ACIAD0561 / SwissProt Alignments

BLASTP 2.2.28+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: 1fd5c47000f01f8ecd7004a2fc056c09.SwissProt.fasta
           26 sequences; 11,250 total letters



Query= ACIAD0561

Length=372
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  Q6FEM3 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (fl...   721    0.0   
  B7I5G7 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (fl...   697    0.0   
  B2I3E5 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (fl...   697    0.0   
  B0VKR8 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (fl...   697    0.0   
  A3M211 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (fl...   697    0.0   
  B0V5G7 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (fl...   697    0.0   
  Q4FTW7 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (fl...   577    0.0   
  Q1QD18 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (fl...   577    0.0   
  Q0VNE0 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (fl...   511    0.0   
  Q1QTK8 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (fl...   500    1e-179
  A5VYT5 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (fl...   499    2e-179
  Q88PJ7 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (fl...   498    8e-179
  B0KPI7 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (fl...   496    3e-178
  A6V0W0 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (fl...   495    1e-177
  Q1IEI1 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (fl...   494    1e-177
  P72241 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (fl...   473    3e-169
  P62620 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (fl...   460    6e-164
  O67496 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (fl...   319    7e-109
  Q9X7W2 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (fl...   310    4e-105
  Q8DK70 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (fe...   244    2e-79 
  Q72H18 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (fl...   209    5e-66 
  Q84GJ3 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (fl...   209    5e-66 
  Q6K8J4 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (fe...   180    2e-53 
  F4K0E8 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (fe...   178    1e-52 
  P95608 Muconate cycloisomerase 1 [Rhodococcus opacus]               38.9    3e-06 
  P38990 SNF1-activating kinase 1 [Saccharomyces cerevisiae (stra...  35.4    5e-05 


> Q6FEM3 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) 
[Acinetobacter baylyi (strain ATCC 33305 / BD413 
/ ADP1)]
Length=371

 Score =  721 bits (1862),  Expect = 0.0
 Identities = 371/371 (100%), Positives = 371/371 (100%), Gaps = 0/371 (0%)

Query  1    MIENPIKRRPTRKIRVGSVYVGGDAPISIQSMTNTETCDVDATVAQIQRCADAGVDIMRV  60
            MIENPIKRRPTRKIRVGSVYVGGDAPISIQSMTNTETCDVDATVAQIQRCADAGVDIMRV
Sbjct  1    MIENPIKRRPTRKIRVGSVYVGGDAPISIQSMTNTETCDVDATVAQIQRCADAGVDIMRV  60

Query  61   SVPSMEAAEAFGKIRQRVSVPLVADIHFDHRIALAVADYGADCLRINPGNIGSDQKVREV  120
            SVPSMEAAEAFGKIRQRVSVPLVADIHFDHRIALAVADYGADCLRINPGNIGSDQKVREV
Sbjct  61   SVPSMEAAEAFGKIRQRVSVPLVADIHFDHRIALAVADYGADCLRINPGNIGSDQKVREV  120

Query  121  VAAARHHGISIRIGVNAGSLEKDLQKKYGEPTGAALLESAMRHIDILDRLDFHEFKVSVK  180
            VAAARHHGISIRIGVNAGSLEKDLQKKYGEPTGAALLESAMRHIDILDRLDFHEFKVSVK
Sbjct  121  VAAARHHGISIRIGVNAGSLEKDLQKKYGEPTGAALLESAMRHIDILDRLDFHEFKVSVK  180

Query  181  ASNVFLTMDAYRLLSQQIDNPLHLGVTEAGIYRTGTVKSAIALGGLLMEGIGDTMRISLA  240
            ASNVFLTMDAYRLLSQQIDNPLHLGVTEAGIYRTGTVKSAIALGGLLMEGIGDTMRISLA
Sbjct  181  ASNVFLTMDAYRLLSQQIDNPLHLGVTEAGIYRTGTVKSAIALGGLLMEGIGDTMRISLA  240

Query  241  AEPEDEVKIGFDILKSLGLRSNGINFIACPSCSRQEFNVIKVMQALEERLEDIRTPMDLS  300
            AEPEDEVKIGFDILKSLGLRSNGINFIACPSCSRQEFNVIKVMQALEERLEDIRTPMDLS
Sbjct  241  AEPEDEVKIGFDILKSLGLRSNGINFIACPSCSRQEFNVIKVMQALEERLEDIRTPMDLS  300

Query  301  VIGCKVNGPGEAKEADIGIVGASPRSLVYRNGEKSHLIDTDQLVDEIEDMVRQRVKEIEE  360
            VIGCKVNGPGEAKEADIGIVGASPRSLVYRNGEKSHLIDTDQLVDEIEDMVRQRVKEIEE
Sbjct  301  VIGCKVNGPGEAKEADIGIVGASPRSLVYRNGEKSHLIDTDQLVDEIEDMVRQRVKEIEE  360

Query  361  AKSKEIIRSSS  371
            AKSKEIIRSSS
Sbjct  361  AKSKEIIRSSS  371


> B7I5G7 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) 
[Acinetobacter baumannii (strain AB0057)]
Length=371

 Score =  697 bits (1799),  Expect = 0.0
 Identities = 353/371 (95%), Positives = 366/371 (99%), Gaps = 0/371 (0%)

Query  1    MIENPIKRRPTRKIRVGSVYVGGDAPISIQSMTNTETCDVDATVAQIQRCADAGVDIMRV  60
            MIENPIKRRPTRKIRVGSVYVGGDAPIS+QSMTNTETCDVDATVAQI+RC DAG DIMRV
Sbjct  1    MIENPIKRRPTRKIRVGSVYVGGDAPISVQSMTNTETCDVDATVAQIERCVDAGADIMRV  60

Query  61   SVPSMEAAEAFGKIRQRVSVPLVADIHFDHRIALAVADYGADCLRINPGNIGSDQKVREV  120
            SVPSMEAAEAFG IR+RVSVPLVADIHFDHRIALAVADYGADCLRINPGNIGSDQKVREV
Sbjct  61   SVPSMEAAEAFGAIRKRVSVPLVADIHFDHRIALAVADYGADCLRINPGNIGSDQKVREV  120

Query  121  VAAARHHGISIRIGVNAGSLEKDLQKKYGEPTGAALLESAMRHIDILDRLDFHEFKVSVK  180
            VAAARHHGIS+RIGVNAGSLEKDLQKKYGEPTG ALLESA+RHIDILDRLDFHEFKVSVK
Sbjct  121  VAAARHHGISMRIGVNAGSLEKDLQKKYGEPTGQALLESALRHIDILDRLDFHEFKVSVK  180

Query  181  ASNVFLTMDAYRLLSQQIDNPLHLGVTEAGIYRTGTVKSAIALGGLLMEGIGDTMRISLA  240
            ASNVFLTMDAYRLLSQQIDNPLHLGVTEAGIYRTGTVKSAIALGGLLMEGIGDTMRISLA
Sbjct  181  ASNVFLTMDAYRLLSQQIDNPLHLGVTEAGIYRTGTVKSAIALGGLLMEGIGDTMRISLA  240

Query  241  AEPEDEVKIGFDILKSLGLRSNGINFIACPSCSRQEFNVIKVMQALEERLEDIRTPMDLS  300
            AEPEDE+KIGFDILKSLGLRSNGINFIACPSCSRQEFNVI+VMQALEERLEDIRTPMD+S
Sbjct  241  AEPEDEIKIGFDILKSLGLRSNGINFIACPSCSRQEFNVIQVMQALEERLEDIRTPMDVS  300

Query  301  VIGCKVNGPGEAKEADIGIVGASPRSLVYRNGEKSHLIDTDQLVDEIEDMVRQRVKEIEE  360
            VIGCKVNGPGEAKEADIG+VGA+PRSLVYRNGEKSHLIDT+QLVDEIE MVRQRV+E+EE
Sbjct  301  VIGCKVNGPGEAKEADIGVVGAAPRSLVYRNGEKSHLIDTNQLVDEIETMVRQRVQELEE  360

Query  361  AKSKEIIRSSS  371
            AKSKEIIRSSS
Sbjct  361  AKSKEIIRSSS  371


> B2I3E5 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) 
[Acinetobacter baumannii (strain ACICU)]
Length=371

 Score =  697 bits (1799),  Expect = 0.0
 Identities = 353/371 (95%), Positives = 366/371 (99%), Gaps = 0/371 (0%)

Query  1    MIENPIKRRPTRKIRVGSVYVGGDAPISIQSMTNTETCDVDATVAQIQRCADAGVDIMRV  60
            MIENPIKRRPTRKIRVGSVYVGGDAPIS+QSMTNTETCDVDATVAQI+RC DAG DIMRV
Sbjct  1    MIENPIKRRPTRKIRVGSVYVGGDAPISVQSMTNTETCDVDATVAQIERCVDAGADIMRV  60

Query  61   SVPSMEAAEAFGKIRQRVSVPLVADIHFDHRIALAVADYGADCLRINPGNIGSDQKVREV  120
            SVPSMEAAEAFG IR+RVSVPLVADIHFDHRIALAVADYGADCLRINPGNIGSDQKVREV
Sbjct  61   SVPSMEAAEAFGAIRKRVSVPLVADIHFDHRIALAVADYGADCLRINPGNIGSDQKVREV  120

Query  121  VAAARHHGISIRIGVNAGSLEKDLQKKYGEPTGAALLESAMRHIDILDRLDFHEFKVSVK  180
            VAAARHHGIS+RIGVNAGSLEKDLQKKYGEPTG ALLESA+RHIDILDRLDFHEFKVSVK
Sbjct  121  VAAARHHGISMRIGVNAGSLEKDLQKKYGEPTGQALLESALRHIDILDRLDFHEFKVSVK  180

Query  181  ASNVFLTMDAYRLLSQQIDNPLHLGVTEAGIYRTGTVKSAIALGGLLMEGIGDTMRISLA  240
            ASNVFLTMDAYRLLSQQIDNPLHLGVTEAGIYRTGTVKSAIALGGLLMEGIGDTMRISLA
Sbjct  181  ASNVFLTMDAYRLLSQQIDNPLHLGVTEAGIYRTGTVKSAIALGGLLMEGIGDTMRISLA  240

Query  241  AEPEDEVKIGFDILKSLGLRSNGINFIACPSCSRQEFNVIKVMQALEERLEDIRTPMDLS  300
            AEPEDE+KIGFDILKSLGLRSNGINFIACPSCSRQEFNVI+VMQALEERLEDIRTPMD+S
Sbjct  241  AEPEDEIKIGFDILKSLGLRSNGINFIACPSCSRQEFNVIQVMQALEERLEDIRTPMDVS  300

Query  301  VIGCKVNGPGEAKEADIGIVGASPRSLVYRNGEKSHLIDTDQLVDEIEDMVRQRVKEIEE  360
            VIGCKVNGPGEAKEADIG+VGA+PRSLVYRNGEKSHLIDT+QLVDEIE MVRQRV+E+EE
Sbjct  301  VIGCKVNGPGEAKEADIGVVGAAPRSLVYRNGEKSHLIDTNQLVDEIETMVRQRVQELEE  360

Query  361  AKSKEIIRSSS  371
            AKSKEIIRSSS
Sbjct  361  AKSKEIIRSSS  371


> B0VKR8 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) 
[Acinetobacter baumannii (strain SDF)]
Length=371

 Score =  697 bits (1799),  Expect = 0.0
 Identities = 353/371 (95%), Positives = 366/371 (99%), Gaps = 0/371 (0%)

Query  1    MIENPIKRRPTRKIRVGSVYVGGDAPISIQSMTNTETCDVDATVAQIQRCADAGVDIMRV  60
            MIENPIKRRPTRKIRVGSVYVGGDAPIS+QSMTNTETCDVDATVAQI+RC DAG DIMRV
Sbjct  1    MIENPIKRRPTRKIRVGSVYVGGDAPISVQSMTNTETCDVDATVAQIERCVDAGADIMRV  60

Query  61   SVPSMEAAEAFGKIRQRVSVPLVADIHFDHRIALAVADYGADCLRINPGNIGSDQKVREV  120
            SVPSMEAAEAFG IR+RVSVPLVADIHFDHRIALAVADYGADCLRINPGNIGSDQKVREV
Sbjct  61   SVPSMEAAEAFGAIRKRVSVPLVADIHFDHRIALAVADYGADCLRINPGNIGSDQKVREV  120

Query  121  VAAARHHGISIRIGVNAGSLEKDLQKKYGEPTGAALLESAMRHIDILDRLDFHEFKVSVK  180
            VAAARHHGIS+RIGVNAGSLEKDLQKKYGEPTG ALLESA+RHIDILDRLDFHEFKVSVK
Sbjct  121  VAAARHHGISMRIGVNAGSLEKDLQKKYGEPTGQALLESALRHIDILDRLDFHEFKVSVK  180

Query  181  ASNVFLTMDAYRLLSQQIDNPLHLGVTEAGIYRTGTVKSAIALGGLLMEGIGDTMRISLA  240
            ASNVFLTMDAYRLLSQQIDNPLHLGVTEAGIYRTGTVKSAIALGGLLMEGIGDTMRISLA
Sbjct  181  ASNVFLTMDAYRLLSQQIDNPLHLGVTEAGIYRTGTVKSAIALGGLLMEGIGDTMRISLA  240

Query  241  AEPEDEVKIGFDILKSLGLRSNGINFIACPSCSRQEFNVIKVMQALEERLEDIRTPMDLS  300
            AEPEDE+KIGFDILKSLGLRSNGINFIACPSCSRQEFNVI+VMQALEERLEDIRTPMD+S
Sbjct  241  AEPEDEIKIGFDILKSLGLRSNGINFIACPSCSRQEFNVIQVMQALEERLEDIRTPMDVS  300

Query  301  VIGCKVNGPGEAKEADIGIVGASPRSLVYRNGEKSHLIDTDQLVDEIEDMVRQRVKEIEE  360
            VIGCKVNGPGEAKEADIG+VGA+PRSLVYRNGEKSHLIDT+QLVDEIE MVRQRV+E+EE
Sbjct  301  VIGCKVNGPGEAKEADIGVVGAAPRSLVYRNGEKSHLIDTNQLVDEIETMVRQRVQELEE  360

Query  361  AKSKEIIRSSS  371
            AKSKEIIRSSS
Sbjct  361  AKSKEIIRSSS  371


> A3M211 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) 
[Acinetobacter baumannii (strain ATCC 17978 / CIP 
53.77 / LMG 1025 / NCDC KC755 / 5377)]
Length=371

 Score =  697 bits (1799),  Expect = 0.0
 Identities = 353/371 (95%), Positives = 366/371 (99%), Gaps = 0/371 (0%)

Query  1    MIENPIKRRPTRKIRVGSVYVGGDAPISIQSMTNTETCDVDATVAQIQRCADAGVDIMRV  60
            MIENPIKRRPTRKIRVGSVYVGGDAPIS+QSMTNTETCDVDATVAQI+RC DAG DIMRV
Sbjct  1    MIENPIKRRPTRKIRVGSVYVGGDAPISVQSMTNTETCDVDATVAQIERCVDAGADIMRV  60

Query  61   SVPSMEAAEAFGKIRQRVSVPLVADIHFDHRIALAVADYGADCLRINPGNIGSDQKVREV  120
            SVPSMEAAEAFG IR+RVSVPLVADIHFDHRIALAVADYGADCLRINPGNIGSDQKVREV
Sbjct  61   SVPSMEAAEAFGAIRKRVSVPLVADIHFDHRIALAVADYGADCLRINPGNIGSDQKVREV  120

Query  121  VAAARHHGISIRIGVNAGSLEKDLQKKYGEPTGAALLESAMRHIDILDRLDFHEFKVSVK  180
            VAAARHHGIS+RIGVNAGSLEKDLQKKYGEPTG ALLESA+RHIDILDRLDFHEFKVSVK
Sbjct  121  VAAARHHGISMRIGVNAGSLEKDLQKKYGEPTGQALLESALRHIDILDRLDFHEFKVSVK  180

Query  181  ASNVFLTMDAYRLLSQQIDNPLHLGVTEAGIYRTGTVKSAIALGGLLMEGIGDTMRISLA  240
            ASNVFLTMDAYRLLSQQIDNPLHLGVTEAGIYRTGTVKSAIALGGLLMEGIGDTMRISLA
Sbjct  181  ASNVFLTMDAYRLLSQQIDNPLHLGVTEAGIYRTGTVKSAIALGGLLMEGIGDTMRISLA  240

Query  241  AEPEDEVKIGFDILKSLGLRSNGINFIACPSCSRQEFNVIKVMQALEERLEDIRTPMDLS  300
            AEPEDE+KIGFDILKSLGLRSNGINFIACPSCSRQEFNVI+VMQALEERLEDIRTPMD+S
Sbjct  241  AEPEDEIKIGFDILKSLGLRSNGINFIACPSCSRQEFNVIQVMQALEERLEDIRTPMDVS  300

Query  301  VIGCKVNGPGEAKEADIGIVGASPRSLVYRNGEKSHLIDTDQLVDEIEDMVRQRVKEIEE  360
            VIGCKVNGPGEAKEADIG+VGA+PRSLVYRNGEKSHLIDT+QLVDEIE MVRQRV+E+EE
Sbjct  301  VIGCKVNGPGEAKEADIGVVGAAPRSLVYRNGEKSHLIDTNQLVDEIETMVRQRVQELEE  360

Query  361  AKSKEIIRSSS  371
            AKSKEIIRSSS
Sbjct  361  AKSKEIIRSSS  371


> B0V5G7 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) 
[Acinetobacter baumannii (strain AYE)]
Length=371

 Score =  697 bits (1799),  Expect = 0.0
 Identities = 353/371 (95%), Positives = 366/371 (99%), Gaps = 0/371 (0%)

Query  1    MIENPIKRRPTRKIRVGSVYVGGDAPISIQSMTNTETCDVDATVAQIQRCADAGVDIMRV  60
            MIENPIKRRPTRKIRVGSVYVGGDAPIS+QSMTNTETCDVDATVAQI+RC DAG DIMRV
Sbjct  1    MIENPIKRRPTRKIRVGSVYVGGDAPISVQSMTNTETCDVDATVAQIERCVDAGADIMRV  60

Query  61   SVPSMEAAEAFGKIRQRVSVPLVADIHFDHRIALAVADYGADCLRINPGNIGSDQKVREV  120
            SVPSMEAAEAFG IR+RVSVPLVADIHFDHRIALAVADYGADCLRINPGNIGSDQKVREV
Sbjct  61   SVPSMEAAEAFGAIRKRVSVPLVADIHFDHRIALAVADYGADCLRINPGNIGSDQKVREV  120

Query  121  VAAARHHGISIRIGVNAGSLEKDLQKKYGEPTGAALLESAMRHIDILDRLDFHEFKVSVK  180
            VAAARHHGIS+RIGVNAGSLEKDLQKKYGEPTG ALLESA+RHIDILDRLDFHEFKVSVK
Sbjct  121  VAAARHHGISMRIGVNAGSLEKDLQKKYGEPTGQALLESALRHIDILDRLDFHEFKVSVK  180

Query  181  ASNVFLTMDAYRLLSQQIDNPLHLGVTEAGIYRTGTVKSAIALGGLLMEGIGDTMRISLA  240
            ASNVFLTMDAYRLLSQQIDNPLHLGVTEAGIYRTGTVKSAIALGGLLMEGIGDTMRISLA
Sbjct  181  ASNVFLTMDAYRLLSQQIDNPLHLGVTEAGIYRTGTVKSAIALGGLLMEGIGDTMRISLA  240

Query  241  AEPEDEVKIGFDILKSLGLRSNGINFIACPSCSRQEFNVIKVMQALEERLEDIRTPMDLS  300
            AEPEDE+KIGFDILKSLGLRSNGINFIACPSCSRQEFNVI+VMQALEERLEDIRTPMD+S
Sbjct  241  AEPEDEIKIGFDILKSLGLRSNGINFIACPSCSRQEFNVIQVMQALEERLEDIRTPMDVS  300

Query  301  VIGCKVNGPGEAKEADIGIVGASPRSLVYRNGEKSHLIDTDQLVDEIEDMVRQRVKEIEE  360
            VIGCKVNGPGEAKEADIG+VGA+PRSLVYRNGEKSHLIDT+QLVDEIE MVRQRV+E+EE
Sbjct  301  VIGCKVNGPGEAKEADIGVVGAAPRSLVYRNGEKSHLIDTNQLVDEIETMVRQRVQELEE  360

Query  361  AKSKEIIRSSS  371
            AKSKEIIRSSS
Sbjct  361  AKSKEIIRSSS  371


> Q4FTW7 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) 
[Psychrobacter arcticus (strain DSM 17307 / VKM 
B-2377 / 273-4)]
Length=371

 Score =  577 bits (1488),  Expect = 0.0
 Identities = 285/364 (78%), Positives = 328/364 (90%), Gaps = 0/364 (0%)

Query  5    PIKRRPTRKIRVGSVYVGGDAPISIQSMTNTETCDVDATVAQIQRCADAGVDIMRVSVPS  64
            PI RR T+KI VG V +GGDAPIS+QSMTNT+TCDV ATVAQI+RC +AG D+MRVS P+
Sbjct  6    PINRRLTKKIYVGDVAIGGDAPISVQSMTNTDTCDVAATVAQIERCVEAGADLMRVSTPT  65

Query  65   MEAAEAFGKIRQRVSVPLVADIHFDHRIALAVADYGADCLRINPGNIGSDQKVREVVAAA  124
            M+  +AFG+IR+ VSVPL+AD+HFDH+IALAVA  GADCLRINPGNIGSD KVREVVA A
Sbjct  66   MDTVKAFGEIRKLVSVPLIADVHFDHKIALAVAAAGADCLRINPGNIGSDAKVREVVACA  125

Query  125  RHHGISIRIGVNAGSLEKDLQKKYGEPTGAALLESAMRHIDILDRLDFHEFKVSVKASNV  184
            +H+ I IRIGVNAGSLEKD+Q+KY EP GAA+LESAMRHIDIL+RL+F ++KVSVKASNV
Sbjct  126  KHYNIPIRIGVNAGSLEKDIQRKYKEPNGAAMLESAMRHIDILERLNFDQYKVSVKASNV  185

Query  185  FLTMDAYRLLSQQIDNPLHLGVTEAGIYRTGTVKSAIALGGLLMEGIGDTMRISLAAEPE  244
            FLTMDAYRL+S QIDNPLHLGVTEAG+YRTG+VKSAIALGGLL++GIGDT+RISLAAEPE
Sbjct  186  FLTMDAYRLISAQIDNPLHLGVTEAGVYRTGSVKSAIALGGLLLDGIGDTIRISLAAEPE  245

Query  245  DEVKIGFDILKSLGLRSNGINFIACPSCSRQEFNVIKVMQALEERLEDIRTPMDLSVIGC  304
            +E+KIGFDILKSL +RSNG+NFIACPSCSRQEF+VI+VM ALE RLEDIR PM+LSVIGC
Sbjct  246  EEIKIGFDILKSLNIRSNGVNFIACPSCSRQEFDVIRVMTALESRLEDIREPMNLSVIGC  305

Query  305  KVNGPGEAKEADIGIVGASPRSLVYRNGEKSHLIDTDQLVDEIEDMVRQRVKEIEEAKSK  364
            KVNGPGEAKEADIGIVGA+P+SLVYR GEKSHLIDTD LVDEIE MVR   +E+ + +  
Sbjct  306  KVNGPGEAKEADIGIVGAAPKSLVYRMGEKSHLIDTDNLVDEIEGMVRAHAEELAKKREN  365

Query  365  EIIR  368
            EIIR
Sbjct  366  EIIR  369


> Q1QD18 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) 
[Psychrobacter cryohalolentis (strain ATCC BAA-1226 
/ DSM 17306 / VKM B-2378 / K5)]
Length=371

 Score =  577 bits (1488),  Expect = 0.0
 Identities = 285/364 (78%), Positives = 328/364 (90%), Gaps = 0/364 (0%)

Query  5    PIKRRPTRKIRVGSVYVGGDAPISIQSMTNTETCDVDATVAQIQRCADAGVDIMRVSVPS  64
            PI RR T+KI VG V +GGDAPIS+QSMTNT+TCDV ATVAQI+RC +AG D+MRVS P+
Sbjct  6    PINRRLTKKIYVGDVAIGGDAPISVQSMTNTDTCDVAATVAQIERCVEAGADLMRVSTPT  65

Query  65   MEAAEAFGKIRQRVSVPLVADIHFDHRIALAVADYGADCLRINPGNIGSDQKVREVVAAA  124
            M+  +AFG+IR+ VSVPL+AD+HFDH+IALAVA  GADCLRINPGNIGSD KVREVVA A
Sbjct  66   MDTVKAFGEIRKLVSVPLIADVHFDHKIALAVAAAGADCLRINPGNIGSDAKVREVVACA  125

Query  125  RHHGISIRIGVNAGSLEKDLQKKYGEPTGAALLESAMRHIDILDRLDFHEFKVSVKASNV  184
            +H+ I IRIGVNAGSLEKD+Q+KY EP GAA+LESAMRHIDIL+RL+F ++KVSVKASNV
Sbjct  126  KHYNIPIRIGVNAGSLEKDIQRKYKEPNGAAMLESAMRHIDILERLNFDQYKVSVKASNV  185

Query  185  FLTMDAYRLLSQQIDNPLHLGVTEAGIYRTGTVKSAIALGGLLMEGIGDTMRISLAAEPE  244
            FLTMDAYRL+S QIDNPLHLGVTEAG+YRTG+VKSAIALGGLL++GIGDT+RISLAAEPE
Sbjct  186  FLTMDAYRLISAQIDNPLHLGVTEAGVYRTGSVKSAIALGGLLLDGIGDTIRISLAAEPE  245

Query  245  DEVKIGFDILKSLGLRSNGINFIACPSCSRQEFNVIKVMQALEERLEDIRTPMDLSVIGC  304
            +E+KIGFDILKSL +RSNG+NFIACPSCSRQEF+VI+VM ALE RLEDIR PM+LSVIGC
Sbjct  246  EEIKIGFDILKSLNIRSNGVNFIACPSCSRQEFDVIRVMTALESRLEDIREPMNLSVIGC  305

Query  305  KVNGPGEAKEADIGIVGASPRSLVYRNGEKSHLIDTDQLVDEIEDMVRQRVKEIEEAKSK  364
            KVNGPGEAKEADIGIVGA+P+SLVYR GEKSHLIDTD LVDEIE MVR   +E+ + +  
Sbjct  306  KVNGPGEAKEADIGIVGAAPKSLVYRMGEKSHLIDTDNLVDEIEGMVRAHAEELAKKREN  365

Query  365  EIIR  368
            EIIR
Sbjct  366  EIIR  369


> Q0VNE0 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) 
[Alcanivorax borkumensis (strain ATCC 700651 / DSM 
11573 / NCIMB 13689 / SK2)]
Length=372

 Score =  511 bits (1315),  Expect = 0.0
 Identities = 252/368 (68%), Positives = 305/368 (83%), Gaps = 0/368 (0%)

Query  3    ENPIKRRPTRKIRVGSVYVGGDAPISIQSMTNTETCDVDATVAQIQRCADAGVDIMRVSV  62
            E  I+RR TR++ VG+V VGGDAPIS+QSMTN+ETCDVDATV QI+R  DAGVDI+RVSV
Sbjct  4    EVKIERRKTRQVMVGNVPVGGDAPISVQSMTNSETCDVDATVGQIRRLQDAGVDIVRVSV  63

Query  63   PSMEAAEAFGKIRQRVSVPLVADIHFDHRIALAVADYGADCLRINPGNIGSDQKVREVVA  122
            PSMEAAEAFGKIR++V VPLVADIH+D++IALAVA+ G DCLRINPGNIG + +++ V+ 
Sbjct  64   PSMEAAEAFGKIRKQVDVPLVADIHYDYKIALAVAEQGVDCLRINPGNIGREDRIKAVIQ  123

Query  123  AARHHGISIRIGVNAGSLEKDLQKKYGEPTGAALLESAMRHIDILDRLDFHEFKVSVKAS  182
             A+  G+ IRIGVNAGSLEK+LQ+KYGEPT  AL+ESA+RH DILDR DF  FKVSVKAS
Sbjct  124  CAKDKGLPIRIGVNAGSLEKELQRKYGEPTSDALVESALRHADILDRYDFQNFKVSVKAS  183

Query  183  NVFLTMDAYRLLSQQIDNPLHLGVTEAGIYRTGTVKSAIALGGLLMEGIGDTMRISLAAE  242
            NVF+T+ AYR LS Q++ PLHLGVTEAG +R+GTVKSA+ALG LLMEGIGDT+R+SLAA+
Sbjct  184  NVFMTLQAYRKLSSQLEQPLHLGVTEAGTFRSGTVKSAVALGALLMEGIGDTIRVSLAAD  243

Query  243  PEDEVKIGFDILKSLGLRSNGINFIACPSCSRQEFNVIKVMQALEERLEDIRTPMDLSVI  302
            P +EV++GFDILKSL LR  G+N IACPSCSRQ F+VIK +  LE RLEDI   +DL+VI
Sbjct  244  PVEEVRVGFDILKSLNLRKKGVNIIACPSCSRQNFDVIKTVNELEARLEDINESVDLAVI  303

Query  303  GCKVNGPGEAKEADIGIVGASPRSLVYRNGEKSHLIDTDQLVDEIEDMVRQRVKEIEEAK  362
            GC VNGPGEA+E D+G+ G +P +L YR+GEKSH I  D LVDE+E MVR +VK+  E +
Sbjct  304  GCLVNGPGEAREVDVGLTGGTPNNLAYRDGEKSHHITADDLVDELERMVRAKVKKQREDE  363

Query  363  SKEIIRSS  370
             K II  S
Sbjct  364  EKGIIARS  371


> Q1QTK8 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) 
[Chromohalobacter salexigens (strain ATCC BAA-138 
/ DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)]
Length=371

 Score =  500 bits (1287),  Expect = 1e-179
 Identities = 249/366 (68%), Positives = 312/366 (85%), Gaps = 1/366 (0%)

Query  2    IENPIKRRPTRKIRVGSVYVGGDAPISIQSMTNTETCDVDATVAQIQRCADAGVDIMRVS  61
            +++PI+RR +R+I VG V VGGDAPI++QSMTNT+T DVDATVAQI++   AG DI+RVS
Sbjct  3    MQSPIQRRKSRQIHVGHVPVGGDAPIAVQSMTNTDTLDVDATVAQIRQLEAAGADIVRVS  62

Query  62   VPSMEAAEAFGKIRQRVSVPLVADIHFDHRIALAVADYGADCLRINPGNIGSDQKVREVV  121
            VP+M+AAEAFG+I+++VSVPLVADIHFD++IAL VA+ G DCLRINPGNIG + +VR VV
Sbjct  63   VPTMDAAEAFGQIKRQVSVPLVADIHFDYKIALRVAELGVDCLRINPGNIGREDRVRAVV  122

Query  122  AAARHHGISIRIGVNAGSLEKDLQKKYGEPTGAALLESAMRHIDILDRLDFHEFKVSVKA  181
             AARHHGI IRIGVNAGSLEKDLQKKYGEPT  AL+ESAMRHI+ LDRLDF +FKVSVKA
Sbjct  123  DAARHHGIPIRIGVNAGSLEKDLQKKYGEPTPEALVESAMRHIEHLDRLDFQDFKVSVKA  182

Query  182  SNVFLTMDAYRLLSQQIDNPLHLGVTEAGIYRTGTVKSAIALGGLLMEGIGDTMRISLAA  241
            S+VF+ + AYR L+Q+ID PLHLG+TEAG  R+GTVKS+I LG LLMEGIGDT+R+SLAA
Sbjct  183  SDVFMAVAAYRQLAQRIDQPLHLGITEAGGLRSGTVKSSIGLGLLLMEGIGDTIRVSLAA  242

Query  242  EPEDEVKIGFDILKSLGLRSNGINFIACPSCSRQEFNVIKVMQALEERLEDIRTPMDLSV  301
            +P +E+K+G+D+LKSL LRS GINFIACPSCSRQ F+VI  M ALEERL+DI TP+D+SV
Sbjct  243  DPVEEIKVGYDMLKSLRLRSKGINFIACPSCSRQNFDVIGTMNALEERLDDIMTPLDVSV  302

Query  302  IGCKVNGPGEAKEADIGIVGASPRSLVYRNGEKSHLIDTDQLVDEIEDMVRQRVKEIEEA  361
            IGC VNGPGEAKE+DIG+ G  P +LVY +G+ +  +  D LVD++E ++R +V+E +EA
Sbjct  303  IGCVVNGPGEAKESDIGLTGGDPANLVYIDGKPASKLRNDHLVDDLEALIRDKVRE-KEA  361

Query  362  KSKEII  367
            + ++ I
Sbjct  362  RERDTI  367


> A5VYT5 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) 
[Pseudomonas putida (strain ATCC 700007 / DSM 6899 
/ BCRC 17059 / F1)]
Length=369

 Score =  499 bits (1285),  Expect = 2e-179
 Identities = 253/366 (69%), Positives = 307/366 (84%), Gaps = 1/366 (0%)

Query  3    ENPIKRRPTRKIRVGSVYVGGDAPISIQSMTNTETCDVDATVAQIQRCADAGVDIMRVSV  62
            E+PIKRR +RKI VG+V VGGDAPI++QSMTNT+T DV ATVAQIQR  DAGVDI+RVSV
Sbjct  4    ESPIKRRESRKIWVGNVPVGGDAPIAVQSMTNTDTNDVAATVAQIQRLVDAGVDIVRVSV  63

Query  63   PSMEAAEAFGKIRQRVSVPLVADIHFDHRIALAVADYGADCLRINPGNIGSDQKVREVVA  122
            P M+AAEAFGKI+QRVSVPLVADIHFD++IAL VA+ G DCLRINPGNIG + +VR VV 
Sbjct  64   PDMDAAEAFGKIKQRVSVPLVADIHFDYKIALRVAELGVDCLRINPGNIGREDRVRAVVD  123

Query  123  AARHHGISIRIGVNAGSLEKDLQKKYGEPTGAALLESAMRHIDILDRLDFHEFKVSVKAS  182
            AAR  GI IRIGVNAGSLEKDLQKKYGEPT AAL+ESA+RH++ LDRLDF +FKVSVKAS
Sbjct  124  AARDRGIPIRIGVNAGSLEKDLQKKYGEPTPAALVESALRHVEHLDRLDFQDFKVSVKAS  183

Query  183  NVFLTMDAYRLLSQQIDNPLHLGVTEAGIYRTGTVKSAIALGGLLMEGIGDTMRISLAAE  242
            +VF+ ++AYRLL++QI  PLHLG+TEAG  R+GTVKSA+ LG LL EGIGDT+RISLAA+
Sbjct  184  DVFMAVEAYRLLAKQIVQPLHLGITEAGGLRSGTVKSAVGLGMLLAEGIGDTIRISLAAD  243

Query  243  PEDEVKIGFDILKSLGLRSNGINFIACPSCSRQEFNVIKVMQALEERLEDIRTPMDLSVI  302
            P +EVK+G+DILKSL LRS GINFIACPSCSRQ F+V+K M  LE RLED+  P+D++VI
Sbjct  244  PVEEVKVGYDILKSLHLRSRGINFIACPSCSRQNFDVVKTMNELEGRLEDLLVPLDVAVI  303

Query  303  GCKVNGPGEAKEADIGIVGASPRSLVYRNGEKSHLIDTDQLVDEIEDMVRQRVKEIEEAK  362
            GC VNGPGEAKEA +G+ G +P +L+Y +G+ +  +  D LVDE+E ++RQ+  E  EA 
Sbjct  304  GCVVNGPGEAKEAHVGLTGGTP-NLIYIDGKPAQKLTNDNLVDELEKLIRQKAAEKAEAD  362

Query  363  SKEIIR  368
            +  I+R
Sbjct  363  AALIVR  368


> Q88PJ7 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) 
[Pseudomonas putida (strain ATCC 47054 / DSM 6125 
/ NCIMB 11950 / KT2440)]
Length=369

 Score =  498 bits (1281),  Expect = 8e-179
 Identities = 253/366 (69%), Positives = 306/366 (84%), Gaps = 1/366 (0%)

Query  3    ENPIKRRPTRKIRVGSVYVGGDAPISIQSMTNTETCDVDATVAQIQRCADAGVDIMRVSV  62
            E+PIKRR +RKI VG+V VGGDAPI++QSMTNT+T DV ATVAQIQR  DAGVDI+RVSV
Sbjct  4    ESPIKRRESRKIWVGNVPVGGDAPIAVQSMTNTDTNDVAATVAQIQRLVDAGVDIVRVSV  63

Query  63   PSMEAAEAFGKIRQRVSVPLVADIHFDHRIALAVADYGADCLRINPGNIGSDQKVREVVA  122
            P M+AAEAFGKI+QRVSVPLVADIHFD++IAL VA+ G DCLRINPGNIG + +VR VV 
Sbjct  64   PDMDAAEAFGKIKQRVSVPLVADIHFDYKIALRVAELGVDCLRINPGNIGREDRVRAVVD  123

Query  123  AARHHGISIRIGVNAGSLEKDLQKKYGEPTGAALLESAMRHIDILDRLDFHEFKVSVKAS  182
            AAR  GI IRIGVNAGSLEKDLQKKYGEPT AAL+ESA+RH++ LDRLDF +FKVSVKAS
Sbjct  124  AARDRGIPIRIGVNAGSLEKDLQKKYGEPTPAALVESALRHVEHLDRLDFQDFKVSVKAS  183

Query  183  NVFLTMDAYRLLSQQIDNPLHLGVTEAGIYRTGTVKSAIALGGLLMEGIGDTMRISLAAE  242
            +VF+ ++AYRLL++QI  PLHLG+TEAG  R+GTVKSA+ LG LL EGIGDT+RISLAA+
Sbjct  184  DVFMAVEAYRLLAKQIVQPLHLGITEAGGLRSGTVKSAVGLGMLLAEGIGDTIRISLAAD  243

Query  243  PEDEVKIGFDILKSLGLRSNGINFIACPSCSRQEFNVIKVMQALEERLEDIRTPMDLSVI  302
            P +EVK+G+DILKSL LRS GINFIACPSCSRQ F+V+K M  LE RLED+  P+D++VI
Sbjct  244  PVEEVKVGYDILKSLHLRSRGINFIACPSCSRQNFDVVKTMNELEGRLEDLLVPLDVAVI  303

Query  303  GCKVNGPGEAKEADIGIVGASPRSLVYRNGEKSHLIDTDQLVDEIEDMVRQRVKEIEEAK  362
            GC VNGPGEAKEA +G+ G +P +L+Y +G+ +  +  D LVDE+E ++RQ+  E  EA 
Sbjct  304  GCVVNGPGEAKEAHVGLTGGTP-NLIYIDGKPAQKLTNDNLVDELEKLIRQKAAEKAEAD  362

Query  363  SKEIIR  368
            +  I R
Sbjct  363  AALIAR  368


> B0KPI7 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) 
[Pseudomonas putida (strain GB-1)]
Length=369

 Score =  496 bits (1277),  Expect = 3e-178
 Identities = 252/366 (69%), Positives = 306/366 (84%), Gaps = 1/366 (0%)

Query  3    ENPIKRRPTRKIRVGSVYVGGDAPISIQSMTNTETCDVDATVAQIQRCADAGVDIMRVSV  62
            E+PIKRR +RKI VG+V VGGDAPI++QSMTNT+T DV ATVAQIQR  DAGVDI+RVSV
Sbjct  4    ESPIKRRESRKIWVGNVPVGGDAPIAVQSMTNTDTNDVAATVAQIQRLVDAGVDIVRVSV  63

Query  63   PSMEAAEAFGKIRQRVSVPLVADIHFDHRIALAVADYGADCLRINPGNIGSDQKVREVVA  122
            P M+AAEAFGKI+Q VSVPLVADIHFD++IAL VA+ G DCLRINPGNIG + +VR VV 
Sbjct  64   PDMDAAEAFGKIKQLVSVPLVADIHFDYKIALRVAELGVDCLRINPGNIGREDRVRAVVD  123

Query  123  AARHHGISIRIGVNAGSLEKDLQKKYGEPTGAALLESAMRHIDILDRLDFHEFKVSVKAS  182
            AAR  GI IRIGVNAGSLEKDLQKKYGEPT AAL+ESA+RH++ LDRLDF +FKVSVKAS
Sbjct  124  AARDRGIPIRIGVNAGSLEKDLQKKYGEPTPAALVESALRHVEHLDRLDFQDFKVSVKAS  183

Query  183  NVFLTMDAYRLLSQQIDNPLHLGVTEAGIYRTGTVKSAIALGGLLMEGIGDTMRISLAAE  242
            +VF+ ++AYRLL++QI  PLHLG+TEAG  R+GTVKSA+ LG LL EGIGDT+RISLAA+
Sbjct  184  DVFMAVEAYRLLAKQIVQPLHLGITEAGGLRSGTVKSAVGLGMLLAEGIGDTIRISLAAD  243

Query  243  PEDEVKIGFDILKSLGLRSNGINFIACPSCSRQEFNVIKVMQALEERLEDIRTPMDLSVI  302
            P +EVK+G+DILKSL LRS GINFIACPSCSRQ F+V+K M  LE RLED+  P+D++VI
Sbjct  244  PVEEVKVGYDILKSLHLRSRGINFIACPSCSRQNFDVVKTMNELEGRLEDLLVPLDVAVI  303

Query  303  GCKVNGPGEAKEADIGIVGASPRSLVYRNGEKSHLIDTDQLVDEIEDMVRQRVKEIEEAK  362
            GC VNGPGEAKEA +G+ G +P +L+Y +G+ +  +  D LVDE+E ++RQ+  E  EA 
Sbjct  304  GCVVNGPGEAKEAHVGLTGGTP-NLIYIDGKPAQKLTNDNLVDELEKLIRQKAAEKVEAD  362

Query  363  SKEIIR  368
            +  I+R
Sbjct  363  AALIVR  368


> A6V0W0 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) 
[Pseudomonas aeruginosa (strain PA7)]
Length=371

 Score =  495 bits (1274),  Expect = 1e-177
 Identities = 252/365 (69%), Positives = 301/365 (82%), Gaps = 1/365 (0%)

Query  4    NPIKRRPTRKIRVGSVYVGGDAPISIQSMTNTETCDVDATVAQIQRCADAGVDIMRVSVP  63
            +PI RR +RKI VG+V VGGDAPI++QSMTNTETCDV ATVAQI+R  DAG DI+RVSVP
Sbjct  7    SPITRRKSRKIWVGNVPVGGDAPIAVQSMTNTETCDVAATVAQIRRLEDAGADIVRVSVP  66

Query  64   SMEAAEAFGKIRQRVSVPLVADIHFDHRIALAVADYGADCLRINPGNIGSDQKVREVVAA  123
             M+AAEAFGKI+Q+V+VPLVADIHFD+RIAL VA+ G DCLRINPGNIG + +V+ VV A
Sbjct  67   DMDAAEAFGKIKQQVNVPLVADIHFDYRIALRVAELGVDCLRINPGNIGREDRVKAVVDA  126

Query  124  ARHHGISIRIGVNAGSLEKDLQKKYGEPTGAALLESAMRHIDILDRLDFHEFKVSVKASN  183
            AR   I IRIGVNAGSLEKDLQKKYGEPT  ALLESAMRH+D LD+LDF  FKVSVKAS+
Sbjct  127  ARERNIPIRIGVNAGSLEKDLQKKYGEPTPEALLESAMRHVDHLDKLDFQNFKVSVKASD  186

Query  184  VFLTMDAYRLLSQQIDNPLHLGVTEAGIYRTGTVKSAIALGGLLMEGIGDTMRISLAAEP  243
            VF+ + AYRLL++QI+ PLHLG+TEAG  R+GTVKSA+ LG LL EGIGDT+RISLAA+P
Sbjct  187  VFMAVAAYRLLARQIEQPLHLGITEAGGLRSGTVKSAVGLGMLLAEGIGDTIRISLAADP  246

Query  244  EDEVKIGFDILKSLGLRSNGINFIACPSCSRQEFNVIKVMQALEERLEDIRTPMDLSVIG  303
             +E+K+GFDILKSL LRS GINFIACPSCSRQ F+V+K M  LE RLED+  PMD++VIG
Sbjct  247  VEEIKVGFDILKSLHLRSRGINFIACPSCSRQNFDVVKTMNELEGRLEDLLVPMDVAVIG  306

Query  304  CKVNGPGEAKEADIGIVGASPRSLVYRNGEKSHLIDTDQLVDEIEDMVRQRVKEIEEAKS  363
            C VNGPGEAKEA +G+ G +P +LVY +G+ S  +  D LVDE+E ++RQ+  E  EA +
Sbjct  307  CVVNGPGEAKEAHVGLTGGTP-NLVYIDGKPSQKLTNDNLVDELERLIRQKAAEKAEADA  365

Query  364  KEIIR  368
              I R
Sbjct  366  SLIAR  370


> Q1IEI1 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) 
[Pseudomonas entomophila (strain L48)]
Length=369

 Score =  494 bits (1273),  Expect = 1e-177
 Identities = 252/366 (69%), Positives = 306/366 (84%), Gaps = 1/366 (0%)

Query  3    ENPIKRRPTRKIRVGSVYVGGDAPISIQSMTNTETCDVDATVAQIQRCADAGVDIMRVSV  62
            E+PIKRR +RKI VG+V VGGDAPI++QSMTNT+T DV ATVAQIQR  DAGVDI+RVSV
Sbjct  4    ESPIKRRESRKIWVGNVPVGGDAPIAVQSMTNTDTNDVAATVAQIQRLVDAGVDIVRVSV  63

Query  63   PSMEAAEAFGKIRQRVSVPLVADIHFDHRIALAVADYGADCLRINPGNIGSDQKVREVVA  122
            P M+AAEAFGKI++ VSVPLVADIHFD++IAL VA+ G DCLRINPGNIG + +VR VV 
Sbjct  64   PDMDAAEAFGKIKKLVSVPLVADIHFDYKIALRVAELGVDCLRINPGNIGREDRVRAVVD  123

Query  123  AARHHGISIRIGVNAGSLEKDLQKKYGEPTGAALLESAMRHIDILDRLDFHEFKVSVKAS  182
            AAR  GI IRIGVNAGSLEKDLQKKYGEPT AAL+ESA+RH++ LDRLDF +FKVSVKAS
Sbjct  124  AARDRGIPIRIGVNAGSLEKDLQKKYGEPTPAALVESALRHVEHLDRLDFQDFKVSVKAS  183

Query  183  NVFLTMDAYRLLSQQIDNPLHLGVTEAGIYRTGTVKSAIALGGLLMEGIGDTMRISLAAE  242
            +VF+ ++AYRLL++QI  PLHLG+TEAG  R+GTVKSA+ LG LL EGIGDT+RISLAA+
Sbjct  184  DVFMAVEAYRLLAKQIIQPLHLGITEAGGLRSGTVKSAVGLGMLLAEGIGDTIRISLAAD  243

Query  243  PEDEVKIGFDILKSLGLRSNGINFIACPSCSRQEFNVIKVMQALEERLEDIRTPMDLSVI  302
            P +EVK+G+DILKSL LRS GINFIACPSCSRQ F+V+K M  LE RLED+  P+D++VI
Sbjct  244  PVEEVKVGYDILKSLHLRSRGINFIACPSCSRQNFDVVKTMNELEGRLEDLLVPLDVAVI  303

Query  303  GCKVNGPGEAKEADIGIVGASPRSLVYRNGEKSHLIDTDQLVDEIEDMVRQRVKEIEEAK  362
            GC VNGPGEAKE+ +G+ G +P +LVY +G+ S  ++ D LVDE+E ++RQ+  E  EA 
Sbjct  304  GCVVNGPGEAKESHVGLTGGTP-NLVYIDGKPSQKLNNDNLVDELEKLIRQKAAEKAEAD  362

Query  363  SKEIIR  368
            +  I R
Sbjct  363  AALIAR  368


> P72241 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) 
[Providencia stuartii]
Length=365

 Score =  473 bits (1218),  Expect = 3e-169
 Identities = 235/359 (65%), Positives = 296/359 (82%), Gaps = 1/359 (0%)

Query  3    ENPIKRRPTRKIRVGSVYVGGDAPISIQSMTNTETCDVDATVAQIQRCADAGVDIMRVSV  62
            E+PIKRR + +I VG+V +G  API++QSMTNT T DV+ATV QIQ     GVDI+RVSV
Sbjct  4    ESPIKRRKSTRIYVGNVPIGDGAPIAVQSMTNTRTTDVEATVRQIQSLERVGVDIVRVSV  63

Query  63   PSMEAAEAFGKIRQRVSVPLVADIHFDHRIALAVADYGADCLRINPGNIGSDQKVREVVA  122
            P+M+AAEAF  I+QRV+VPLVADIHFD+RIA+ VA+YG DCLRINPGNIGS++++R+VV 
Sbjct  64   PTMDAAEAFKLIKQRVNVPLVADIHFDYRIAMKVAEYGVDCLRINPGNIGSEERIRQVVD  123

Query  123  AARHHGISIRIGVNAGSLEKDLQKKYGEPTGAALLESAMRHIDILDRLDFHEFKVSVKAS  182
            +ARHH I IRIGVN GSLEKD+Q+KYGEPT  AL+ESAMRH+DILDRL+F +FKVSVKAS
Sbjct  124  SARHHNIPIRIGVNGGSLEKDIQEKYGEPTPEALVESAMRHVDILDRLNFDQFKVSVKAS  183

Query  183  NVFLTMDAYRLLSQQIDNPLHLGVTEAGIYRTGTVKSAIALGGLLMEGIGDTMRISLAAE  242
            +VFL + +YRLL+Q+ID PLHLG+TEAG  R+G+VKSAI LG LL EGIGDT+RISLAA+
Sbjct  184  DVFLAVGSYRLLAQKIDQPLHLGITEAGGARSGSVKSAIGLGMLLAEGIGDTLRISLAAD  243

Query  243  PEDEVKIGFDILKSLGLRSNGINFIACPSCSRQEFNVIKVMQALEERLEDIRTPMDLSVI  302
            P +EVK+GFDILKSL +RS GINFIACP+CSRQEF+VI  + ALE+RLEDI TPMD+S+I
Sbjct  244  PVEEVKVGFDILKSLRIRSRGINFIACPTCSRQEFDVIGTVNALEQRLEDIITPMDVSII  303

Query  303  GCKVNGPGEAKEADIGIVGASPRSLVYRNG-EKSHLIDTDQLVDEIEDMVRQRVKEIEE  360
            GC VNGPGEA+ + +G+ GA  +S  Y +G  K    D D ++D++E  +R +   ++E
Sbjct  304  GCVVNGPGEAEVSTLGVAGAKTKSGFYEDGVRKKERFDNDNIIDQLEAKIRAKAAMLDE  362


> P62620 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) 
[Escherichia coli (strain K12)]
Length=372

 Score =  460 bits (1183),  Expect = 6e-164
 Identities = 226/362 (62%), Positives = 295/362 (81%), Gaps = 0/362 (0%)

Query  5    PIKRRPTRKIRVGSVYVGGDAPISIQSMTNTETCDVDATVAQIQRCADAGVDIMRVSVPS  64
            PI+RR + +I VG+V +G  API++QSMTNT T DV+ATV QI+     G DI+RVSVP+
Sbjct  6    PIQRRKSTRIYVGNVPIGDGAPIAVQSMTNTRTTDVEATVNQIKALERVGADIVRVSVPT  65

Query  65   MEAAEAFGKIRQRVSVPLVADIHFDHRIALAVADYGADCLRINPGNIGSDQKVREVVAAA  124
            M+AAEAF  I+Q+V+VPLVADIHFD+RIAL VA+YG DCLRINPGNIG+++++R VV  A
Sbjct  66   MDAAEAFKLIKQQVNVPLVADIHFDYRIALKVAEYGVDCLRINPGNIGNEERIRMVVDCA  125

Query  125  RHHGISIRIGVNAGSLEKDLQKKYGEPTGAALLESAMRHIDILDRLDFHEFKVSVKASNV  184
            R   I IRIGVNAGSLEKDLQ+KYGEPT  ALLESAMRH+D LDRL+F +FKVSVKAS+V
Sbjct  126  RDKNIPIRIGVNAGSLEKDLQEKYGEPTPQALLESAMRHVDHLDRLNFDQFKVSVKASDV  185

Query  185  FLTMDAYRLLSQQIDNPLHLGVTEAGIYRTGTVKSAIALGGLLMEGIGDTMRISLAAEPE  244
            FL +++YRLL++QID PLHLG+TEAG  R+G VKSAI LG LL EGIGDT+R+SLAA+P 
Sbjct  186  FLAVESYRLLAKQIDQPLHLGITEAGGARSGAVKSAIGLGLLLSEGIGDTLRVSLAADPV  245

Query  245  DEVKIGFDILKSLGLRSNGINFIACPSCSRQEFNVIKVMQALEERLEDIRTPMDLSVIGC  304
            +E+K+GFDILKSL +RS GINFIACP+CSRQEF+VI  + ALE+RLEDI TPMD+S+IGC
Sbjct  246  EEIKVGFDILKSLRIRSRGINFIACPTCSRQEFDVIGTVNALEQRLEDIITPMDVSIIGC  305

Query  305  KVNGPGEAKEADIGIVGASPRSLVYRNGEKSHLIDTDQLVDEIEDMVRQRVKEIEEAKSK  364
             VNGPGEA  + +G+ G + +S +Y +G +   +D + ++D++E  +R +  +++EA+  
Sbjct  306  VVNGPGEALVSTLGVTGGNKKSGLYEDGVRKDRLDNNDMIDQLEARIRAKASQLDEARRI  365

Query  365  EI  366
            ++
Sbjct  366  DV  367


> O67496 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) 
[Aquifex aeolicus (strain VF5)]
Length=357

 Score =  319 bits (817),  Expect = 7e-109
 Identities = 157/352 (45%), Positives = 246/352 (70%), Gaps = 0/352 (0%)

Query  6    IKRRPTRKIRVGSVYVGGDAPISIQSMTNTETCDVDATVAQIQRCADAGVDIMRVSVPSM  65
            I++R TR+IRVG+V +GGDAPI +QSMT+T+T DV+AT+ QI+R  +AG +I+RV+VP  
Sbjct  2    IQKRKTRQIRVGNVKIGGDAPIVVQSMTSTKTHDVEATLNQIKRLYEAGCEIVRVAVPHK  61

Query  66   EAAEAFGKIRQRVSVPLVADIHFDHRIALAVADYGADCLRINPGNIGSDQKVREVVAAAR  125
            E  EA  +I ++  +P++ADIHF    A    + G   +RINPGNIG ++ VRE+V  A+
Sbjct  62   EDVEALEEIVKKSPMPVIADIHFAPSYAFLSMEKGVHGIRINPGNIGKEEIVREIVEEAK  121

Query  126  HHGISIRIGVNAGSLEKDLQKKYGEPTGAALLESAMRHIDILDRLDFHEFKVSVKASNVF  185
              G+++RIGVN+GSLEKDL +KYG P+  AL ESA+R  +  ++  F  +KVS+K S+V 
Sbjct  122  RRGVAVRIGVNSGSLEKDLLEKYGYPSAEALAESALRWSEKFEKWGFTNYKVSIKGSDVL  181

Query  186  LTMDAYRLLSQQIDNPLHLGVTEAGIYRTGTVKSAIALGGLLMEGIGDTMRISLAAEPED  245
              + A  + +++ D PLH+G+TEAG+   G +KS++ +G LL  GIGDT+R+SL  +P  
Sbjct  182  QNVRANLIFAERTDVPLHIGITEAGMGTKGIIKSSVGIGILLYMGIGDTVRVSLTDDPVV  241

Query  246  EVKIGFDILKSLGLRSNGINFIACPSCSRQEFNVIKVMQALEERLEDIRTPMDLSVIGCK  305
            EV+  ++ILKSLGLR  G+  +ACP+C R E ++ KV++ ++E+L  ++TP+ ++V+GC 
Sbjct  242  EVETAYEILKSLGLRRRGVEIVACPTCGRIEVDLPKVVKEVQEKLSGVKTPLKVAVMGCV  301

Query  306  VNGPGEAKEADIGIVGASPRSLVYRNGEKSHLIDTDQLVDEIEDMVRQRVKE  357
            VN  GEA+EADIG+      + ++++G+    +D  ++VDE+   ++   K+
Sbjct  302  VNAIGEAREADIGLACGRGFAWLFKHGKPIKKVDESEMVDELLKEIQNMEKD  353


> Q9X7W2 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) 
1 [Streptomyces coelicolor (strain ATCC BAA-471 
/ A3(2) / M145)]
Length=384

 Score =  310 bits (794),  Expect = 4e-105
 Identities = 152/355 (43%), Positives = 233/355 (66%), Gaps = 1/355 (0%)

Query  7    KRRPTRKIRVGSVYVGGDAPISIQSMTNTETCDVDATVAQIQRCADAGVDIMRVSVPSME  66
            +RR +R+I+VG V VGG AP+S+QSMT T T D+ AT+ QI     +G  I+RV+ P+ +
Sbjct  18   ERRVSRRIQVGPVAVGGGAPVSVQSMTTTRTSDIGATLQQIAELTASGCQIVRVACPTQD  77

Query  67   AAEAFGKIRQRVSVPLVADIHFDHRIALAVADYGADCLRINPGNIGS-DQKVREVVAAAR  125
             A+A   I ++  +P++ADIHF  +   A  + G   +R+NPGNI   D KV+E+  AA+
Sbjct  78   DADALPVIARKSQIPVIADIHFQPKYVFAAIEAGCAAVRVNPGNIKQFDDKVKEIAKAAK  137

Query  126  HHGISIRIGVNAGSLEKDLQKKYGEPTGAALLESAMRHIDILDRLDFHEFKVSVKASNVF  185
             HG  IRIGVNAGSL++ L +KYG  T  AL ESA+    + +  DF + K+SVK ++  
Sbjct  138  DHGTPIRIGVNAGSLDRRLLQKYGRATPEALAESALWEASLFEEHDFRDIKISVKHNDPV  197

Query  186  LTMDAYRLLSQQIDNPLHLGVTEAGIYRTGTVKSAIALGGLLMEGIGDTMRISLAAEPED  245
            + ++AYR L+ Q D PLHLGVTEAG    GT+KSA+A G LL +GIGDT+R+SL+  P +
Sbjct  198  VMVEAYRQLAAQCDYPLHLGVTEAGPAFQGTIKSAVAFGALLSQGIGDTIRVSLSTPPVE  257

Query  246  EVKIGFDILKSLGLRSNGINFIACPSCSRQEFNVIKVMQALEERLEDIRTPMDLSVIGCK  305
            E+K+G  IL+SL LR  G+  ++CPSC R + +V K+ + +   LE +  P+ ++V+GC 
Sbjct  258  EIKVGIQILESLNLRQRGLEIVSCPSCGRAQVDVYKLAEEVTAGLEGMEVPLRVAVMGCV  317

Query  306  VNGPGEAKEADIGIVGASPRSLVYRNGEKSHLIDTDQLVDEIEDMVRQRVKEIEE  360
            VNGPGEA+EAD+G+   + +  ++  GE    +   ++V+ + +   +  +++E+
Sbjct  318  VNGPGEAREADLGVASGNGKGQIFVKGEVVKTVPESKIVETLIEEAMRIAEQMEK  372


> Q8DK70 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (ferredoxin) 
[Thermosynechococcus elongatus (strain BP-1)]
Length=402

 Score =  244 bits (624),  Expect = 2e-79
 Identities = 152/386 (39%), Positives = 232/386 (60%), Gaps = 41/386 (11%)

Query  3    ENPIKRRPTRKIRVGSVYVGGDAPISIQSMTNTETCDVDATVAQIQRCADAGVDIMRVSV  62
            E  I RR TR + +GSV +GG  P+++QSM N +T D++ +VA I+R  + G +I+RV+V
Sbjct  14   ETAIVRRKTRPVPIGSVVIGGGHPVAVQSMINEDTLDIEGSVAAIRRLHEIGCEIVRVTV  73

Query  63   PSMEAAEAFGKIRQRV-----SVPLVADIHFDH-RIALAVADYGADCLRINPG-------  109
            PS+  A+A  +IR R+      VPLVAD+H +  +IAL VA Y  D +RINPG       
Sbjct  74   PSLAHAKAMEEIRDRLYKTYKPVPLVADVHHNGMKIALEVAKY-VDNVRINPGLYVFEKP  132

Query  110  -------------NIGSDQKVRE----VVAAARHHGISIRIGVNAGSLEKDLQKKYGEPT  152
                          IG+  K+RE    +V + R  G S+RIGVN GSL + +   YG+ T
Sbjct  133  KPNRTEYTQAEFDEIGA--KIRETLEPLVISLRDQGKSMRIGVNHGSLAERMLFTYGD-T  189

Query  153  GAALLESAMRHIDILDRLDFHEFKVSVKASNVFLTMDAYRLLSQQIDN-----PLHLGVT  207
               ++ESA+  I I + L+F+  ++S+KAS V + + A RL+ +++D      PLHLGVT
Sbjct  190  PEGMVESALEFIRICESLNFYNLEISLKASRVPVMIAANRLMVKRMDELGMDYPLHLGVT  249

Query  208  EAGIYRTGTVKSAIALGGLLMEGIGDTMRISLAAEPEDEVKIGFDILKSLGLRSNGINFI  267
            EAG    G +KS   +  LL EGIGDT+R+SL   PE E+ + + IL++LGLR   + ++
Sbjct  250  EAGDGEYGRIKSTAGIATLLAEGIGDTIRVSLTEAPEKEIPVCYGILQALGLRRTMVEYV  309

Query  268  ACPSCSRQEFNVIKVMQALEERLEDIRTPMDLSVIGCKVNGPGEAKEADIGIVGASPRSL  327
            ACPSC R  FN+ +V+  + E  + + T ++++V+GC VNGPGE  +AD G VG  P  +
Sbjct  310  ACPSCGRTLFNLEEVLHKVREATKHL-TGLNIAVMGCIVNGPGEMADADYGYVGKQPGYI  368

Query  328  -VYRNGEKSHLIDTDQLVDEIEDMVR  352
             +YR  E+   +   + V  + ++++
Sbjct  369  SLYRGREEVKKVPEAEGVAALVELIK  394


> Q72H18 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) 
[Thermus thermophilus (strain HB27 / ATCC BAA-163 
/ DSM 7039)]
Length=406

 Score =  209 bits (533),  Expect = 5e-66
 Identities = 150/397 (38%), Positives = 216/397 (54%), Gaps = 50/397 (13%)

Query  8    RRPTRKIRVGSVYVGGDAPISIQSMTNTETCDVDATVAQIQRCADAGVDIMRVSVPSMEA  67
            RRPT  + VG V +GG  PI++QSMTNT T DV+AT AQ+     AG +I+R++V   EA
Sbjct  5    RRPTPTVYVGRVPIGGAHPIAVQSMTNTPTRDVEATTAQVLELHRAGSEIVRLTVNDEEA  64

Query  68   AEAFGKIRQR-----VSVPLVADIHFDHRIALAVADYGADCL---RINPGNIG----SDQ  115
            A+A  +I++R     V VPLV D HF+  + L      A+ L   RINPG +G     D+
Sbjct  65   AKAVPEIKRRLLAEGVEVPLVGDFHFNGHLLLRKYPKMAEALDKFRINPGTLGRGRHKDE  124

Query  116  KVREVVAAARHHGISIRIGVNAGSLE-------KDLQKKYGEPTGA------ALLESAMR  162
               E++  A   G  +RIG N GSL+        D      EP  A      AL+ESA+R
Sbjct  125  HFAEMIRIAMDLGKPVRIGANWGSLDPALLTELMDRNASRPEPKSAHEVVLEALVESAVR  184

Query  163  HIDILDRLDFHEFK--VSVKASNVFLTMDAYRLLSQQIDNPLHLGVTEAGIYRTGTVKSA  220
              +    +   E K  +S K S     +  YR L+++   PLHLG+TEAG+   G V SA
Sbjct  185  AYEAALEMGLGEDKLVLSAKVSKARDLVWVYRELARRTQAPLHLGLTEAGMGVKGIVASA  244

Query  221  IALGGLLMEGIGDTMRISLAAEPED----EVKIGFDILKSLGLRSNGINFIACPSCSRQE  276
             AL  LL+EGIGDT+R+SL   P++    EV++  +IL++LGLR+      +CP C R  
Sbjct  245  AALAPLLLEGIGDTIRVSLTPSPKEPRTKEVEVAQEILQALGLRAFAPEVTSCPGCGRTT  304

Query  277  FNVI-----KVMQALEERLEDIRT------PMDLSVIGCKVNGPGEAKEADIGI----VG  321
                     +V + L+ERL + R        + ++V+GC VNGPGE+K A IGI     G
Sbjct  305  STFFQELAEEVSRRLKERLPEWRARYPGVEELKVAVMGCVVNGPGESKHAHIGISLPGAG  364

Query  322  ASPRSLVYRNGEKSHLIDTDQLVDE----IEDMVRQR  354
              P++ VY +G+   ++  + + +E    +ED V+ R
Sbjct  365  EEPKAPVYADGKLLTILKGEGIAEEFLRLVEDYVKTR  401


> Q84GJ3 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) 
[Thermus thermophilus]
Length=406

 Score =  209 bits (533),  Expect = 5e-66
 Identities = 150/397 (38%), Positives = 216/397 (54%), Gaps = 50/397 (13%)

Query  8    RRPTRKIRVGSVYVGGDAPISIQSMTNTETCDVDATVAQIQRCADAGVDIMRVSVPSMEA  67
            RRPT  + VG V +GG  PI++QSMTNT T DV+AT AQ+     AG +I+R++V   EA
Sbjct  5    RRPTPTVYVGRVPIGGAHPIAVQSMTNTPTRDVEATTAQVLELHRAGSEIVRLTVNDEEA  64

Query  68   AEAFGKIRQR-----VSVPLVADIHFDHRIALAVADYGADCL---RINPGNIG----SDQ  115
            A+A  +I++R     V VPLV D HF+  + L      A+ L   RINPG +G     D+
Sbjct  65   AKAVPEIKRRLLAEGVEVPLVGDFHFNGHLLLRKYPKMAEALDKFRINPGTLGRGRHKDE  124

Query  116  KVREVVAAARHHGISIRIGVNAGSLE-------KDLQKKYGEPTGA------ALLESAMR  162
               E++  A   G  +RIG N GSL+        D      EP  A      AL+ESA+R
Sbjct  125  HFAEMIRIAMDLGKPVRIGANWGSLDPALLTELMDRNASRPEPKSAHEVVLEALVESAVR  184

Query  163  HIDILDRLDFHEFK--VSVKASNVFLTMDAYRLLSQQIDNPLHLGVTEAGIYRTGTVKSA  220
              +    +   E K  +S K S     +  YR L+++   PLHLG+TEAG+   G V SA
Sbjct  185  AYEAALEMGLGEDKLVLSAKVSKARDLVWVYRELARRTQAPLHLGLTEAGMGVKGIVASA  244

Query  221  IALGGLLMEGIGDTMRISLAAEPED----EVKIGFDILKSLGLRSNGINFIACPSCSRQE  276
             AL  LL+EGIGDT+R+SL   P++    EV++  +IL++LGLR+      +CP C R  
Sbjct  245  AALAPLLLEGIGDTIRVSLTPSPKEPRTKEVEVAQEILQALGLRAFAPEVTSCPGCGRTT  304

Query  277  FNVI-----KVMQALEERLEDIRT------PMDLSVIGCKVNGPGEAKEADIGI----VG  321
                     +V + L+ERL + R        + ++V+GC VNGPGE+K A IGI     G
Sbjct  305  STFFQELAEEVSRRLKERLPEWRARYPGVEELKVAVMGCVVNGPGESKHAHIGISLPGAG  364

Query  322  ASPRSLVYRNGEKSHLIDTDQLVDE----IEDMVRQR  354
              P++ VY +G+   ++  + + +E    +ED V+ R
Sbjct  365  EEPKAPVYADGKLLTILKGEGIAEEFLRLVEDYVKTR  401


> Q6K8J4 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (ferredoxin), 
chloroplastic [Oryza sativa subsp. japonica]
Length=744

 Score =  180 bits (457),  Expect = 2e-53
 Identities = 111/274 (41%), Positives = 159/274 (58%), Gaps = 36/274 (13%)

Query  7    KRRPTRKIRVGSVYVGGDAPISIQSMTNTETCDVDATVAQIQRCADAGVDIMRVSVPSME  66
            +RR TR + VG+V +G D PI IQ+MT ++T DV  TV ++ R AD G D +R++V   +
Sbjct  86   RRRKTRTVMVGNVPLGSDHPIRIQTMTTSDTKDVAKTVEEVMRIADKGADFVRITVQGRK  145

Query  67   AAEAFGKIRQRV-----SVPLVADIHFDHRIALAVADYGADCLRINPGNIGSDQKVRE--  119
             A+A  +I+  +     ++PLVADIHF   +AL VA+   D +R+NPGN    +   E  
Sbjct  146  EADACFEIKNTLVQKNYNIPLVADIHFAPTVALRVAEC-FDKIRVNPGNFADRRAQFEQL  204

Query  120  --------------------VVAAARHHGISIRIGVNAGSLEKDLQKKYGE-PTGAALLE  158
                                +V   + +G ++RIG N GSL   +   YG+ P G  ++E
Sbjct  205  EYTEDDYQKELEHIEKVFSPLVEKCKQYGRAMRIGTNHGSLSDRIMSYYGDSPRG--MVE  262

Query  159  SAMRHIDILDRLDFHEFKVSVKASNVFLTMDAYRLLSQQI-----DNPLHLGVTEAGIYR  213
            SA+    I  +LDFH F  S+KASN  + + AYRLL  ++     D PLHLGVTEAG   
Sbjct  263  SALEFARICRKLDFHNFVFSMKASNPVIMVQAYRLLVAEMYNLGWDYPLHLGVTEAGEGE  322

Query  214  TGTVKSAIALGGLLMEGIGDTMRISLAAEPEDEV  247
             G +KSAI +G LLM+G+GDT+R+SL   PE+E+
Sbjct  323  DGRMKSAIGIGTLLMDGLGDTIRVSLTEPPEEEI  356


 Score = 68.6 bits (166),  Expect = 2e-15
 Identities = 32/103 (31%), Positives = 63/103 (61%), Gaps = 2/103 (2%)

Query  223  LGGLLMEGIGDTMRISLAAEPEDEVK-IGFDILKSLGLRSNGINFIACPSCSRQEFNVIK  281
            +G LL++G+GD + +  A +  + ++   F++L+   +R+    +++CPSC R  F++ +
Sbjct  601  VGALLVDGLGDGVLLEAADQEFEFLRDTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQE  660

Query  282  VMQALEERLEDIRTPMDLSVIGCKVNGPGEAKEADIGIVGASP  324
            V   + E+   +   + ++++GC VNGPGE  +AD G VG +P
Sbjct  661  VSAQIREKTSHL-PGVSIAIMGCIVNGPGEMADADFGYVGGAP  702


> F4K0E8 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (ferredoxin), 
chloroplastic [Arabidopsis thaliana]
Length=741

 Score =  178 bits (452),  Expect = 1e-52
 Identities = 108/273 (40%), Positives = 158/273 (58%), Gaps = 36/273 (13%)

Query  8    RRPTRKIRVGSVYVGGDAPISIQSMTNTETCDVDATVAQIQRCADAGVDIMRVSVPSMEA  67
            RR TR + VG+V +G + PI IQ+MT ++T D+  TV ++ R AD G DI+R++V   + 
Sbjct  84   RRKTRTVMVGNVALGSEHPIRIQTMTTSDTKDITGTVDEVMRIADKGADIVRITVQGKKE  143

Query  68   AEAFGKIRQRV-----SVPLVADIHFDHRIALAVADYGADCLRINPGNIGS---------  113
            A+A  +I+ ++     ++PLVADIHF   +AL VA+   D +R+NPGN            
Sbjct  144  ADACFEIKDKLVQLNYNIPLVADIHFAPTVALRVAEC-FDKIRVNPGNFADRRAQFETID  202

Query  114  -------------DQKVREVVAAARHHGISIRIGVNAGSLEKDLQKKYGE-PTGAALLES  159
                         +Q    +V   + +G ++RIG N GSL   +   YG+ P G  ++ES
Sbjct  203  YTEDEYQKELQHIEQVFTPLVEKCKKYGRAMRIGTNHGSLSDRIMSYYGDSPRG--MVES  260

Query  160  AMRHIDILDRLDFHEFKVSVKASNVFLTMDAYRLLSQQI-----DNPLHLGVTEAGIYRT  214
            A     I  +LD+H F  S+KASN  + + AYRLL  ++     D PLHLGVTEAG    
Sbjct  261  AFEFARICRKLDYHNFVFSMKASNPVIMVQAYRLLVAEMYVHGWDYPLHLGVTEAGEGED  320

Query  215  GTVKSAIALGGLLMEGIGDTMRISLAAEPEDEV  247
            G +KSAI +G LL +G+GDT+R+SL   PE+E+
Sbjct  321  GRMKSAIGIGTLLQDGLGDTIRVSLTEPPEEEI  353


 Score = 73.2 bits (178),  Expect = 5e-17
 Identities = 52/171 (30%), Positives = 89/171 (52%), Gaps = 12/171 (7%)

Query  161  MRHID---ILDRLDFHEFKVSVKASNVFLTMDAYRLLSQQIDN--PLHLGVTEAGIYRTG  215
            +++ID   IL  + F E KVS     V      +  LS+   N   +H      GI+R  
Sbjct  533  LKNIDATMILHDVPFTEDKVS----RVHAARRLFEFLSENSVNFPVIHHINFPTGIHRDE  588

Query  216  TVKSA-IALGGLLMEGIGDTMRISLAAEPEDEVK-IGFDILKSLGLRSNGINFIACPSCS  273
             V  A    GGLL++G+GD + +    +  D ++   F++L+   +R+    +++CPSC 
Sbjct  589  LVIHAGTYAGGLLVDGLGDGVMLEAPDQDFDFLRNTSFNLLQGCRMRNTKTEYVSCPSCG  648

Query  274  RQEFNVIKVMQALEERLEDIRTPMDLSVIGCKVNGPGEAKEADIGIVGASP  324
            R  F++ ++   + E+   +   + ++++GC VNGPGE  +AD G VG SP
Sbjct  649  RTLFDLQEISAEIREKTSHL-PGVSIAIMGCIVNGPGEMADADFGYVGGSP  698


> P95608 Muconate cycloisomerase 1 [Rhodococcus opacus]
Length=373

 Score = 38.9 bits (89),  Expect = 3e-06
 Identities = 30/87 (34%), Positives = 45/87 (52%), Gaps = 5/87 (6%)

Query  47   IQRCADAGVDIMRVSVPSMEAAEAFGKIRQRVSVPLVAD--IHFDHRIALAVADYGA-DC  103
            + R  + GV+++    P  E  E   ++ + V VP++AD  +   H  AL VA  GA D 
Sbjct  212  VPRLVEGGVELIEQPTPG-EQLEVLAELNRLVPVPVMADESVQTPHD-ALEVARRGAADV  269

Query  104  LRINPGNIGSDQKVREVVAAARHHGIS  130
            + +     G  QK REVVA A+  GI+
Sbjct  270  IALKTTKCGGLQKSREVVAIAKAAGIA  296


> P38990 SNF1-activating kinase 1 [Saccharomyces cerevisiae (strain 
ATCC 204508 / S288c)]
Length=1142

 Score = 35.4 bits (80),  Expect = 5e-05
 Identities = 31/115 (27%), Positives = 57/115 (50%), Gaps = 4/115 (3%)

Query  178  SVKASNV-FLTMDAYRLLSQQIDNPLHLGVTEAGIYRTGTVKSAIALGGLLMEGIGDTMR  236
            S+ +S+V  L M   R   +Q+++P H     + + +T T  S+    G     + +T R
Sbjct  57   SIASSSVDSLNMLLERQRVRQLNHPQHQQHISSSLAKTPTTTSSFCSSGSSKNKVKETNR  116

Query  237  ISLAAEPEDEVKI--GFDILKSLGLRSNGINFIACPSCSRQEFNVIKVMQALEER  289
            ISL  +P  + K+   ++I+K LG   +G   +A    S+Q    IK++   E++
Sbjct  117  ISLTYDPVSKRKVLNTYEIIKELGHGQHGKVKLARDILSKQ-LVAIKIVDRHEKK  170


 Score = 20.8 bits (42),  Expect = 1.9
 Identities = 10/42 (24%), Positives = 22/42 (52%), Gaps = 0/42 (0%)

Query  326  SLVYRNGEKSHLIDTDQLVDEIEDMVRQRVKEIEEAKSKEII  367
            SL Y    K  +++T +++ E+      +VK   +  SK+++
Sbjct  118  SLTYDPVSKRKVLNTYEIIKELGHGQHGKVKLARDILSKQLV  159


 Score = 18.9 bits (37),  Expect = 7.5
 Identities = 11/51 (22%), Positives = 23/51 (45%), Gaps = 9/51 (18%)

Query  298  DLSVIGCKVNGPGEAKEADIGIVGASPRSLVYRNGEKSHLIDTDQLVDEIE  348
            D+      ++G G  K +D G+  A+           ++  D+ + +DE+E
Sbjct  277  DIKPANLLISGDGTVKISDFGVSLAA---------SSTNSSDSSESLDELE  318



Lambda      K        H        a         alpha
   0.320    0.137    0.383    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3149168


  Database: 1fd5c47000f01f8ecd7004a2fc056c09.SwissProt.fasta
    Posted date:  Sep 24, 2020  4:04 AM
  Number of letters in database: 11,250
  Number of sequences in database:  26



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40