPTRKIRVGSVYVGGDAPISVQSMTNTETCDVDATVAQIERCVDAGADIMRV  60

Query  61   SVPSMEAAEAFGKIRQRVSVPLVADIHFDHRIALAVADYGADCLRINPGNIGSDQKVREV  120
            SVPSMEAAEAFG IR+RVSVPLVADIHFDHRIALAVADYGADCLRINPGNIGSDQKVREV
Sbjct  61   SVPSMEAAEAFGAIRKRVSVPLVADIHFDHRIALAVADYGADCLRINPGNIGSDQKVREV  120

Query  121  VAAARHHGISIRIGVNAGSLEKDLQKKYGEPTGAALLESAMRHIDILDRLDFHEFKVSVK  180
            VAAARHHGIS+RIGVNAGSLEKDLQKKYGEPTG ALLESA+RHIDILDRLDFHEFKVSVK
Sbjct  121  VAAARHHGISMRIGVNAGSLEKDLQKKYGEPTGQALLESALRHIDILDRLDFHEFKVSVK  180

Query  181  ASNVFLTMDAYRLLSQQIDNPLHLGVTEAGIYRTGTVKSAIALGGLLMEGIGDTMRISLA  240
            ASNVFLTMDAYRLLSQQIDNPLHLGVTEAGIYRTGTVKSAIALGGLLMEGIGDTMRISLA
Sbjct  181  ASNVFLTMDAYRLLSQQIDNPLHLGVTEAGIYRTGTVKSAIALGGLLMEGIGDTMRISLA  240

Query  241  AEPEDEVKIGFDILKSLGLRSNGINFIACPSCSRQEFNVIKVMQALEERLEDIRTPMDLS  300
            AEPEDE+KIGFDILKSLGLRSNGINFIACPSCSRQEFNVI+VMQALEERLEDIRTPMD+S
Sbjct  241  AEPEDEIKIGFDILKSLGLRSNGINFIACPSCSRQEFNVIQVMQALEERLEDIRTPMDVS  300

Query  301  VIGCKVNGPGEAKEADIGIVGASPRSLVYRNGEKSHLIDTDQLVDEIEDMVRQRVKEIEE  360
            VIGCKVNGPGEAKEADIGIVGA+PRSLVYRNGEKSHLIDTDQLVDEIE MVRQRV+E+EE
Sbjct  301  VIGCKVNGPGEAKEADIGIVGAAPRSLVYRNGEKSHLIDTDQLVDEIETMVRQRVQELEE  360

Query  361  AKSKEIIRSSS  371
            AKSKEIIRSSS
Sbjct  361  AKSKEIIRSSS  371


> A0A242SCX0 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
(flavodoxin) [Acinetobacter pittii]
Length=371

 Score =  699 bits (1804),  Expect = 0.0
 Identities = 354/371 (95%), Positives = 366/371 (99%), Gaps = 0/371 (0%)

Query  1    MIENPIKRRPTRKIRVGSVYVGGDAPISIQSMTNTETCDVDATVAQIQRCADAGVDIMRV  60
            MIENPIKRRPTRKIRVGSVYVGGDAPIS+QSMTNTETCDVDATVAQI+RC DAG DIMRV
Sbjct  1    MIENPIKRRPTRKIRVGSVYVGGDAPISVQSMTNTETCDVDATVAQIERCVDAGADIMRV  60

Query  61   SVPSMEAAEAFGKIRQRVSVPLVADIHFDHRIALAVADYGADCLRINPGNIGSDQKVREV  120
            SVPSMEAAEAFG IR+RVSVPLVADIHFDHRIALAVADYGADCLRINPGNIGSDQKVREV
Sbjct  61   SVPSMEAAEAFGAIRKRVSVPLVADIHFDHRIALAVADYGADCLRINPGNIGSDQKVREV  120

Query  121  VAAARHHGISIRIGVNAGSLEKDLQKKYGEPTGAALLESAMRHIDILDRLDFHEFKVSVK  180
            VAAARHHGIS+RIGVNAGSLEKDLQKKYGEPTG ALLESA+RHIDILDRLDFHEFKVSVK
Sbjct  121  VAAARHHGISMRIGVNAGSLEKDLQKKYGEPTGQALLESALRHIDILDRLDFHEFKVSVK  180

Query  181  ASNVFLTMDAYRLLSQQIDNPLHLGVTEAGIYRTGTVKSAIALGGLLMEGIGDTMRISLA  240
            ASNVFLTMDAYRLLSQQIDNPLHLGVTEAGIYRTGTVKSAIALGGLLMEGIGDTMRISLA
Sbjct  181  ASNVFLTMDAYRLLSQQIDNPLHLGVTEAGIYRTGTVKSAIALGGLLMEGIGDTMRISLA  240

Query  241  AEPEDEVKIGFDILKSLGLRSNGINFIACPSCSRQEFNVIKVMQALEERLEDIRTPMDLS  300
            AEPEDE+KIGFDILKSLGLRSNGINFIACPSCSRQEFNVI+VMQALEERLEDIRTPMD+S
Sbjct  241  AEPEDEIKIGFDILKSLGLRSNGINFIACPSCSRQEFNVIQVMQALEERLEDIRTPMDVS  300

Query  301  VIGCKVNGPGEAKEADIGIVGASPRSLVYRNGEKSHLIDTDQLVDEIEDMVRQRVKEIEE  360
            VIGCKVNGPGEAKEADIG+VGA+PRSLVYRNGEKSHLIDTDQLVDEIE MVRQRV+E+EE
Sbjct  301  VIGCKVNGPGEAKEADIGVVGAAPRSLVYRNGEKSHLIDTDQLVDEIETMVRQRVQELEE  360

Query  361  AKSKEIIRSSS  371
            AKSKEIIRSSS
Sbjct  361  AKSKEIIRSSS  371


> A0A0B2XZL5 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
(flavodoxin) [Acinetobacter baumannii]
Length=371

 Score =  699 bits (1804),  Expect = 0.0
 Identities = 354/371 (95%), Positives = 366/371 (99%), Gaps = 0/371 (0%)

Query  1    MIENPIKRRPTRKIRVGSVYVGGDAPISIQSMTNTETCDVDATVAQIQRCADAGVDIMRV  60
            MIENPIKRRPTRKIRVGSVYVGGDAPIS+QSMTNTETCDVDATVAQI+RC DAG DIMRV
Sbjct  1    MIENPIKRRPTRKIRVGSVYVGGDAPISVQSMTNTETCDVDATVAQIERCVDAGADIMRV  60

Query  61   SVPSMEAAEAFGKIRQRVSVPLVADIHFDHRIALAVADYGADCLRINPGNIGSDQKVREV  120
            SVPSMEAAEAFG IR+RVSVPLVADIHFDHRIALAVADYGADCLRINPGNIGSDQKVREV
Sbjct  61   SVPSMEAAEAFGAIRKRVSVPLVADIHFDHRIALAVADYGADCLRINPGNIGSDQKVREV  120

Query  121  VAAARHHGISIRIGVNAGSLEKDLQKKYGEPTGAALLESAMRHIDILDRLDFHEFKVSVK  180
            VAAARHHGIS+RIGVNAGSLEKDLQKKYGEPTG ALLESA+RHIDILDRLDFHEFKVSVK
Sbjct  121  VAAARHHGISMRIGVNAGSLEKDLQKKYGEPTGQALLESALRHIDILDRLDFHEFKVSVK  180

Query  181  ASNVFLTMDAYRLLSQQIDNPLHLGVTEAGIYRTGTVKSAIALGGLLMEGIGDTMRISLA  240
            ASNVFLTMDAYRLLSQQIDNPLHLGVTEAGIYRTGTVKSAIALGGLLMEGIGDTMRISLA
Sbjct  181  ASNVFLTMDAYRLLSQQIDNPLHLGVTEAGIYRTGTVKSAIALGGLLMEGIGDTMRISLA  240

Query  241  AEPEDEVKIGFDILKSLGLRSNGINFIACPSCSRQEFNVIKVMQALEERLEDIRTPMDLS  300
            AEPEDE+KIGFDILKSLGLRSNGINFIACPSCSRQEFNVI+VMQALEERLEDIRTPMD+S
Sbjct  241  AEPEDEIKIGFDILKSLGLRSNGINFIACPSCSRQEFNVIQVMQALEERLEDIRTPMDVS  300

Query  301  VIGCKVNGPGEAKEADIGIVGASPRSLVYRNGEKSHLIDTDQLVDEIEDMVRQRVKEIEE  360
            VIGCKVNGPGEAKEADIG+VGA+PRSLVYRNGEKSHLIDTDQLVDEIE MVRQRV+E+EE
Sbjct  301  VIGCKVNGPGEAKEADIGVVGAAPRSLVYRNGEKSHLIDTDQLVDEIETMVRQRVQELEE  360

Query  361  AKSKEIIRSSS  371
            AKSKEIIRSSS
Sbjct  361  AKSKEIIRSSS  371


> N8QZQ1 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) 
[Acinetobacter seifertii]
Length=371

 Score =  699 bits (1804),  Expect = 0.0
 Identities = 354/371 (95%), Positives = 366/371 (99%), Gaps = 0/371 (0%)

Query  1    MIENPIKRRPTRKIRVGSVYVGGDAPISIQSMTNTETCDVDATVAQIQRCADAGVDIMRV  60
            MIENPIKRRPTRKIRVGSVYVGGDAPIS+QSMTNTETCDVDATVAQI+RC DAG DIMRV
Sbjct  1    MIENPIKRRPTRKIRVGSVYVGGDAPISVQSMTNTETCDVDATVAQIERCVDAGADIMRV  60

Query  61   SVPSMEAAEAFGKIRQRVSVPLVADIHFDHRIALAVADYGADCLRINPGNIGSDQKVREV  120
            SVPSMEAAEAFG IR+RVSVPLVADIHFDHRIALAVADYGADCLRINPGNIGSDQKVREV
Sbjct  61   SVPSMEAAEAFGAIRKRVSVPLVADIHFDHRIALAVADYGADCLRINPGNIGSDQKVREV  120

Query  121  VAAARHHGISIRIGVNAGSLEKDLQKKYGEPTGAALLESAMRHIDILDRLDFHEFKVSVK  180
            VAAARHHGIS+RIGVNAGSLEKDLQKKYGEPTG ALLESA+RHIDILDRLDFHEFKVSVK
Sbjct  121  VAAARHHGISMRIGVNAGSLEKDLQKKYGEPTGQALLESALRHIDILDRLDFHEFKVSVK  180

Query  181  ASNVFLTMDAYRLLSQQIDNPLHLGVTEAGIYRTGTVKSAIALGGLLMEGIGDTMRISLA  240
            ASNVFLTMDAYRLLSQQIDNPLHLGVTEAGIYRTGTVKSAIALGGLLMEGIGDTMRISLA
Sbjct  181  ASNVFLTMDAYRLLSQQIDNPLHLGVTEAGIYRTGTVKSAIALGGLLMEGIGDTMRISLA  240

Query  241  AEPEDEVKIGFDILKSLGLRSNGINFIACPSCSRQEFNVIKVMQALEERLEDIRTPMDLS  300
            AEPEDE+KIGFDILKSLGLRSNGINFIACPSCSRQEFNVI+VMQALEERLEDIRTPMD+S
Sbjct  241  AEPEDEIKIGFDILKSLGLRSNGINFIACPSCSRQEFNVIQVMQALEERLEDIRTPMDVS  300

Query  301  VIGCKVNGPGEAKEADIGIVGASPRSLVYRNGEKSHLIDTDQLVDEIEDMVRQRVKEIEE  360
            VIGCKVNGPGEAKEADIG+VGA+PRSLVYRNGEKSHLIDTDQLVDEIE MVRQRV+E+EE
Sbjct  301  VIGCKVNGPGEAKEADIGVVGAAPRSLVYRNGEKSHLIDTDQLVDEIETMVRQRVQELEE  360

Query  361  AKSKEIIRSSS  371
            AKSKEIIRSSS
Sbjct  361  AKSKEIIRSSS  371


> A0A013U068 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
(flavodoxin) [Acinetobacter baumannii 573719]
Length=371

 Score =  699 bits (1804),  Expect = 0.0
 Identities = 354/371 (95%), Positives = 366/371 (99%), Gaps = 0/371 (0%)

Query  1    MIENPIKRRPTRKIRVGSVYVGGDAPISIQSMTNTETCDVDATVAQIQRCADAGVDIMRV  60
            MIENPIKRRPTRKIRVGSVYVGGDAPIS+QSMTNTETCDVDATVAQI+RC DAG DIMRV
Sbjct  1    MIENPIKRRPTRKIRVGSVYVGGDAPISVQSMTNTETCDVDATVAQIERCVDAGADIMRV  60

Query  61   SVPSMEAAEAFGKIRQRVSVPLVADIHFDHRIALAVADYGADCLRINPGNIGSDQKVREV  120
            SVPSMEAAEAFG IR+RVSVPLVADIHFDHRIALAVADYGADCLRINPGNIGSDQKVREV
Sbjct  61   SVPSMEAAEAFGAIRKRVSVPLVADIHFDHRIALAVADYGADCLRINPGNIGSDQKVREV  120

Query  121  VAAARHHGISIRIGVNAGSLEKDLQKKYGEPTGAALLESAMRHIDILDRLDFHEFKVSVK  180
            VAAARHHGIS+RIGVNAGSLEKDLQKKYGEPTG ALLESA+RHIDILDRLDFHEFKVSVK
Sbjct  121  VAAARHHGISMRIGVNAGSLEKDLQKKYGEPTGQALLESALRHIDILDRLDFHEFKVSVK  180

Query  181  ASNVFLTMDAYRLLSQQIDNPLHLGVTEAGIYRTGTVKSAIALGGLLMEGIGDTMRISLA  240
            ASNVFLTMDAYRLLSQQIDNPLHLGVTEAGIYRTGTVKSAIALGGLLMEGIGDTMRISLA
Sbjct  181  ASNVFLTMDAYRLLSQQIDNPLHLGVTEAGIYRTGTVKSAIALGGLLMEGIGDTMRISLA  240

Query  241  AEPEDEVKIGFDILKSLGLRSNGINFIACPSCSRQEFNVIKVMQALEERLEDIRTPMDLS  300
            AEPEDE+KIGFDILKSLGLRSNGINFIACPSCSRQEFNVI+VMQALEERLEDIRTPMD+S
Sbjct  241  AEPEDEIKIGFDILKSLGLRSNGINFIACPSCSRQEFNVIQVMQALEERLEDIRTPMDVS  300

Query  301  VIGCKVNGPGEAKEADIGIVGASPRSLVYRNGEKSHLIDTDQLVDEIEDMVRQRVKEIEE  360
            VIGCKVNGPGEAKEADIG+VGA+PRSLVYRNGEKSHLIDTDQLVDEIE MVRQRV+E+EE
Sbjct  301  VIGCKVNGPGEAKEADIGVVGAAPRSLVYRNGEKSHLIDTDQLVDEIETMVRQRVQELEE  360

Query  361  AKSKEIIRSSS  371
            AKSKEIIRSSS
Sbjct  361  AKSKEIIRSSS  371


> N9S7Z8 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) 
[Acinetobacter sp. NIPH 542]
Length=371

 Score =  699 bits (1804),  Expect = 0.0
 Identities = 354/371 (95%), Positives = 366/371 (99%), Gaps = 0/371 (0%)

Query  1    MIENPIKRRPTRKIRVGSVYVGGDAPISIQSMTNTETCDVDATVAQIQRCADAGVDIMRV  60
            MIENPIKRRPTRKIRVGSVYVGGDAPIS+QSMTNTETCDVDATVAQI+RC DAG DIMRV
Sbjct  1    MIENPIKRRPTRKIRVGSVYVGGDAPISVQSMTNTETCDVDATVAQIERCVDAGADIMRV  60

Query  61   SVPSMEAAEAFGKIRQRVSVPLVADIHFDHRIALAVADYGADCLRINPGNIGSDQKVREV  120
            SVPSMEAAEAFG IR+RVSVPLVADIHFDHRIALAVADYGADCLRINPGNIGSDQKVREV
Sbjct  61   SVPSMEAAEAFGAIRKRVSVPLVADIHFDHRIALAVADYGADCLRINPGNIGSDQKVREV  120

Query  121  VAAARHHGISIRIGVNAGSLEKDLQKKYGEPTGAALLESAMRHIDILDRLDFHEFKVSVK  180
            VAAARHHGIS+RIGVNAGSLEKDLQKKYGEPTG ALLESA+RHIDILDRLDFHEFKVSVK
Sbjct  121  VAAARHHGISMRIGVNAGSLEKDLQKKYGEPTGQALLESALRHIDILDRLDFHEFKVSVK  180

Query  181  ASNVFLTMDAYRLLSQQIDNPLHLGVTEAGIYRTGTVKSAIALGGLLMEGIGDTMRISLA  240
            ASNVFLTMDAYRLLSQQIDNPLHLGVTEAGIYRTGTVKSAIALGGLLMEGIGDTMRISLA
Sbjct  181  ASNVFLTMDAYRLLSQQIDNPLHLGVTEAGIYRTGTVKSAIALGGLLMEGIGDTMRISLA  240

Query  241  AEPEDEVKIGFDILKSLGLRSNGINFIACPSCSRQEFNVIKVMQALEERLEDIRTPMDLS  300
            AEPEDE+KIGFDILKSLGLRSNGINFIACPSCSRQEFNVI+VMQALEERLEDIRTPMD+S
Sbjct  241  AEPEDEIKIGFDILKSLGLRSNGINFIACPSCSRQEFNVIQVMQALEERLEDIRTPMDVS  300

Query  301  VIGCKVNGPGEAKEADIGIVGASPRSLVYRNGEKSHLIDTDQLVDEIEDMVRQRVKEIEE  360
            VIGCKVNGPGEAKEADIG+VGA+PRSLVYRNGEKSHLIDTDQLVDEIE MVRQRV+E+EE
Sbjct  301  VIGCKVNGPGEAKEADIGVVGAAPRSLVYRNGEKSHLIDTDQLVDEIETMVRQRVQELEE  360

Query  361  AKSKEIIRSSS  371
            AKSKEIIRSSS
Sbjct  361  AKSKEIIRSSS  371


> R8YDZ4 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) 
[Acinetobacter pittii ANC 4050]
Length=371

 Score =  699 bits (1803),  Expect = 0.0
 Identities = 353/371 (95%), Positives = 366/371 (99%), Gaps = 0/371 (0%)

Query  1    MIENPIKRRPTRKIRVGSVYVGGDAPISIQSMTNTETCDVDATVAQIQRCADAGVDIMRV  60
            MIENPIKRRPTRKIRVGSVYVGGDAPIS+QSMTNTETCDVDATVAQI+RC DAG DIMRV
Sbjct  1    MIENPIKRRPTRKIRVGSVYVGGDAPISVQSMTNTETCDVDATVAQIERCVDAGADIMRV  60

Query  61   SVPSMEAAEAFGKIRQRVSVPLVADIHFDHRIALAVADYGADCLRINPGNIGSDQKVREV  120
            SVPSMEAAEAFG IR+RVSVPLVADIHFDHRIALAVADYGADCLRINPGNIGSDQKVREV
Sbjct  61   SVPSMEAAEAFGAIRKRVSVPLVADIHFDHRIALAVADYGADCLRINPGNIGSDQKVREV  120

Query  121  VAAARHHGISIRIGVNAGSLEKDLQKKYGEPTGAALLESAMRHIDILDRLDFHEFKVSVK  180
            VAAARHHGIS+RIGVNAGSLEKDLQKKYGEPTG ALLESA+RHIDILDRLDFHEFKVSVK
Sbjct  121  VAAARHHGISMRIGVNAGSLEKDLQKKYGEPTGQALLESALRHIDILDRLDFHEFKVSVK  180

Query  181  ASNVFLTMDAYRLLSQQIDNPLHLGVTEAGIYRTGTVKSAIALGGLLMEGIGDTMRISLA  240
            ASNVFLTMDAYRLLSQQIDNPLHLGVTEAGIYRTGTVKSAIALGGLLMEGIGDTMRISLA
Sbjct  181  ASNVFLTMDAYRLLSQQIDNPLHLGVTEAGIYRTGTVKSAIALGGLLMEGIGDTMRISLA  240

Query  241  AEPEDEVKIGFDILKSLGLRSNGINFIACPSCSRQEFNVIKVMQALEERLEDIRTPMDLS  300
            AEPEDE+KIGFDILKSLGLRSNGINFIACPSCSRQEFNVI+VMQALEERLED+RTPMD+S
Sbjct  241  AEPEDEIKIGFDILKSLGLRSNGINFIACPSCSRQEFNVIQVMQALEERLEDVRTPMDVS  300

Query  301  VIGCKVNGPGEAKEADIGIVGASPRSLVYRNGEKSHLIDTDQLVDEIEDMVRQRVKEIEE  360
            VIGCKVNGPGEAKEADIG+VGA+PRSLVYRNGEKSHLIDTDQLVDEIE MVRQRV+E+EE
Sbjct  301  VIGCKVNGPGEAKEADIGVVGAAPRSLVYRNGEKSHLIDTDQLVDEIETMVRQRVQELEE  360

Query  361  AKSKEIIRSSS  371
            AKSKEIIRSSS
Sbjct  361  AKSKEIIRSSS  371


> N9PRE8 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) 
[Acinetobacter sp. NIPH 2168]
Length=371

 Score =  699 bits (1803),  Expect = 0.0
 Identities = 357/371 (96%), Positives = 365/371 (98%), Gaps = 0/371 (0%)

Query  1    MIENPIKRRPTRKIRVGSVYVGGDAPISIQSMTNTETCDVDATVAQIQRCADAGVDIMRV  60
            MI NPIKRRPTRKIRVGSVYVGGDAPIS+QSMTNTETCDVDATVAQIQRCADAG DIMRV
Sbjct  1    MIVNPIKRRPTRKIRVGSVYVGGDAPISVQSMTNTETCDVDATVAQIQRCADAGADIMRV  60

Query  61   SVPSMEAAEAFGKIRQRVSVPLVADIHFDHRIALAVADYGADCLRINPGNIGSDQKVREV  120
            SVPSMEAAEAFG IR+RVSVPLVADIHFDHRIALAVADYGADCLRINPGNIGSDQKVREV
Sbjct  61   SVPSMEAAEAFGAIRKRVSVPLVADIHFDHRIALAVADYGADCLRINPGNIGSDQKVREV  120

Query  121  VAAARHHGISIRIGVNAGSLEKDLQKKYGEPTGAALLESAMRHIDILDRLDFHEFKVSVK  180
            VAAA+HHGISIRIGVNAGSLEKDLQ KYGEPTG ALLESAMRHIDILDRLDFHEFKVSVK
Sbjct  121  VAAAKHHGISIRIGVNAGSLEKDLQAKYGEPTGQALLESAMRHIDILDRLDFHEFKVSVK  180

Query  181  ASNVFLTMDAYRLLSQQIDNPLHLGVTEAGIYRTGTVKSAIALGGLLMEGIGDTMRISLA  240
            ASNVFLTMDAYRLLSQQIDNPLHLGVTEAGIYRTGTVKSAIALGGLLMEGIGDTMRISLA
Sbjct  181  ASNVFLTMDAYRLLSQQIDNPLHLGVTEAGIYRTGTVKSAIALGGLLMEGIGDTMRISLA  240

Query  241  AEPEDEVKIGFDILKSLGLRSNGINFIACPSCSRQEFNVIKVMQALEERLEDIRTPMDLS  300
            AEPEDE+KIGFDILKSLGLRSNGINFIACPSCSRQEFNVI+VMQALEERLEDIRTPMDLS
Sbjct  241  AEPEDEIKIGFDILKSLGLRSNGINFIACPSCSRQEFNVIQVMQALEERLEDIRTPMDLS  300

Query  301  VIGCKVNGPGEAKEADIGIVGASPRSLVYRNGEKSHLIDTDQLVDEIEDMVRQRVKEIEE  360
            VIGCKVNGPGEAKEADIGIVGASPRSLVYRNGEKSHLIDT+QLVDEIE MVRQRV+E+EE
Sbjct  301  VIGCKVNGPGEAKEADIGIVGASPRSLVYRNGEKSHLIDTNQLVDEIETMVRQRVQELEE  360

Query  361  AKSKEIIRSSS  371
            AKSKEIIRSSS
Sbjct  361  AKSKEIIRSSS  371


> A0A0B0KJ14 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
(flavodoxin) [Acinetobacter sp. neg1]
Length=371

 Score =  699 bits (1803),  Expect = 0.0
 Identities = 357/371 (96%), Positives = 365/371 (98%), Gaps = 0/371 (0%)

Query  1    MIENPIKRRPTRKIRVGSVYVGGDAPISIQSMTNTETCDVDATVAQIQRCADAGVDIMRV  60
            MI NPIKRRPTRKIRVGSVYVGGDAPIS+QSMTNTETCDVDATVAQIQRCADAG DIMRV
Sbjct  1    MIVNPIKRRPTRKIRVGSVYVGGDAPISVQSMTNTETCDVDATVAQIQRCADAGADIMRV  60

Query  61   SVPSMEAAEAFGKIRQRVSVPLVADIHFDHRIALAVADYGADCLRINPGNIGSDQKVREV  120
            SVPSMEAAEAFG IR+RVSVPLVADIHFDHRIALAVADYGADCLRINPGNIGSDQKVREV
Sbjct  61   SVPSMEAAEAFGAIRKRVSVPLVADIHFDHRIALAVADYGADCLRINPGNIGSDQKVREV  120

Query  121  VAAARHHGISIRIGVNAGSLEKDLQKKYGEPTGAALLESAMRHIDILDRLDFHEFKVSVK  180
            VAAA+HHGISIRIGVNAGSLEKDLQ KYGEPTG ALLESAMRHIDILDRLDFHEFKVSVK
Sbjct  121  VAAAKHHGISIRIGVNAGSLEKDLQAKYGEPTGQALLESAMRHIDILDRLDFHEFKVSVK  180

Query  181  ASNVFLTMDAYRLLSQQIDNPLHLGVTEAGIYRTGTVKSAIALGGLLMEGIGDTMRISLA  240
            ASNVFLTMDAYRLLSQQIDNPLHLGVTEAGIYRTGTVKSAIALGGLLMEGIGDTMRISLA
Sbjct  181  ASNVFLTMDAYRLLSQQIDNPLHLGVTEAGIYRTGTVKSAIALGGLLMEGIGDTMRISLA  240

Query  241  AEPEDEVKIGFDILKSLGLRSNGINFIACPSCSRQEFNVIKVMQALEERLEDIRTPMDLS  300
            AEPEDE+KIGFDILKSLGLRSNGINFIACPSCSRQEFNVI+VMQALEERLEDIRTPMDLS
Sbjct  241  AEPEDEIKIGFDILKSLGLRSNGINFIACPSCSRQEFNVIQVMQALEERLEDIRTPMDLS  300

Query  301  VIGCKVNGPGEAKEADIGIVGASPRSLVYRNGEKSHLIDTDQLVDEIEDMVRQRVKEIEE  360
            VIGCKVNGPGEAKEADIGIVGASPRSLVYRNGEKSHLIDT+QLVDEIE MVRQRV+E+EE
Sbjct  301  VIGCKVNGPGEAKEADIGIVGASPRSLVYRNGEKSHLIDTNQLVDEIETMVRQRVQELEE  360

Query  361  AKSKEIIRSSS  371
            AKSKEIIRSSS
Sbjct  361  AKSKEIIRSSS  371


> N9RB37 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) 
[Acinetobacter sp. NIPH 3623]
Length=371

 Score =  699 bits (1803),  Expect = 0.0
 Identities = 357/371 (96%), Positives = 365/371 (98%), Gaps = 0/371 (0%)

Query  1    MIENPIKRRPTRKIRVGSVYVGGDAPISIQSMTNTETCDVDATVAQIQRCADAGVDIMRV  60
            MI NPIKRRPTRKIRVGSVYVGGDAPIS+QSMTNTETCDVDATVAQIQRCADAG DIMRV
Sbjct  1    MIVNPIKRRPTRKIRVGSVYVGGDAPISVQSMTNTETCDVDATVAQIQRCADAGADIMRV  60

Query  61   SVPSMEAAEAFGKIRQRVSVPLVADIHFDHRIALAVADYGADCLRINPGNIGSDQKVREV  120
            SVPSMEAAEAFG IR+RVSVPLVADIHFDHRIALAVADYGADCLRINPGNIGSDQKVREV
Sbjct  61   SVPSMEAAEAFGAIRKRVSVPLVADIHFDHRIALAVADYGADCLRINPGNIGSDQKVREV  120

Query  121  VAAARHHGISIRIGVNAGSLEKDLQKKYGEPTGAALLESAMRHIDILDRLDFHEFKVSVK  180
            VAAA+HHGISIRIGVNAGSLEKDLQ KYGEPTG ALLESAMRHIDILDRLDFHEFKVSVK
Sbjct  121  VAAAKHHGISIRIGVNAGSLEKDLQAKYGEPTGQALLESAMRHIDILDRLDFHEFKVSVK  180

Query  181  ASNVFLTMDAYRLLSQQIDNPLHLGVTEAGIYRTGTVKSAIALGGLLMEGIGDTMRISLA  240
            ASNVFLTMDAYRLLSQQIDNPLHLGVTEAGIYRTGTVKSAIALGGLLMEGIGDTMRISLA
Sbjct  181  ASNVFLTMDAYRLLSQQIDNPLHLGVTEAGIYRTGTVKSAIALGGLLMEGIGDTMRISLA  240

Query  241  AEPEDEVKIGFDILKSLGLRSNGINFIACPSCSRQEFNVIKVMQALEERLEDIRTPMDLS  300
            AEPEDE+KIGFDILKSLGLRSNGINFIACPSCSRQEFNVI+VMQALEERLEDIRTPMDLS
Sbjct  241  AEPEDEIKIGFDILKSLGLRSNGINFIACPSCSRQEFNVIQVMQALEERLEDIRTPMDLS  300

Query  301  VIGCKVNGPGEAKEADIGIVGASPRSLVYRNGEKSHLIDTDQLVDEIEDMVRQRVKEIEE  360
            VIGCKVNGPGEAKEADIGIVGASPRSLVYRNGEKSHLIDT+QLVDEIE MVRQRV+E+EE
Sbjct  301  VIGCKVNGPGEAKEADIGIVGASPRSLVYRNGEKSHLIDTNQLVDEIETMVRQRVQELEE  360

Query  361  AKSKEIIRSSS  371
            AKSKEIIRSSS
Sbjct  361  AKSKEIIRSSS  371


> N8W9S3 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) 
[Acinetobacter sp. NIPH 758]
Length=371

 Score =  698 bits (1802),  Expect = 0.0
 Identities = 356/371 (96%), Positives = 365/371 (98%), Gaps = 0/371 (0%)

Query  1    MIENPIKRRPTRKIRVGSVYVGGDAPISIQSMTNTETCDVDATVAQIQRCADAGVDIMRV  60
            MI NPIKRRPTRKIRVGSVYVGGDAPIS+QSMTNTETCDVDATVAQIQRCADAG DIMRV
Sbjct  1    MIVNPIKRRPTRKIRVGSVYVGGDAPISVQSMTNTETCDVDATVAQIQRCADAGADIMRV  60

Query  61   SVPSMEAAEAFGKIRQRVSVPLVADIHFDHRIALAVADYGADCLRINPGNIGSDQKVREV  120
            SVPSMEAAEAFG IR+RVSVPLVADIHFDHRIALAVADYGADCLRINPGNIGSDQKVREV
Sbjct  61   SVPSMEAAEAFGAIRKRVSVPLVADIHFDHRIALAVADYGADCLRINPGNIGSDQKVREV  120

Query  121  VAAARHHGISIRIGVNAGSLEKDLQKKYGEPTGAALLESAMRHIDILDRLDFHEFKVSVK  180
            VAAA+HHGISIRIGVNAGSLEKDLQ KYGEPTG ALLESAMRHIDILDRLDFHEFKVSVK
Sbjct  121  VAAAKHHGISIRIGVNAGSLEKDLQAKYGEPTGQALLESAMRHIDILDRLDFHEFKVSVK  180

Query  181  ASNVFLTMDAYRLLSQQIDNPLHLGVTEAGIYRTGTVKSAIALGGLLMEGIGDTMRISLA  240
            ASNVFLTMDAYRLLSQQIDNPLHLGVTEAGIYRTGTVKSAIALGGLLMEGIGDTMRISLA
Sbjct  181  ASNVFLTMDAYRLLSQQIDNPLHLGVTEAGIYRTGTVKSAIALGGLLMEGIGDTMRISLA  240

Query  241  AEPEDEVKIGFDILKSLGLRSNGINFIACPSCSRQEFNVIKVMQALEERLEDIRTPMDLS  300
            AEPEDE+KIGFDILKSLGLRSNGINFIACPSCSRQEFNVI+VMQALEERLED+RTPMDLS
Sbjct  241  AEPEDEIKIGFDILKSLGLRSNGINFIACPSCSRQEFNVIQVMQALEERLEDVRTPMDLS  300

Query  301  VIGCKVNGPGEAKEADIGIVGASPRSLVYRNGEKSHLIDTDQLVDEIEDMVRQRVKEIEE  360
            VIGCKVNGPGEAKEADIGIVGASPRSLVYRNGEKSHLIDT+QLVDEIE MVRQRV+E+EE
Sbjct  301  VIGCKVNGPGEAKEADIGIVGASPRSLVYRNGEKSHLIDTNQLVDEIETMVRQRVQELEE  360

Query  361  AKSKEIIRSSS  371
            AKSKEIIRSSS
Sbjct  361  AKSKEIIRSSS  371


> N8QR85 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) 
[Acinetobacter sp. NIPH 236]
Length=371

 Score =  698 bits (1802),  Expect = 0.0
 Identities = 357/371 (96%), Positives = 365/371 (98%), Gaps = 0/371 (0%)

Query  1    MIENPIKRRPTRKIRVGSVYVGGDAPISIQSMTNTETCDVDATVAQIQRCADAGVDIMRV  60
            MI NPIKRRPTRKIRVGSVYVGGDAPIS+QSMTNTETCDVDATVAQIQRCADAG DIMRV
Sbjct  1    MIVNPIKRRPTRKIRVGSVYVGGDAPISVQSMTNTETCDVDATVAQIQRCADAGADIMRV  60

Query  61   SVPSMEAAEAFGKIRQRVSVPLVADIHFDHRIALAVADYGADCLRINPGNIGSDQKVREV  120
            SVPSMEAAEAFG IR+RVSVPLVADIHFDHRIALAVADYGADCLRINPGNIGSDQKVREV
Sbjct  61   SVPSMEAAEAFGAIRKRVSVPLVADIHFDHRIALAVADYGADCLRINPGNIGSDQKVREV  120

Query  121  VAAARHHGISIRIGVNAGSLEKDLQKKYGEPTGAALLESAMRHIDILDRLDFHEFKVSVK  180
            VAAA+HHGISIRIGVNAGSLEKDLQ KYGEPTG ALLESAMRHIDILDRLDFHEFKVSVK
Sbjct  121  VAAAKHHGISIRIGVNAGSLEKDLQVKYGEPTGQALLESAMRHIDILDRLDFHEFKVSVK  180

Query  181  ASNVFLTMDAYRLLSQQIDNPLHLGVTEAGIYRTGTVKSAIALGGLLMEGIGDTMRISLA  240
            ASNVFLTMDAYRLLSQQIDNPLHLGVTEAGIYRTGTVKSAIALGGLLMEGIGDTMRISLA
Sbjct  181  ASNVFLTMDAYRLLSQQIDNPLHLGVTEAGIYRTGTVKSAIALGGLLMEGIGDTMRISLA  240

Query  241  AEPEDEVKIGFDILKSLGLRSNGINFIACPSCSRQEFNVIKVMQALEERLEDIRTPMDLS  300
            AEPEDE+KIGFDILKSLGLRSNGINFIACPSCSRQEFNVI+VMQALEERLEDIRTPMDLS
Sbjct  241  AEPEDEIKIGFDILKSLGLRSNGINFIACPSCSRQEFNVIQVMQALEERLEDIRTPMDLS  300

Query  301  VIGCKVNGPGEAKEADIGIVGASPRSLVYRNGEKSHLIDTDQLVDEIEDMVRQRVKEIEE  360
            VIGCKVNGPGEAKEADIGIVGASPRSLVYRNGEKSHLIDT+QLVDEIE MVRQRV+E+EE
Sbjct  301  VIGCKVNGPGEAKEADIGIVGASPRSLVYRNGEKSHLIDTNQLVDEIETMVRQRVQELEE  360

Query  361  AKSKEIIRSSS  371
            AKSKEIIRSSS
Sbjct  361  AKSKEIIRSSS  371


> A0A1Q3NQ29 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
(flavodoxin) [Acinetobacter sp. 38-8]
Length=371

 Score =  698 bits (1802),  Expect = 0.0
 Identities = 357/371 (96%), Positives = 365/371 (98%), Gaps = 0/371 (0%)

Query  1    MIENPIKRRPTRKIRVGSVYVGGDAPISIQSMTNTETCDVDATVAQIQRCADAGVDIMRV  60
            MI NPIKRRPTRKIRVGSVYVGGDAPIS+QSMTNTETCDVDATVAQIQRCADAG DIMRV
Sbjct  1    MIVNPIKRRPTRKIRVGSVYVGGDAPISVQSMTNTETCDVDATVAQIQRCADAGADIMRV  60

Query  61   SVPSMEAAEAFGKIRQRVSVPLVADIHFDHRIALAVADYGADCLRINPGNIGSDQKVREV  120
            SVPSMEAAEAFG IR+RVSVPLVADIHFDHRIALAVADYGADCLRINPGNIGSDQKVREV
Sbjct  61   SVPSMEAAEAFGAIRKRVSVPLVADIHFDHRIALAVADYGADCLRINPGNIGSDQKVREV  120

Query  121  VAAARHHGISIRIGVNAGSLEKDLQKKYGEPTGAALLESAMRHIDILDRLDFHEFKVSVK  180
            VAAA+HHGISIRIGVNAGSLEKDLQ KYGEPTG ALLESAMRHIDILDRLDFHEFKVSVK
Sbjct  121  VAAAKHHGISIRIGVNAGSLEKDLQVKYGEPTGQALLESAMRHIDILDRLDFHEFKVSVK  180

Query  181  ASNVFLTMDAYRLLSQQIDNPLHLGVTEAGIYRTGTVKSAIALGGLLMEGIGDTMRISLA  240
            ASNVFLTMDAYRLLSQQIDNPLHLGVTEAGIYRTGTVKSAIALGGLLMEGIGDTMRISLA
Sbjct  181  ASNVFLTMDAYRLLSQQIDNPLHLGVTEAGIYRTGTVKSAIALGGLLMEGIGDTMRISLA  240

Query  241  AEPEDEVKIGFDILKSLGLRSNGINFIACPSCSRQEFNVIKVMQALEERLEDIRTPMDLS  300
            AEPEDE+KIGFDILKSLGLRSNGINFIACPSCSRQEFNVI+VMQALEERLEDIRTPMDLS
Sbjct  241  AEPEDEIKIGFDILKSLGLRSNGINFIACPSCSRQEFNVIQVMQALEERLEDIRTPMDLS  300

Query  301  VIGCKVNGPGEAKEADIGIVGASPRSLVYRNGEKSHLIDTDQLVDEIEDMVRQRVKEIEE  360
            VIGCKVNGPGEAKEADIGIVGASPRSLVYRNGEKSHLIDT+QLVDEIE MVRQRV+E+EE
Sbjct  301  VIGCKVNGPGEAKEADIGIVGASPRSLVYRNGEKSHLIDTNQLVDEIETMVRQRVQELEE  360

Query  361  AKSKEIIRSSS  371
            AKSKEIIRSSS
Sbjct  361  AKSKEIIRSSS  371


> A0A0M2ZVA4 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
(flavodoxin) [Acinetobacter sp. AG1]
Length=371

 Score =  698 bits (1802),  Expect = 0.0
 Identities = 357/371 (96%), Positives = 365/371 (98%), Gaps = 0/371 (0%)

Query  1    MIENPIKRRPTRKIRVGSVYVGGDAPISIQSMTNTETCDVDATVAQIQRCADAGVDIMRV  60
            MI NPIKRRPTRKIRVGSVYVGGDAPIS+QSMTNTETCDVDATVAQIQRCADAG DIMRV
Sbjct  1    MIVNPIKRRPTRKIRVGSVYVGGDAPISVQSMTNTETCDVDATVAQIQRCADAGADIMRV  60

Query  61   SVPSMEAAEAFGKIRQRVSVPLVADIHFDHRIALAVADYGADCLRINPGNIGSDQKVREV  120
            SVPSMEAAEAFG IR+RVSVPLVADIHFDHRIALAVADYGADCLRINPGNIGSDQKVREV
Sbjct  61   SVPSMEAAEAFGAIRKRVSVPLVADIHFDHRIALAVADYGADCLRINPGNIGSDQKVREV  120

Query  121  VAAARHHGISIRIGVNAGSLEKDLQKKYGEPTGAALLESAMRHIDILDRLDFHEFKVSVK  180
            VAAA+HHGISIRIGVNAGSLEKDLQ KYGEPTG ALLESAMRHIDILDRLDFHEFKVSVK
Sbjct  121  VAAAKHHGISIRIGVNAGSLEKDLQVKYGEPTGQALLESAMRHIDILDRLDFHEFKVSVK  180

Query  181  ASNVFLTMDAYRLLSQQIDNPLHLGVTEAGIYRTGTVKSAIALGGLLMEGIGDTMRISLA  240
            ASNVFLTMDAYRLLSQQIDNPLHLGVTEAGIYRTGTVKSAIALGGLLMEGIGDTMRISLA
Sbjct  181  ASNVFLTMDAYRLLSQQIDNPLHLGVTEAGIYRTGTVKSAIALGGLLMEGIGDTMRISLA  240

Query  241  AEPEDEVKIGFDILKSLGLRSNGINFIACPSCSRQEFNVIKVMQALEERLEDIRTPMDLS  300
            AEPEDE+KIGFDILKSLGLRSNGINFIACPSCSRQEFNVI+VMQALEERLEDIRTPMDLS
Sbjct  241  AEPEDEIKIGFDILKSLGLRSNGINFIACPSCSRQEFNVIQVMQALEERLEDIRTPMDLS  300

Query  301  VIGCKVNGPGEAKEADIGIVGASPRSLVYRNGEKSHLIDTDQLVDEIEDMVRQRVKEIEE  360
            VIGCKVNGPGEAKEADIGIVGASPRSLVYRNGEKSHLIDT+QLVDEIE MVRQRV+E+EE
Sbjct  301  VIGCKVNGPGEAKEADIGIVGASPRSLVYRNGEKSHLIDTNQLVDEIETMVRQRVQELEE  360

Query  361  AKSKEIIRSSS  371
            AKSKEIIRSSS
Sbjct  361  AKSKEIIRSSS  371


> N9K8J3 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) 
[Acinetobacter sp. NIPH 284]
Length=371

 Score =  698 bits (1802),  Expect = 0.0
 Identities = 357/371 (96%), Positives = 365/371 (98%), Gaps = 0/371 (0%)

Query  1    MIENPIKRRPTRKIRVGSVYVGGDAPISIQSMTNTETCDVDATVAQIQRCADAGVDIMRV  60
            MI NPIKRRPTRKIRVGSVYVGGDAPIS+QSMTNTETCDVDATVAQIQRCADAG DIMRV
Sbjct  1    MIVNPIKRRPTRKIRVGSVYVGGDAPISVQSMTNTETCDVDATVAQIQRCADAGADIMRV  60

Query  61   SVPSMEAAEAFGKIRQRVSVPLVADIHFDHRIALAVADYGADCLRINPGNIGSDQKVREV  120
            SVPSMEAAEAFG IR+RVSVPLVADIHFDHRIALAVADYGADCLRINPGNIGSDQKVREV
Sbjct  61   SVPSMEAAEAFGAIRKRVSVPLVADIHFDHRIALAVADYGADCLRINPGNIGSDQKVREV  120

Query  121  VAAARHHGISIRIGVNAGSLEKDLQKKYGEPTGAALLESAMRHIDILDRLDFHEFKVSVK  180
            VAAA+HHGISIRIGVNAGSLEKDLQ KYGEPTG ALLESAMRHIDILDRLDFHEFKVSVK
Sbjct  121  VAAAKHHGISIRIGVNAGSLEKDLQVKYGEPTGQALLESAMRHIDILDRLDFHEFKVSVK  180

Query  181  ASNVFLTMDAYRLLSQQIDNPLHLGVTEAGIYRTGTVKSAIALGGLLMEGIGDTMRISLA  240
            ASNVFLTMDAYRLLSQQIDNPLHLGVTEAGIYRTGTVKSAIALGGLLMEGIGDTMRISLA
Sbjct  181  ASNVFLTMDAYRLLSQQIDNPLHLGVTEAGIYRTGTVKSAIALGGLLMEGIGDTMRISLA  240

Query  241  AEPEDEVKIGFDILKSLGLRSNGINFIACPSCSRQEFNVIKVMQALEERLEDIRTPMDLS  300
            AEPEDE+KIGFDILKSLGLRSNGINFIACPSCSRQEFNVI+VMQALEERLEDIRTPMDLS
Sbjct  241  AEPEDEIKIGFDILKSLGLRSNGINFIACPSCSRQEFNVIQVMQALEERLEDIRTPMDLS  300

Query  301  VIGCKVNGPGEAKEADIGIVGASPRSLVYRNGEKSHLIDTDQLVDEIEDMVRQRVKEIEE  360
            VIGCKVNGPGEAKEADIGIVGASPRSLVYRNGEKSHLIDT+QLVDEIE MVRQRV+E+EE
Sbjct  301  VIGCKVNGPGEAKEADIGIVGASPRSLVYRNGEKSHLIDTNQLVDEIETMVRQRVQELEE  360

Query  361  AKSKEIIRSSS  371
            AKSKEIIRSSS
Sbjct  361  AKSKEIIRSSS  371


> N9M6X5 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) 
[Acinetobacter sp. ANC 3862]
Length=371

 Score =  698 bits (1802),  Expect = 0.0
 Identities = 357/371 (96%), Positives = 365/371 (98%), Gaps = 0/371 (0%)

Query  1    MIENPIKRRPTRKIRVGSVYVGGDAPISIQSMTNTETCDVDATVAQIQRCADAGVDIMRV  60
            MI NPIKRRPTRKIRVGSVYVGGDAPIS+QSMTNTETCDVDATVAQIQRCADAG DIMRV
Sbjct  1    MIVNPIKRRPTRKIRVGSVYVGGDAPISVQSMTNTETCDVDATVAQIQRCADAGADIMRV  60

Query  61   SVPSMEAAEAFGKIRQRVSVPLVADIHFDHRIALAVADYGADCLRINPGNIGSDQKVREV  120
            SVPSMEAAEAFG IR+RVSVPLVADIHFDHRIALAVADYGADCLRINPGNIGSDQKVREV
Sbjct  61   SVPSMEAAEAFGAIRKRVSVPLVADIHFDHRIALAVADYGADCLRINPGNIGSDQKVREV  120

Query  121  VAAARHHGISIRIGVNAGSLEKDLQKKYGEPTGAALLESAMRHIDILDRLDFHEFKVSVK  180
            VAAA+HHGISIRIGVNAGSLEKDLQ KYGEPTG ALLESAMRHIDILDRLDFHEFKVSVK
Sbjct  121  VAAAKHHGISIRIGVNAGSLEKDLQVKYGEPTGQALLESAMRHIDILDRLDFHEFKVSVK  180

Query  181  ASNVFLTMDAYRLLSQQIDNPLHLGVTEAGIYRTGTVKSAIALGGLLMEGIGDTMRISLA  240
            ASNVFLTMDAYRLLSQQIDNPLHLGVTEAGIYRTGTVKSAIALGGLLMEGIGDTMRISLA
Sbjct  181  ASNVFLTMDAYRLLSQQIDNPLHLGVTEAGIYRTGTVKSAIALGGLLMEGIGDTMRISLA  240

Query  241  AEPEDEVKIGFDILKSLGLRSNGINFIACPSCSRQEFNVIKVMQALEERLEDIRTPMDLS  300
            AEPEDE+KIGFDILKSLGLRSNGINFIACPSCSRQEFNVI+VMQALEERLEDIRTPMDLS
Sbjct  241  AEPEDEIKIGFDILKSLGLRSNGINFIACPSCSRQEFNVIQVMQALEERLEDIRTPMDLS  300

Query  301  VIGCKVNGPGEAKEADIGIVGASPRSLVYRNGEKSHLIDTDQLVDEIEDMVRQRVKEIEE  360
            VIGCKVNGPGEAKEADIGIVGASPRSLVYRNGEKSHLIDT+QLVDEIE MVRQRV+E+EE
Sbjct  301  VIGCKVNGPGEAKEADIGIVGASPRSLVYRNGEKSHLIDTNQLVDEIETMVRQRVQELEE  360

Query  361  AKSKEIIRSSS  371
            AKSKEIIRSSS
Sbjct  361  AKSKEIIRSSS  371


> N9MU58 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) 
[Acinetobacter sp. CIP 64.2]
Length=371

 Score =  697 bits (1800),  Expect = 0.0
 Identities = 356/371 (96%), Positives = 366/371 (99%), Gaps = 0/371 (0%)

Query  1    MIENPIKRRPTRKIRVGSVYVGGDAPISIQSMTNTETCDVDATVAQIQRCADAGVDIMRV  60
            MI NPIKRRPTRKIRVGSVYVGGDAPIS+QSMTNTETCDV+ATVAQIQRCADAG DIMRV
Sbjct  1    MIVNPIKRRPTRKIRVGSVYVGGDAPISVQSMTNTETCDVEATVAQIQRCADAGADIMRV  60

Query  61   SVPSMEAAEAFGKIRQRVSVPLVADIHFDHRIALAVADYGADCLRINPGNIGSDQKVREV  120
            SVPSMEAAEAFG+IR+RVSVPLVADIHFDHRIALAVADYGADCLRINPGNIGSDQKVREV
Sbjct  61   SVPSMEAAEAFGEIRKRVSVPLVADIHFDHRIALAVADYGADCLRINPGNIGSDQKVREV  120

Query  121  VAAARHHGISIRIGVNAGSLEKDLQKKYGEPTGAALLESAMRHIDILDRLDFHEFKVSVK  180
            VAAA+HHGISIRIGVNAGSLEKDLQ KYGEPTG ALLESAMRHIDILDRLDFHEFKVSVK
Sbjct  121  VAAAKHHGISIRIGVNAGSLEKDLQVKYGEPTGQALLESAMRHIDILDRLDFHEFKVSVK  180

Query  181  ASNVFLTMDAYRLLSQQIDNPLHLGVTEAGIYRTGTVKSAIALGGLLMEGIGDTMRISLA  240
            ASNVFLTMDAYRLLSQQIDNPLHLGVTEAGIYRTGTVKSAIALGGLLMEGIGDTMRISLA
Sbjct  181  ASNVFLTMDAYRLLSQQIDNPLHLGVTEAGIYRTGTVKSAIALGGLLMEGIGDTMRISLA  240

Query  241  AEPEDEVKIGFDILKSLGLRSNGINFIACPSCSRQEFNVIKVMQALEERLEDIRTPMDLS  300
            AEPEDE+KIGFDILKSLGLRSNGINFIACPSCSRQEFNVI+VMQALEERLEDIRTPMDLS
Sbjct  241  AEPEDEIKIGFDILKSLGLRSNGINFIACPSCSRQEFNVIQVMQALEERLEDIRTPMDLS  300

Query  301  VIGCKVNGPGEAKEADIGIVGASPRSLVYRNGEKSHLIDTDQLVDEIEDMVRQRVKEIEE  360
            VIGCKVNGPGEAKEADIGIVGASPRSLVYRNGEKSHLIDT+QLVDEIE MVRQRV+E+EE
Sbjct  301  VIGCKVNGPGEAKEADIGIVGASPRSLVYRNGEKSHLIDTNQLVDEIETMVRQRVQELEE  360

Query  361  AKSKEIIRSSS  371
            AKSKEIIRSSS
Sbjct  361  AKSKEIIRSSS  371


> A0A009L3D9 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
(flavodoxin) [Acinetobacter baumannii 146457]
Length=371

 Score =  697 bits (1800),  Expect = 0.0
 Identities = 356/371 (96%), Positives = 365/371 (98%), Gaps = 0/371 (0%)

Query  1    MIENPIKRRPTRKIRVGSVYVGGDAPISIQSMTNTETCDVDATVAQIQRCADAGVDIMRV  60
            MI NPIKRRPTRKIRVGSVYVGGDAPIS+QSMTNTETCDVDATVAQIQRCADAG DIMRV
Sbjct  1    MIVNPIKRRPTRKIRVGSVYVGGDAPISVQSMTNTETCDVDATVAQIQRCADAGADIMRV  60

Query  61   SVPSMEAAEAFGKIRQRVSVPLVADIHFDHRIALAVADYGADCLRINPGNIGSDQKVREV  120
            SVPSMEAAEAFG IR+RV+VPLVADIHFDHRIALAVADYGADCLRINPGNIGSDQKVREV
Sbjct  61   SVPSMEAAEAFGAIRKRVTVPLVADIHFDHRIALAVADYGADCLRINPGNIGSDQKVREV  120

Query  121  VAAARHHGISIRIGVNAGSLEKDLQKKYGEPTGAALLESAMRHIDILDRLDFHEFKVSVK  180
            VAAA+HHGISIRIGVNAGSLEKDLQ KYGEPTG ALLESAMRHIDILDRLDFHEFKVSVK
Sbjct  121  VAAAKHHGISIRIGVNAGSLEKDLQAKYGEPTGQALLESAMRHIDILDRLDFHEFKVSVK  180

Query  181  ASNVFLTMDAYRLLSQQIDNPLHLGVTEAGIYRTGTVKSAIALGGLLMEGIGDTMRISLA  240
            ASNVFLTMDAYRLLSQQIDNPLHLGVTEAGIYRTGTVKSAIALGGLLMEGIGDTMRISLA
Sbjct  181  ASNVFLTMDAYRLLSQQIDNPLHLGVTEAGIYRTGTVKSAIALGGLLMEGIGDTMRISLA  240

Query  241  AEPEDEVKIGFDILKSLGLRSNGINFIACPSCSRQEFNVIKVMQALEERLEDIRTPMDLS  300
            AEPEDE+KIGFDILKSLGLRSNGINFIACPSCSRQEFNVI+VMQALEERLEDIRTPMDLS
Sbjct  241  AEPEDEIKIGFDILKSLGLRSNGINFIACPSCSRQEFNVIQVMQALEERLEDIRTPMDLS  300

Query  301  VIGCKVNGPGEAKEADIGIVGASPRSLVYRNGEKSHLIDTDQLVDEIEDMVRQRVKEIEE  360
            VIGCKVNGPGEAKEADIGIVGASPRSLVYRNGEKSHLIDT+QLVDEIE MVRQRV+E+EE
Sbjct  301  VIGCKVNGPGEAKEADIGIVGASPRSLVYRNGEKSHLIDTNQLVDEIETMVRQRVQELEE  360

Query  361  AKSKEIIRSSS  371
            AKSKEIIRSSS
Sbjct  361  AKSKEIIRSSS  371


> N9RDT6 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) 
[Acinetobacter colistiniresistens]
Length=371

 Score =  697 bits (1800),  Expect = 0.0
 Identities = 356/371 (96%), Positives = 366/371 (99%), Gaps = 0/371 (0%)

Query  1    MIENPIKRRPTRKIRVGSVYVGGDAPISIQSMTNTETCDVDATVAQIQRCADAGVDIMRV  60
            MI NPIKRRPTRKIRVGSVYVGGDAPIS+QSMTNTETCDV+ATVAQIQRCADAG DIMRV
Sbjct  1    MIVNPIKRRPTRKIRVGSVYVGGDAPISVQSMTNTETCDVEATVAQIQRCADAGADIMRV  60

Query  61   SVPSMEAAEAFGKIRQRVSVPLVADIHFDHRIALAVADYGADCLRINPGNIGSDQKVREV  120
            SVPSMEAAEAFG+IR+RVSVPLVADIHFDHRIALAVADYGADCLRINPGNIGSDQKVREV
Sbjct  61   SVPSMEAAEAFGEIRKRVSVPLVADIHFDHRIALAVADYGADCLRINPGNIGSDQKVREV  120

Query  121  VAAARHHGISIRIGVNAGSLEKDLQKKYGEPTGAALLESAMRHIDILDRLDFHEFKVSVK  180
            VAAA+HHGISIRIGVNAGSLEKDLQ KYGEPTG ALLESAMRHIDILDRLDFHEFKVSVK
Sbjct  121  VAAAKHHGISIRIGVNAGSLEKDLQVKYGEPTGQALLESAMRHIDILDRLDFHEFKVSVK  180

Query  181  ASNVFLTMDAYRLLSQQIDNPLHLGVTEAGIYRTGTVKSAIALGGLLMEGIGDTMRISLA  240
            ASNVFLTMDAYRLLSQQIDNPLHLGVTEAGIYRTGTVKSAIALGGLLMEGIGDTMRISLA
Sbjct  181  ASNVFLTMDAYRLLSQQIDNPLHLGVTEAGIYRTGTVKSAIALGGLLMEGIGDTMRISLA  240

Query  241  AEPEDEVKIGFDILKSLGLRSNGINFIACPSCSRQEFNVIKVMQALEERLEDIRTPMDLS  300
            AEPEDE+KIGFDILKSLGLRSNGINFIACPSCSRQEFNVI+VMQALEERLEDIRTPMDLS
Sbjct  241  AEPEDEIKIGFDILKSLGLRSNGINFIACPSCSRQEFNVIQVMQALEERLEDIRTPMDLS  300

Query  301  VIGCKVNGPGEAKEADIGIVGASPRSLVYRNGEKSHLIDTDQLVDEIEDMVRQRVKEIEE  360
            VIGCKVNGPGEAKEADIGIVGASPRSLVYRNGEKSHLIDT+QLVDEIE MVRQRV+E+EE
Sbjct  301  VIGCKVNGPGEAKEADIGIVGASPRSLVYRNGEKSHLIDTNQLVDEIETMVRQRVQELEE  360

Query  361  AKSKEIIRSSS  371
            AKSKEIIRSSS
Sbjct  361  AKSKEIIRSSS  371


> A0A022IBY6 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
(flavodoxin) [Acinetobacter sp. 1000160]
Length=371

 Score =  697 bits (1800),  Expect = 0.0
 Identities = 356/371 (96%), Positives = 365/371 (98%), Gaps = 0/371 (0%)

Query  1    MIENPIKRRPTRKIRVGSVYVGGDAPISIQSMTNTETCDVDATVAQIQRCADAGVDIMRV  60
            MI NPIKRRPTRKIRVGSVYVGGDAPIS+QSMTNTETCDVDATVAQIQRCADAG DIMRV
Sbjct  1    MIVNPIKRRPTRKIRVGSVYVGGDAPISVQSMTNTETCDVDATVAQIQRCADAGADIMRV  60

Query  61   SVPSMEAAEAFGKIRQRVSVPLVADIHFDHRIALAVADYGADCLRINPGNIGSDQKVREV  120
            SVPSMEAAEAFG IR+RV+VPLVADIHFDHRIALAVADYGADCLRINPGNIGSDQKVREV
Sbjct  61   SVPSMEAAEAFGAIRKRVTVPLVADIHFDHRIALAVADYGADCLRINPGNIGSDQKVREV  120

Query  121  VAAARHHGISIRIGVNAGSLEKDLQKKYGEPTGAALLESAMRHIDILDRLDFHEFKVSVK  180
            VAAA+HHGISIRIGVNAGSLEKDLQ KYGEPTG ALLESAMRHIDILDRLDFHEFKVSVK
Sbjct  121  VAAAKHHGISIRIGVNAGSLEKDLQAKYGEPTGQALLESAMRHIDILDRLDFHEFKVSVK  180

Query  181  ASNVFLTMDAYRLLSQQIDNPLHLGVTEAGIYRTGTVKSAIALGGLLMEGIGDTMRISLA  240
            ASNVFLTMDAYRLLSQQIDNPLHLGVTEAGIYRTGTVKSAIALGGLLMEGIGDTMRISLA
Sbjct  181  ASNVFLTMDAYRLLSQQIDNPLHLGVTEAGIYRTGTVKSAIALGGLLMEGIGDTMRISLA  240

Query  241  AEPEDEVKIGFDILKSLGLRSNGINFIACPSCSRQEFNVIKVMQALEERLEDIRTPMDLS  300
            AEPEDE+KIGFDILKSLGLRSNGINFIACPSCSRQEFNVI+VMQALEERLEDIRTPMDLS
Sbjct  241  AEPEDEIKIGFDILKSLGLRSNGINFIACPSCSRQEFNVIQVMQALEERLEDIRTPMDLS  300

Query  301  VIGCKVNGPGEAKEADIGIVGASPRSLVYRNGEKSHLIDTDQLVDEIEDMVRQRVKEIEE  360
            VIGCKVNGPGEAKEADIGIVGASPRSLVYRNGEKSHLIDT+QLVDEIE MVRQRV+E+EE
Sbjct  301  VIGCKVNGPGEAKEADIGIVGASPRSLVYRNGEKSHLIDTNQLVDEIETMVRQRVQELEE  360

Query  361  AKSKEIIRSSS  371
            AKSKEIIRSSS
Sbjct  361  AKSKEIIRSSS  371


> N9QW94 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) 
[Acinetobacter ursingii NIPH 706]
Length=372

 Score =  697 bits (1798),  Expect = 0.0
 Identities = 354/370 (96%), Positives = 363/370 (98%), Gaps = 0/370 (0%)

Query  1    MIENPIKRRPTRKIRVGSVYVGGDAPISIQSMTNTETCDVDATVAQIQRCADAGVDIMRV  60
            MIENPIKRRPTRKIRVGSVYVGGDAPIS+QSMTNTETCDVDATVAQIQRCADAG DIMRV
Sbjct  1    MIENPIKRRPTRKIRVGSVYVGGDAPISVQSMTNTETCDVDATVAQIQRCADAGADIMRV  60

Query  61   SVPSMEAAEAFGKIRQRVSVPLVADIHFDHRIALAVADYGADCLRINPGNIGSDQKVREV  120
            SVPSMEAAEAFG IR+RV+VPLVADIHFDHRIALAVADYGADCLRINPGNIGSDQKVREV
Sbjct  61   SVPSMEAAEAFGAIRKRVTVPLVADIHFDHRIALAVADYGADCLRINPGNIGSDQKVREV  120

Query  121  VAAARHHGISIRIGVNAGSLEKDLQKKYGEPTGAALLESAMRHIDILDRLDFHEFKVSVK  180
            VAAARHHGISIRIGVNAGSLEKDLQKKYGEPTG ALLESA+RHIDILDRLDFHEFKVSVK
Sbjct  121  VAAARHHGISIRIGVNAGSLEKDLQKKYGEPTGQALLESALRHIDILDRLDFHEFKVSVK  180

Query  181  ASNVFLTMDAYRLLSQQIDNPLHLGVTEAGIYRTGTVKSAIALGGLLMEGIGDTMRISLA  240
            ASNVFLTMDAYRLLSQQIDNPLHLGVTEAGIYRTGTVKSAIALGGLLMEGIGDTMRISLA
Sbjct  181  ASNVFLTMDAYRLLSQQIDNPLHLGVTEAGIYRTGTVKSAIALGGLLMEGIGDTMRISLA  240

Query  241  AEPEDEVKIGFDILKSLGLRSNGINFIACPSCSRQEFNVIKVMQALEERLEDIRTPMDLS  300
            AEPEDE+KIGFDILKSLGLRSNGINFIACPSCSRQEFNVIKVMQ LEERLEDIRTPMD+S
Sbjct  241  AEPEDEIKIGFDILKSLGLRSNGINFIACPSCSRQEFNVIKVMQMLEERLEDIRTPMDVS  300

Query  301  VIGCKVNGPGEAKEADIGIVGASPRSLVYRNGEKSHLIDTDQLVDEIEDMVRQRVKEIEE  360
            VIGCKVNGPGEAKEADIG+VGASPRSLVYRNGEKSHLIDTDQLV+EIE MVR RVK IEE
Sbjct  301  VIGCKVNGPGEAKEADIGVVGASPRSLVYRNGEKSHLIDTDQLVEEIESMVRDRVKAIEE  360

Query  361  AKSKEIIRSS  370
            AKSKEIIR+S
Sbjct  361  AKSKEIIRTS  370


> N9DHL4 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) 
[Acinetobacter ursingii ANC 3649]
Length=372

 Score =  697 bits (1798),  Expect = 0.0
 Identities = 354/370 (96%), Positives = 363/370 (98%), Gaps = 0/370 (0%)

Query  1    MIENPIKRRPTRKIRVGSVYVGGDAPISIQSMTNTETCDVDATVAQIQRCADAGVDIMRV  60
            MIENPIKRRPTRKIRVGSVYVGGDAPIS+QSMTNTETCDVDATVAQIQRCADAG DIMRV
Sbjct  1    MIENPIKRRPTRKIRVGSVYVGGDAPISVQSMTNTETCDVDATVAQIQRCADAGADIMRV  60

Query  61   SVPSMEAAEAFGKIRQRVSVPLVADIHFDHRIALAVADYGADCLRINPGNIGSDQKVREV  120
            SVPSMEAAEAFG IR+RV+VPLVADIHFDHRIALAVADYGADCLRINPGNIGSDQKVREV
Sbjct  61   SVPSMEAAEAFGAIRKRVTVPLVADIHFDHRIALAVADYGADCLRINPGNIGSDQKVREV  120

Query  121  VAAARHHGISIRIGVNAGSLEKDLQKKYGEPTGAALLESAMRHIDILDRLDFHEFKVSVK  180
            VAAARHHGISIRIGVNAGSLEKDLQKKYGEPTG ALLESA+RHIDILDRLDFHEFKVSVK
Sbjct  121  VAAARHHGISIRIGVNAGSLEKDLQKKYGEPTGQALLESALRHIDILDRLDFHEFKVSVK  180

Query  181  ASNVFLTMDAYRLLSQQIDNPLHLGVTEAGIYRTGTVKSAIALGGLLMEGIGDTMRISLA  240
            ASNVFLTMDAYRLLSQQIDNPLHLGVTEAGIYRTGTVKSAIALGGLLMEGIGDTMRISLA
Sbjct  181  ASNVFLTMDAYRLLSQQIDNPLHLGVTEAGIYRTGTVKSAIALGGLLMEGIGDTMRISLA  240

Query  241  AEPEDEVKIGFDILKSLGLRSNGINFIACPSCSRQEFNVIKVMQALEERLEDIRTPMDLS  300
            AEPEDE+KIGFDILKSLGLRSNGINFIACPSCSRQEFNVIKVMQ LEERLEDIRTPMD+S
Sbjct  241  AEPEDEIKIGFDILKSLGLRSNGINFIACPSCSRQEFNVIKVMQMLEERLEDIRTPMDVS  300

Query  301  VIGCKVNGPGEAKEADIGIVGASPRSLVYRNGEKSHLIDTDQLVDEIEDMVRQRVKEIEE  360
            VIGCKVNGPGEAKEADIG+VGASPRSLVYRNGEKSHLIDTDQLV+EIE MVR RVK IEE
Sbjct  301  VIGCKVNGPGEAKEADIGVVGASPRSLVYRNGEKSHLIDTDQLVEEIESMVRDRVKAIEE  360

Query  361  AKSKEIIRSS  370
            AKSKEIIR+S
Sbjct  361  AKSKEIIRTS  370


> A0A009YF10 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
(flavodoxin) [Acinetobacter sp. 479375]
Length=372

 Score =  697 bits (1798),  Expect = 0.0
 Identities = 354/370 (96%), Positives = 363/370 (98%), Gaps = 0/370 (0%)

Query  1    MIENPIKRRPTRKIRVGSVYVGGDAPISIQSMTNTETCDVDATVAQIQRCADAGVDIMRV  60
            MIENPIKRRPTRKIRVGSVYVGGDAPIS+QSMTNTETCDVDATVAQIQRCADAG DIMRV
Sbjct  1    MIENPIKRRPTRKIRVGSVYVGGDAPISVQSMTNTETCDVDATVAQIQRCADAGADIMRV  60

Query  61   SVPSMEAAEAFGKIRQRVSVPLVADIHFDHRIALAVADYGADCLRINPGNIGSDQKVREV  120
            SVPSMEAAEAFG IR+RV+VPLVADIHFDHRIALAVADYGADCLRINPGNIGSDQKVREV
Sbjct  61   SVPSMEAAEAFGAIRKRVTVPLVADIHFDHRIALAVADYGADCLRINPGNIGSDQKVREV  120

Query  121  VAAARHHGISIRIGVNAGSLEKDLQKKYGEPTGAALLESAMRHIDILDRLDFHEFKVSVK  180
            VAAARHHGISIRIGVNAGSLEKDLQKKYGEPTG ALLESA+RHIDILDRLDFHEFKVSVK
Sbjct  121  VAAARHHGISIRIGVNAGSLEKDLQKKYGEPTGQALLESALRHIDILDRLDFHEFKVSVK  180

Query  181  ASNVFLTMDAYRLLSQQIDNPLHLGVTEAGIYRTGTVKSAIALGGLLMEGIGDTMRISLA  240
            ASNVFLTMDAYRLLSQQIDNPLHLGVTEAGIYRTGTVKSAIALGGLLMEGIGDTMRISLA
Sbjct  181  ASNVFLTMDAYRLLSQQIDNPLHLGVTEAGIYRTGTVKSAIALGGLLMEGIGDTMRISLA  240

Query  241  AEPEDEVKIGFDILKSLGLRSNGINFIACPSCSRQEFNVIKVMQALEERLEDIRTPMDLS  300
            AEPEDE+KIGFDILKSLGLRSNGINFIACPSCSRQEFNVIKVMQ LEERLEDIRTPMD+S
Sbjct  241  AEPEDEIKIGFDILKSLGLRSNGINFIACPSCSRQEFNVIKVMQMLEERLEDIRTPMDVS  300

Query  301  VIGCKVNGPGEAKEADIGIVGASPRSLVYRNGEKSHLIDTDQLVDEIEDMVRQRVKEIEE  360
            VIGCKVNGPGEAKEADIG+VGASPRSLVYRNGEKSHLIDTDQLV+EIE MVR RVK IEE
Sbjct  301  VIGCKVNGPGEAKEADIGVVGASPRSLVYRNGEKSHLIDTDQLVEEIESMVRDRVKAIEE  360

Query  361  AKSKEIIRSS  370
            AKSKEIIR+S
Sbjct  361  AKSKEIIRTS  370


> A0A1W6GWT3 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
(flavodoxin) [Streptomyces sp]
Length=383

 Score =  303 bits (777),  Expect = 2e-102
 Identities = 154/347 (44%), Positives = 232/347 (67%), Gaps = 2/347 (1%)

Query  8    RRPTRKIRVGSVYVGGDAPISIQSMTNTETCDVDATVAQIQRCADAGVDIMRVSVPSMEA  67
            RR TR++ VG V VG ++P+++QSMT T T DV+AT+ +I +   AG DI+RV+ PS + 
Sbjct  18   RRRTRQLDVGGVGVGSESPVAVQSMTVTTTSDVNATLQEIAQLTAAGCDIVRVACPSQDD  77

Query  68   AEAFGKIRQRVSVPLVADIHFDHRIALAVADYGADCLRINPGNIGS-DQKVREVVAAARH  126
            A+A  +I ++  +P++ADIHF  R   A  + G   +R+NPGNI   D +V+E+  AAR 
Sbjct  78   ADALPQIARKAQIPVIADIHFQPRYVFAAIEAGCAAVRVNPGNIKKFDDQVKEISQAARE  137

Query  127  HGISIRIGVNAGSLEKDLQKKYGEPTGAALLESAMRHIDILDRLDFHEFKVSVKASNVFL  186
             G  IRIGVNAGSL+K L +K+G+ T  AL+ESA+    +    DFH+ K+SVK ++  +
Sbjct  138  TGTPIRIGVNAGSLDKRLLQKHGKATPEALVESALWEAGLFAEHDFHDIKISVKHNDPVV  197

Query  187  TMDAYRLLSQQIDNPLHLGVTEAGIYRTGTVKSAIALGGLLMEGIGDTMRISLAAEPEDE  246
             + AY LL++  D PLHLGVTEAG    GT+KSA+A G LL +GIGDT+R+SL+A P +E
Sbjct  198  MVRAYELLAESCDYPLHLGVTEAGPAFQGTIKSAVAFGALLRQGIGDTIRVSLSAPPVEE  257

Query  247  VKIGFDILKSLGLRSNGINFIACPSCSRQEFNVIKVMQALEERLEDIRTPMDLSVIGCKV  306
            VK+G  IL+SL LR   ++ ++CP+C R + +V K+   +   LE +  P+ ++V+GC V
Sbjct  258  VKVGLQILQSLNLRPRKLDIVSCPACGRAQVDVYKLADEVTAGLEGLEVPLRVAVMGCVV  317

Query  307  NGPGEAKEADIGIVGASPRSLVYRNGEKSHLIDTDQLVDE-IEDMVR  352
            NGPGEA+EAD+G+   + +  ++  GE    +   ++V+  IE+ +R
Sbjct  318  NGPGEAREADLGVASGNGKGQIFVKGEVIKTVPESKIVETLIEEALR  364


> A0A2D1CNW4 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
(ferredoxin) [Scytonema sp. PCC 10023]
Length=420

 Score =  229 bits (583),  Expect = 4e-73
 Identities = 147/390 (38%), Positives = 227/390 (58%), Gaps = 41/390 (11%)

Query  6    IKRRPTRKIRVGSVYVGGDAPISIQSMTNTETCDVDATVAQIQRCADAGVDIMRVSVPSM  65
            I  R TR + VG+V +GG +P+ +QSM N +T DV   V+ I+R    G +I+RV+VPS+
Sbjct  35   IPHRKTRPVSVGNVTIGGGSPVIVQSMINEDTLDVAGAVSAIRRLHKLGCEIVRVTVPSL  94

Query  66   EAAEAFGKIRQRVS-----VPLVADIHFDH-RIALAVADYGADCLRINPG----------  109
              A+A   I++ ++     VPLVAD+H +  +IAL VA +  D +RINPG          
Sbjct  95   AHAKAVAPIKRELTKTYQKVPLVADVHHNGMKIALEVAKH-VDKVRINPGLYVFEKPNPL  153

Query  110  ----------NIGSDQKVRE----VVAAARHHGISIRIGVNAGSLEKDLQKKYGEPTGAA  155
                       IG  +K+RE    +V + R  G ++RIGVN GSL + +   YG+ T   
Sbjct  154  RTEYTQAEFDEIG--EKIRETLEPLVVSLREQGKAMRIGVNHGSLAERMLFTYGD-TPEG  210

Query  156  LLESAMRHIDILDRLDFHEFKVSVKASNVFLTMDAYRLLSQQIDN-----PLHLGVTEAG  210
            +++SA+  I I + LDF    +S+KAS V + + A RL+ + +D      PLHLGVTEAG
Sbjct  211  MVQSALEFIRICESLDFRNLIISLKASRVPVMLAANRLMVKCMDELVMDYPLHLGVTEAG  270

Query  211  IYRTGTVKSAIALGGLLMEGIGDTMRISLAAEPEDEVKIGFDILKSLGLRSNGINFIACP  270
                G +KS   +  LL +GIGDT+R+SL   PE E+ + + IL++LGLR   + +IACP
Sbjct  271  DGEYGRIKSTAGIATLLADGIGDTIRVSLTEAPEKEIPVCYGILQALGLRRTMVEYIACP  330

Query  271  SCSRQEFNVIKVMQALEERLEDIRTPMDLSVIGCKVNGPGEAKEADIGIVGASPRSL-VY  329
            SC R  FN+  V+  + E  + + T ++++V+GC VNG GE  +AD G VG  P  + +Y
Sbjct  331  SCGRTLFNLENVLHQVREATKHL-TGLNIAVMGCIVNGLGEMADADYGYVGKQPGYISLY  389

Query  330  RNGEKSHLIDTDQLVDEIEDMVRQRVKEIE  359
            R  E+   +   + V+E+ ++++   + +E
Sbjct  390  RRREEIKKVPESKGVEELINLIKADGRWVE  419


> B6DXA0 Putative chloroplast 4-hydroxy-3-methylbut-2-en-1-yl diphosphate 
synthase [Pyropia yezoensis]
Length=484

 Score =  226 bits (576),  Expect = 2e-71
 Identities = 144/363 (40%), Positives = 211/363 (58%), Gaps = 39/363 (11%)

Query  8    RRPTRKIRVGSVYVGGDAPISIQSMTNTETCDVDATVAQIQRCADAGVDIMRVSVPSMEA  67
            RR TR +RVG + +GG  P+ +QSM N +T DVD   A I+   + G +++RV+  SM  
Sbjct  89   RRKTRAVRVGDISIGGGNPVVVQSMINEDTLDVDNATASIRALHEIGCEMVRVTCVSMAH  148

Query  68   AEAFGKIRQRV-----SVPLVADIHFDH-RIALAVADYGADCLRINPG-----------N  110
            A A G I++++      VPLVAD+H +  +IAL VA +  D +RINPG            
Sbjct  149  AHAVGFIKEKLRAEYQDVPLVADVHHNGMKIALEVAKH-VDKVRINPGLYVFEKPKEGRT  207

Query  111  IGSDQKVREV-----------VAAARHHGISIRIGVNAGSLEKDLQKKYGEPTGAALLES  159
              SD++   +           V + +  G ++RIGVN GSL + +   YG+ T   ++ES
Sbjct  208  EYSDEEFNRLKDKLKATLTPLVLSLKEQGKAMRIGVNHGSLAERMMFTYGD-TPRGMVES  266

Query  160  AMRHIDILDRLDFHEFKVSVKASNVFLTMDAYRLLSQQIDN-----PLHLGVTEAGIYRT  214
            AM  I+I   LDFH   +S+KAS V + + AYR L+ ++D      P+HLGVTEAG    
Sbjct  267  AMECIEICRELDFHNLVISMKASKVPVMIAAYRQLALRLDAEGYDYPIHLGVTEAGDGEY  326

Query  215  GTVKSAIALGGLLMEGIGDTMRISLAAEPEDEVKIGFDILKSLGLRSNGINFIACPSCSR  274
            G VKS+I +G LL EGIGDT+R+SL   P  E+ + + IL++L LR     ++ACPSC R
Sbjct  327  GRVKSSIGIGTLLGEGIGDTLRVSLTENPMKEIPVCYGILQALNLRRTMTEWVACPSCGR  386

Query  275  QEF---NVIKVMQALEERLEDIRTPMDLSVIGCKVNGPGEAKEADIGIVGASPRSL-VYR  330
              F   +V+  ++A  + L+ +  P+ +SV+GC VNGPGE  +AD G VG+    + +YR
Sbjct  387  TLFDLEDVLADVRAATKHLDKLDPPISISVLGCIVNGPGEMADADYGYVGSKAGYITLYR  446

Query  331  NGE  333
              E
Sbjct  447  RKE  449


> Q4VKB7 Putative chloroplast 1-hydroxy-2-methyl-2-(E)-butenyl-4-diphosphate 
synthase [Chlamydomonas reinhardtii]
Length=681

 Score =  192 bits (488),  Expect = 2e-57
 Identities = 115/277 (42%), Positives = 162/277 (58%), Gaps = 35/277 (13%)

Query  4    NPIKRRPTRKIRVGSVYVGGDAPISIQSMTNTETCDVDATVAQIQRCADAGVDIMRVSVP  63
            N   RRPTR + +G V VG    I++Q+MT T+T +V  TV Q+++CADAG DI+R++V 
Sbjct  14   NKTIRRPTRTVMIGKVPVGSQHRIALQTMTTTDTRNVQLTVDQVKKCADAGADIVRITVQ  73

Query  64   SMEAAEAFGKIRQRV-----SVPLVADIHFDHRIALAVADYGADCLRINPGNIGSDQKVR  118
              + AEA  KIR+++      VPLVADIHF   +A+ VAD   + +R+NPGN    +K  
Sbjct  74   GKKEAEACMKIREQLFKDKYDVPLVADIHFQPTVAMMVAD-AFEKIRVNPGNFADGRKTF  132

Query  119  EV-----------------------VAAARHHGISIRIGVNAGSLEKDLQKKYGEPTGAA  155
            +V                       V   +  G +IRIG N GSL   +   YG+ T   
Sbjct  133  DVINYDDPREFERERELIEETFTPLVLKCKELGRAIRIGTNHGSLSARILSYYGD-TPRG  191

Query  156  LLESAMRHIDILDRLDFHEFKVSVKASNVFLTMDAYRLLSQQ-----IDNPLHLGVTEAG  210
            ++ESA    D+  + D+H F  S+KASN  + + AYRLL+++      D PLHLGVTEAG
Sbjct  192  MVESAFEFADVCRKHDYHNFVFSMKASNPLVMVQAYRLLAEEQYKRSWDYPLHLGVTEAG  251

Query  211  IYRTGTVKSAIALGGLLMEGIGDTMRISLAAEPEDEV  247
                G +KSAI +G LLM+G+GDT+R+SL  +PE E+
Sbjct  252  EGEDGRMKSAIGIGALLMDGLGDTIRVSLTEDPEFEM  288


 Score = 80.9 bits (198),  Expect = 2e-19
 Identities = 52/182 (29%), Positives = 97/182 (53%), Gaps = 17/182 (9%)

Query  205  GVTEAGIYR----TGTVKSAIAL------GGLLMEGIGDTMRISLAAEPEDEVKI-GFDI  253
            G+T   I+R     GTV+  I +      GGLL++G+GD   +    E  D ++   F +
Sbjct  501  GITTPVIHRITFPAGTVRDEIVITTGSLVGGLLVDGLGDGAMVECPGEDTDFLRTTAFGL  560

Query  254  LKSLGLRSNGINFIACPSCSRQEFNVIKVMQALEERLEDIRTPMDLSVIGCKVNGPGEAK  313
            L+   +R+    +++CPSC R  FN+ +V   +  R   +   + ++V+GC VNGPGE  
Sbjct  561  LQGCRMRNIKTEYVSCPSCGRTLFNLQEVTDQIRTRTGHL-PGVAIAVMGCIVNGPGEMA  619

Query  314  EADIGIVGASPRSLVYRNGEK--SHLIDTDQLVDEIEDMVRQRVKEIE---EAKSKEIIR  368
            +AD G VG +P  +    G++     I  +   D++ +++++  + +E   E +SKE++ 
Sbjct  620  DADFGYVGGAPGKIDLYVGKEVVRRGIPMESACDQLIELIKEHGRWVEPAVEEESKELVA  679

Query  369  SS  370
            ++
Sbjct  680  TA  681


> A0A1D8H2T4 4-hydroxy-3-methylbut-2-enyl diphosphate synthase 
[Osmanthus fragrans]
Length=742

 Score =  185 bits (469),  Expect = 9e-55
 Identities = 114/273 (42%), Positives = 160/273 (59%), Gaps = 36/273 (13%)

Query  8    RRPTRKIRVGSVYVGGDAPISIQSMTNTETCDVDATVAQIQRCADAGVDIMRVSVPSMEA  67
            RR TR + VG+V +G + PI IQ+MT T+T DV ATV Q+ R AD G DI+R++V   + 
Sbjct  86   RRKTRTVMVGNVALGSEHPIRIQTMTTTDTKDVAATVEQVMRIADQGADIVRITVQGKKE  145

Query  68   AEAFGKIR-----QRVSVPLVADIHFDHRIALAVADYGADCLRINPGNIGS---------  113
            A+A  +I+     +  ++PLVADIHF   IAL V++   D +R+NPGN            
Sbjct  146  ADACFEIKNSLVQKNYNIPLVADIHFAPPIALRVSEC-FDKIRVNPGNFADRRAQFETLE  204

Query  114  -------------DQKVREVVAAARHHGISIRIGVNAGSLEKDLQKKYGE-PTGAALLES  159
                         +Q    +V   + +G ++RIG N GSL   +   YG+ P G  ++ES
Sbjct  205  YTEDDYQKELEHIEQVFTPLVEKCKKYGRAMRIGTNHGSLSDRIMSYYGDSPRG--MVES  262

Query  160  AMRHIDILDRLDFHEFKVSVKASNVFLTMDAYRLLSQQI-----DNPLHLGVTEAGIYRT  214
            A  +  I  +LDFH F  S+KASN  + + AYRLL  ++     D PLHLGVTEAG    
Sbjct  263  AFEYARICRKLDFHNFVFSMKASNPVIMVQAYRLLVAEMNVLGWDYPLHLGVTEAGEGED  322

Query  215  GTVKSAIALGGLLMEGIGDTMRISLAAEPEDEV  247
            G +KSAI +G LLM+G+GDT+R+SL   PE+E+
Sbjct  323  GRMKSAIGIGTLLMDGLGDTIRVSLTEAPEEEI  355


 Score = 70.5 bits (171),  Expect = 6e-16
 Identities = 51/182 (28%), Positives = 93/182 (51%), Gaps = 15/182 (8%)

Query  180  KASNVFLTMDAYRLLSQQ-IDNP-LHLGVTEAGIYRTGTVKSA-IALGGLLMEGIGDTMR  236
            K S V      +  LS+  +D P +H     + I+R   V  A    GGLL++G+GD + 
Sbjct  553  KTSRVHAARRLFEYLSENSLDIPVIHHIEFPSKIHRDDLVIGAGTNAGGLLVDGLGDGIL  612

Query  237  ISLAAEPEDEVK-IGFDILKSLGLRSNGINFIACPSCSRQEFNVIKVMQALEERLEDIRT  295
            +    +  + ++   F++L+   +R+    +++CPSC R  F++ ++   + E+   +  
Sbjct  613  LEAPDQDFEFLRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHL-P  671

Query  296  PMDLSVIGCKVNGPGEAKEADIGIVGASP--------RSLVYRNGEKSHLIDTDQLVDEI  347
             + ++++GC VNGPGE  +AD G VG +P        +++V R     H   TD L+  I
Sbjct  672  GVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRGIAMEHA--TDALIQLI  729

Query  348  ED  349
            +D
Sbjct  730  KD  731


> B1Q2Q6 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Perkinsus 
marinus]
Length=798

 Score =  183 bits (464),  Expect = 5e-54
 Identities = 111/279 (40%), Positives = 169/279 (61%), Gaps = 36/279 (13%)

Query  2    IENPIKRRPTRKIRVGSVYVGGDAPISIQSMTNTETCDVDATVAQIQRCADAGVDIMRVS  61
            +++PI+R+ TR + VG+V VG +  +++Q+M+N+ T DVDATV QI+RCADAG+DI+RV+
Sbjct  141  VDHPIRRK-TRTVMVGNVPVGSEHRLALQTMSNSSTDDVDATVKQIERCADAGIDIVRVT  199

Query  62   VPSMEAAEAFGKIRQRV-----SVPLVADIHFDHRIALAVADYGADCLRINPGNIGSDQK  116
            V  ++ A A   I++R+     + P+VADIHF  ++A+  A+   D +RINPGN     K
Sbjct  200  VQGIKEAHATKLIKERLLKDGYTTPIVADIHFKPKVAMLAAE-ACDKIRINPGNFIDGMK  258

Query  117  -----------------------VREVVAAARHHGISIRIGVNAGSLEKDLQKKYGEPTG  153
                                   ++ +V + +  G  +RIGVN GSL + +  +YG+ T 
Sbjct  259  TFDKITEVTPEIAAEWQEEMFKTLKPLVESLKRQGKCMRIGVNHGSLSERILTQYGD-TP  317

Query  154  AALLESAMRHIDILDRLDFHEFKVSVKASNVFLTMDAYRLLSQQI-----DNPLHLGVTE  208
              ++ SA+    +   LDFH    S+K+SN  + + AYRLL+ ++     D PLHLGVTE
Sbjct  318  EGMVASALEVGLMCRALDFHNIIFSMKSSNTRVMVAAYRLLAAEMEKRGWDYPLHLGVTE  377

Query  209  AGIYRTGTVKSAIALGGLLMEGIGDTMRISLAAEPEDEV  247
            AG    G +KSAI +G LL +G+GDT+R+SL  +P  EV
Sbjct  378  AGGGSDGRIKSAIGIGALLQDGLGDTVRVSLTEDPWHEV  416


 Score = 66.6 bits (161),  Expect = 1e-14
 Identities = 37/139 (27%), Positives = 75/139 (54%), Gaps = 4/139 (3%)

Query  217  VKSAIALGGLLMEGIGDTMRISLAAEPEDEVK-IGFDILKSLGLRSNGINFIACPSCSRQ  275
            +  A   G L ++G+GD +         +E + +G ++++   +R +   FI+CPSC R 
Sbjct  646  ILGASEFGSLFVDGLGDGIFWDDRGLTTEETRDVGLNLMQGSRMRLSKTEFISCPSCGRT  705

Query  276  EFNVIKVMQALEERLEDIRTPMDLSVIGCKVNGPGEAKEADIGIVGASPRSLVYRNGEK-  334
             F++    + + ++   + + + ++V+GC VNGPGE  +AD G VG+ P  +    G++ 
Sbjct  706  LFDLQDTTERIRKKTGHL-SGLRIAVMGCVVNGPGEMADADFGYVGSLPGKVDLYVGKQC  764

Query  335  -SHLIDTDQLVDEIEDMVR  352
                +D D+  D + D+++
Sbjct  765  VRRAVDYDKAEDVLVDLIK  783


> Q84XR5 GCPE protein [Catharanthus roseus]
Length=740

 Score =  180 bits (457),  Expect = 3e-53
 Identities = 113/273 (41%), Positives = 156/273 (57%), Gaps = 36/273 (13%)

Query  8    RRPTRKIRVGSVYVGGDAPISIQSMTNTETCDVDATVAQIQRCADAGVDIMRVSVPSMEA  67
            RR TR + VG+V +G D PI IQ+MT T+T DV ATV Q+   AD G DI+R++V   + 
Sbjct  84   RRKTRTVMVGNVALGSDHPIRIQTMTTTDTKDVAATVEQVMGIADKGADIVRITVQGKKE  143

Query  68   AEAFGKIRQRV-----SVPLVADIHFDHRIALAVADYGADCLRINPGNIGS---------  113
            A+A   I+  +     ++PLVADIHF   +AL VA+   D +R+NPGN            
Sbjct  144  ADACYDIKNTLVQKSYNIPLVADIHFAPAVALRVAEC-FDKIRVNPGNFADRRAQFEQLE  202

Query  114  -------------DQKVREVVAAARHHGISIRIGVNAGSLEKDLQKKYGE-PTGAALLES  159
                         +Q    +V   + +G ++RIG N GSL   +   YG+ P G  ++ES
Sbjct  203  YTDEEYQKELEHIEQVFTPLVEKCKKYGRAMRIGTNHGSLSDRIMSYYGDSPRG--MVES  260

Query  160  AMRHIDILDRLDFHEFKVSVKASNVFLTMDAYRLLSQQI-----DNPLHLGVTEAGIYRT  214
            A     I  +LDFH F  S+KASN  + + AYRLL  ++     D PLHLGVTEAG    
Sbjct  261  AFEFARICRKLDFHNFVFSMKASNPVIMVAAYRLLVAEMYVLGWDYPLHLGVTEAGEGED  320

Query  215  GTVKSAIALGGLLMEGIGDTMRISLAAEPEDEV  247
            G +KSAI +G LL +G+GDT+R+SL   PE+E+
Sbjct  321  GRMKSAIGIGTLLQDGLGDTIRVSLTEPPEEEI  353


 Score = 68.9 bits (167),  Expect = 2e-15
 Identities = 38/135 (28%), Positives = 75/135 (56%), Gaps = 12/135 (9%)

Query  224  GGLLMEGIGDTMRISLAAEPEDEVK-IGFDILKSLGLRSNGINFIACPSCSRQEFNVIKV  282
            G LL++G+GD + +    +  + ++   F++L+   +R+    +++CPSC R  F++ ++
Sbjct  598  GALLVDGLGDGVMLEAHDQDFEFLRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEI  657

Query  283  MQALEERLEDIRTPMDLSVIGCKVNGPGEAKEADIGIVGASP--------RSLVYRNGEK  334
               + E+   +   + ++++GC VNGPGE  +AD G VG +P        +++V R  + 
Sbjct  658  SAQIREKTSHL-PGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRGIDM  716

Query  335  SHLIDTDQLVDEIED  349
             H   TD L+  I+D
Sbjct  717  EHA--TDALIQLIKD  729


> A9ZN14 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Hevea 
brasiliensis]
Length=740

 Score =  178 bits (451),  Expect = 2e-52
 Identities = 113/290 (39%), Positives = 164/290 (57%), Gaps = 37/290 (13%)

Query  8    RRPTRKIRVGSVYVGGDAPISIQSMTNTETCDVDATVAQIQRCADAGVDIMRVSVPSMEA  67
            RR TR + VG+V +G + PI +Q+MT ++T DV  TV Q+ R AD G D++R++V     
Sbjct  84   RRKTRTVMVGNVALGSEHPIRVQTMTTSDTKDVAGTVEQVMRIADQGADLVRITVQGKRE  143

Query  68   AEAFGKIR-----QRVSVPLVADIHFDHRIALAVADYGADCLRINPGNIGS---------  113
            A+A  +I+     +  ++PLVADIHF   +AL VA+   D +R+NPGN            
Sbjct  144  ADACFEIKNSLVQKNYNIPLVADIHFAPSVALRVAEC-FDKIRVNPGNFADRRAQFEKLE  202

Query  114  -------------DQKVREVVAAARHHGISIRIGVNAGSLEKDLQKKYGE-PTGAALLES  159
                         +Q    +V   + +G ++RIG N GSL   +   YG+ P G  ++ES
Sbjct  203  YTEDDYQKELEHIEQVFTPLVEKCKKYGRAMRIGTNHGSLSDRIMSYYGDSPRG--MVES  260

Query  160  AMRHIDILDRLDFHEFKVSVKASNVFLTMDAYRLLSQQI-----DNPLHLGVTEAGIYRT  214
            A     I  +LDFH F  S+KASN  + + AYRLL  ++     D PLHLGVTEAG    
Sbjct  261  AFEFARICRKLDFHNFVFSMKASNPVIMVQAYRLLVAEMYVQGWDYPLHLGVTEAGEGED  320

Query  215  GTVKSAIALGGLLMEGIGDTMRISLAAEPEDEVKIGFDILKSLGLRSNGI  264
            G +KSAI +G LL +G+GDT+R+SL   PE E+      L +LG+R++ +
Sbjct  321  GRMKSAIGIGTLLQDGLGDTIRVSLTEPPEKEID-PCRRLANLGMRASTV  369


 Score = 66.6 bits (161),  Expect = 1e-14
 Identities = 31/102 (30%), Positives = 60/102 (59%), Gaps = 2/102 (2%)

Query  224  GGLLMEGIGDTMRISLAAEPEDEVK-IGFDILKSLGLRSNGINFIACPSCSRQEFNVIKV  282
            G LL++G+GD + +    +  D ++   F++L+   +R+    +++CPSC R  F++  +
Sbjct  598  GALLVDGLGDGILLEAPDQDFDFLRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQDI  657

Query  283  MQALEERLEDIRTPMDLSVIGCKVNGPGEAKEADIGIVGASP  324
               + E+   +   + ++++GC VNGPGE  +AD G VG +P
Sbjct  658  SAEIREKTSHL-PGVSIAIMGCIVNGPGEMADADFGYVGGAP  698


> A9CBE3 (E)-4-hydroxy-3-methyl-but-2-enyl diphosphate synthase 
[Ginkgo biloba]
Length=741

 Score =  178 bits (451),  Expect = 2e-52
 Identities = 111/273 (41%), Positives = 157/273 (58%), Gaps = 36/273 (13%)

Query  8    RRPTRKIRVGSVYVGGDAPISIQSMTNTETCDVDATVAQIQRCADAGVDIMRVSVPSMEA  67
            RR TR +  G+V +G + PI IQ+MT T+T DV ATV Q+ R AD G D++R++V   + 
Sbjct  85   RRRTRTMMAGNVALGSEHPIRIQTMTTTDTKDVSATVEQVMRIADRGADLVRITVQGKKE  144

Query  68   AEAFGKIRQRV-----SVPLVADIHFDHRIALAVADYGADCLRINPGNIGSD--------  114
            A+A   I+  +     ++PLVADIHF   +A+ VA+   D +R+NPGN            
Sbjct  145  ADACYDIKNTLVQKDYNIPLVADIHFAPSVAMRVAEC-FDKIRVNPGNFADRRAQFQKLE  203

Query  115  ----------QKVREV----VAAARHHGISIRIGVNAGSLEKDLQKKYGE-PTGAALLES  159
                      + + EV    V   + +G ++RIG N GSL   +   YG+ P G  ++ES
Sbjct  204  YTEEDYQKELEHIEEVFGPLVEKCKKYGRAMRIGTNHGSLSDRIMSYYGDSPRG--MVES  261

Query  160  AMRHIDILDRLDFHEFKVSVKASNVFLTMDAYRLLSQQI-----DNPLHLGVTEAGIYRT  214
            A     I  +LDFH F  S+KASN  + + AYRLL  ++     D PLHLGVTEAG    
Sbjct  262  AFEFARICQKLDFHNFVFSMKASNPVVMVQAYRLLVAEMYVQGWDYPLHLGVTEAGEGED  321

Query  215  GTVKSAIALGGLLMEGIGDTMRISLAAEPEDEV  247
            G +KSAI +G LL +G+GDT+R+SL   PE+E+
Sbjct  322  GRMKSAIGIGTLLQDGLGDTIRVSLTEPPEEEI  354


 Score = 71.2 bits (173),  Expect = 3e-16
 Identities = 42/151 (28%), Positives = 83/151 (55%), Gaps = 5/151 (3%)

Query  209  AGIYRTGTVKSAIA-LGGLLMEGIGDTMRISLAAEPEDEVK-IGFDILKSLGLRSNGINF  266
            AG +R   V +A +  G LL++G+GD + +    +  D ++   F +L+   +R+    +
Sbjct  583  AGTHRDDLVINAGSEAGALLVDGLGDGLLLEAPDQDFDFLRNTSFGLLQGCRMRNTKTEY  642

Query  267  IACPSCSRQEFNVIKVMQALEERLEDIRTPMDLSVIGCKVNGPGEAKEADIGIVGASPRS  326
            ++CPSC R  F++ ++   + E+   +   + ++++GC VNGPGE  +AD G VG SP  
Sbjct  643  VSCPSCGRTLFDLQEISAEIREKTAHL-PGVSIAIMGCIVNGPGEMADADFGYVGGSPGK  701

Query  327  LVYRNGEKSHLIDTDQLVDEIEDMVRQRVKE  357
            +    G++  ++     +D+  D + Q +K+
Sbjct  702  IDLYVGKE--VVKRGIAMDQATDALIQLIKD  730


> B6DX96 Putative chloroplast 4-hydroxy-3-methylbut-2-en-1-yl diphosphate 
synthase [Phaeodactylum tricornutum]
Length=757

 Score =  175 bits (443),  Expect = 3e-51
 Identities = 108/274 (39%), Positives = 150/274 (55%), Gaps = 35/274 (13%)

Query  6    IKRRPTRKIRVGSVYVGGDAPISIQSMTNTETCDVDATVAQIQRCADAGVDIMRVSVPSM  65
            + RR TR +  G +  G D PI  Q+M  T T DV+AT+ Q+ RCAD G D++RV+V   
Sbjct  78   VTRRKTRTVNCGPIKFGSDHPIVRQTMATTNTADVEATMDQVMRCADKGFDLVRVTVQGK  137

Query  66   EAAEAFGKIRQRV-----SVPLVADIHFDHRIALAVADYGADCLRINPGNIGSDQK----  116
              A A  KIR+ +      +PL AD+HF   +AL VAD   + +RINPGN    +K    
Sbjct  138  REANACAKIREGLFKKGYDIPLCADMHFQPVVALLVAD-AVEKIRINPGNFADGRKDFNE  196

Query  117  -------------------VREVVAAARHHGISIRIGVNAGSLEKDLQKKYGEPTGAALL  157
                               ++ +V   +     +RIG N GSL   +   YG+ T   ++
Sbjct  197  KVYETEEDYYAERGYLVEALQPLVEKCKDLDRCMRIGTNHGSLSSRVLSFYGD-TPRGMV  255

Query  158  ESAMRHIDILDRLDFHEFKVSVKASNVFLTMDAYRLLSQQ-----IDNPLHLGVTEAGIY  212
            ESA+   DI   LD+H F  S+KASN  + + +YRLL+ +      D PLHLGVTEAG  
Sbjct  256  ESAIEFADICRSLDYHNFVFSMKASNPLVMVQSYRLLAAEQYRLDWDYPLHLGVTEAGEG  315

Query  213  RTGTVKSAIALGGLLMEGIGDTMRISLAAEPEDE  246
              G +KSAI +G LL +G+GDT+R+SL  +PE E
Sbjct  316  EDGRMKSAIGIGTLLADGLGDTVRVSLTEDPEFE  349


 Score = 65.5 bits (158),  Expect = 2e-14
 Identities = 43/155 (28%), Positives = 76/155 (49%), Gaps = 12/155 (8%)

Query  223  LGGLLMEGIGDTMRISLAAEPEDEV-----KIGFDILKSLGLRSNGINFIACPSCSRQEF  277
            +G LL +G GD + I    E +        +  F +L+   +R+    F++CPSC R  F
Sbjct  599  IGSLLTDGNGDGIMIEQVGEEKPFSVDFLRRTSFSLLQGSRMRNTKTEFVSCPSCGRTLF  658

Query  278  NVIKVMQALEERLEDIRTPMDLSVIGCKVNGPGEAKEADIGIVGASPR--SLVYRNGEKS  335
            ++ +    ++E    +   + ++V+GC VNGPGE  +AD G VG  P    L Y      
Sbjct  659  DLQETTAGIQEATGHL-PGVTVAVMGCIVNGPGEMADADFGYVGTLPGKVDLYYGKEVVR  717

Query  336  HLIDTDQLVDEIEDMVRQ----RVKEIEEAKSKEI  366
              +   + VD + D++++    + KE  E  ++E+
Sbjct  718  KSVPNAEAVDALIDLIKEYGMWKDKEEAEEDTEEV  752



Lambda      K        H        a         alpha
   0.320    0.137    0.383    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4461604


  Database: 0c4265b40ba4b3184c435dc54aa3b23e.TrEMBL.fasta
    Posted date:  Sep 19, 2020  2:45 PM
  Number of letters in database: 16,135
  Number of sequences in database:  36



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40