ACIAD0512 / TrEMBL Alignments

BLASTP 2.2.28+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: f33151460ccbc52d8025c11777eb9b2e.TrEMBL.fasta
           1 sequences; 60 total letters



Query= ACIAD0512

Length=61
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  Q6FES0 Uncharacterized protein [Acinetobacter baylyi (strain AT...   128    2e-45


> Q6FES0 Uncharacterized protein [Acinetobacter baylyi (strain 
ATCC 33305 / BD413 / ADP1)]
Length=60

 Score =  128 bits (322),  Expect = 2e-45
 Identities = 59/60 (98%), Positives = 60/60 (100%), Gaps = 0/60 (0%)

Query  1   LAIQCCLNKEGEICGNDDAFAVVWGEFDAMGPAGEVGVLVQPDIIKATHRLEPRKSCFII  60
           +AIQCCLNKEGEICGNDDAFAVVWGEFDAMGPAGEVGVLVQPDIIKATHRLEPRKSCFII
Sbjct  1   MAIQCCLNKEGEICGNDDAFAVVWGEFDAMGPAGEVGVLVQPDIIKATHRLEPRKSCFII  60



Lambda      K        H        a         alpha
   0.333    0.149    0.502    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3192


  Database: f33151460ccbc52d8025c11777eb9b2e.TrEMBL.fasta
    Posted date:  Sep 19, 2020  2:27 PM
  Number of letters in database: 60
  Number of sequences in database:  1



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40