ACIAD0497 / TrEMBL Alignments

BLASTP 2.2.28+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: ac37652250c6d09f84293d42c042a07d.TrEMBL.fasta
           15 sequences; 1,798 total letters



Query= ACIAD0497

Length=124
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  Q6FET4 ASCH domain-containing protein [Acinetobacter baylyi (st...   258    4e-93
  A0A1H8PGI3 ASCH domain-containing protein [Acinetobacter sp. yr...   149    3e-50
  N9A506 ASCH domain-containing protein [Acinetobacter venetianus...   148    5e-50
  U7H142 RNA-binding protein [Acinetobacter sp. COS3]                  148    5e-50
  G7G9P2 ASCH domain-containing protein [Acinetobacter sp. NBRC 1...   148    5e-50
  A0A150HV10 RNA-binding protein [Acinetobacter venetianus]            148    5e-50
  A0A1H3FK67 ASCH domain-containing protein [Acinetobacter kyongg...   148    5e-50
  A0A1Q3N838 RNA-binding protein [Acinetobacter sp. 38-8]              148    6e-50
  A0A1Q3M543 RNA-binding protein [Acinetobacter sp. 39-4]              148    6e-50
  A0A241WS55 RNA-binding protein [Acinetobacter sp. ANC 4654]          148    7e-50
  A0A1F2VJM7 RNA-binding protein [Acinetobacter sp. GWC1_38_13]        147    9e-50
  A0A1B8UB04 RNA-binding protein [Acinetobacter gyllenbergii]          147    9e-50
  A0A0Q5FNP1 RNA-binding protein [Acinetobacter sp. Leaf130]           147    9e-50
  A0A2S2FH07 ASCH domain-containing protein [Acinetobacter defluvii]   147    9e-50
  A0A1Y3DDF4 RNA-binding protein [Acinetobacter sp. ANC 4973]          147    1e-49


> Q6FET4 ASCH domain-containing protein [Acinetobacter baylyi (strain 
ATCC 33305 / BD413 / ADP1)]
Length=123

 Score =  258 bits (659),  Expect = 4e-93
 Identities = 123/123 (100%), Positives = 123/123 (100%), Gaps = 0/123 (0%)

Query  1    MLKDAWALSIVAPSGTRIAQGLKTLEVRSWRPDVLPIRDLLIIENDHFSTQHHATEWGRA  60
            MLKDAWALSIVAPSGTRIAQGLKTLEVRSWRPDVLPIRDLLIIENDHFSTQHHATEWGRA
Sbjct  1    MLKDAWALSIVAPSGTRIAQGLKTLEVRSWRPDVLPIRDLLIIENDHFSTQHHATEWGRA  60

Query  61   VAWIDIESVHPWQAHEVEAACASAWSEGYFAWVISHVRPLNETFRVLAKRKLYKLDMAHD  120
            VAWIDIESVHPWQAHEVEAACASAWSEGYFAWVISHVRPLNETFRVLAKRKLYKLDMAHD
Sbjct  61   VAWIDIESVHPWQAHEVEAACASAWSEGYFAWVISHVRPLNETFRVLAKRKLYKLDMAHD  120

Query  121  VKL  123
            VKL
Sbjct  121  VKL  123


> A0A1H8PGI3 ASCH domain-containing protein [Acinetobacter sp. 
yr461]
Length=120

 Score =  149 bits (375),  Expect = 3e-50
 Identities = 68/117 (58%), Positives = 93/117 (79%), Gaps = 0/117 (0%)

Query  1    MLKDAWALSIVAPSGTRIAQGLKTLEVRSWRPDVLPIRDLLIIENDHFSTQHHATEWGRA  60
            M +   ALSIVAP+GTRIA+G+KTLEVRSW P  LPI+DLLI+EN +F  +    E G A
Sbjct  1    MKRQFLALSIVAPNGTRIAEGIKTLEVRSWVPTKLPIKDLLIVENQNFLVKDTVEEQGVA  60

Query  61   VAWIDIESVHPWQAHEVEAACASAWSEGYFAWVISHVRPLNETFRVLAKRKLYKLDM  117
            VA +DI+S+H W+  E+E ACA+AWSEGYFAWV+S+VRP+++  + LAKRK+Y++++
Sbjct  61   VALVDIDSIHAWRNDEIEPACATAWSEGYFAWVLSNVRPISQPLKTLAKRKIYQVEL  117


> N9A506 ASCH domain-containing protein [Acinetobacter venetianus 
(strain ATCC 31012 / CIP 110063 / RAG-1)]
Length=119

 Score =  148 bits (374),  Expect = 5e-50
 Identities = 71/117 (61%), Positives = 90/117 (77%), Gaps = 0/117 (0%)

Query  1    MLKDAWALSIVAPSGTRIAQGLKTLEVRSWRPDVLPIRDLLIIENDHFSTQHHATEWGRA  60
            MLK   ALSIVAP+G RIAQGLKTLE+RSW+P+ LP+++L+I+EN  F       E GRA
Sbjct  1    MLKQYQALSIVAPNGGRIAQGLKTLEIRSWQPEYLPLKNLVIVENQSFLLADGEEEIGRA  60

Query  61   VAWIDIESVHPWQAHEVEAACASAWSEGYFAWVISHVRPLNETFRVLAKRKLYKLDM  117
            VA +DIESVH W   EV AACAS+W+ GYFAWVIS+VRP ++    +AKRKLY+L++
Sbjct  61   VALVDIESVHLWTEDEVNAACASSWAVGYFAWVISNVRPFSQPIETIAKRKLYRLEL  117


> U7H142 RNA-binding protein [Acinetobacter sp. COS3]
Length=119

 Score =  148 bits (374),  Expect = 5e-50
 Identities = 71/117 (61%), Positives = 90/117 (77%), Gaps = 0/117 (0%)

Query  1    MLKDAWALSIVAPSGTRIAQGLKTLEVRSWRPDVLPIRDLLIIENDHFSTQHHATEWGRA  60
            MLK   ALSIVAP+G RIAQGLKTLE+RSW+P+ LP+++L+I+EN  F       E GRA
Sbjct  1    MLKQYQALSIVAPNGGRIAQGLKTLEIRSWQPEYLPLKNLVIVENQSFLLADGEEEIGRA  60

Query  61   VAWIDIESVHPWQAHEVEAACASAWSEGYFAWVISHVRPLNETFRVLAKRKLYKLDM  117
            VA +DIESVH W   EV AACAS+W+ GYFAWVIS+VRP ++    +AKRKLY+L++
Sbjct  61   VALVDIESVHLWTKDEVNAACASSWAVGYFAWVISNVRPFSQPIETIAKRKLYRLEL  117


> G7G9P2 ASCH domain-containing protein [Acinetobacter sp. NBRC 
100985]
Length=119

 Score =  148 bits (374),  Expect = 5e-50
 Identities = 71/117 (61%), Positives = 90/117 (77%), Gaps = 0/117 (0%)

Query  1    MLKDAWALSIVAPSGTRIAQGLKTLEVRSWRPDVLPIRDLLIIENDHFSTQHHATEWGRA  60
            MLK   ALSIVAP+G RIAQGLKTLE+RSW+P+ LP+++L+I+EN  F       E GRA
Sbjct  1    MLKQYQALSIVAPNGGRIAQGLKTLEIRSWQPEYLPLKNLVIVENQSFLLADGEEEIGRA  60

Query  61   VAWIDIESVHPWQAHEVEAACASAWSEGYFAWVISHVRPLNETFRVLAKRKLYKLDM  117
            VA +DIESVH W   EV AACAS+W+ GYFAWVIS+VRP ++    +AKRKLY+L++
Sbjct  61   VALVDIESVHLWTKDEVNAACASSWAVGYFAWVISNVRPFSQPIETIAKRKLYRLEL  117


> A0A150HV10 RNA-binding protein [Acinetobacter venetianus]
Length=119

 Score =  148 bits (374),  Expect = 5e-50
 Identities = 71/117 (61%), Positives = 90/117 (77%), Gaps = 0/117 (0%)

Query  1    MLKDAWALSIVAPSGTRIAQGLKTLEVRSWRPDVLPIRDLLIIENDHFSTQHHATEWGRA  60
            MLK   ALSIVAP+G RIAQGLKTLE+RSW+P+ LP+++L+I+EN  F       E GRA
Sbjct  1    MLKQYQALSIVAPNGGRIAQGLKTLEIRSWQPEYLPLKNLVIVENQSFLLADGEEEIGRA  60

Query  61   VAWIDIESVHPWQAHEVEAACASAWSEGYFAWVISHVRPLNETFRVLAKRKLYKLDM  117
            VA +DIESVH W   EV AACAS+W+ GYFAWVIS+VRP ++    +AKRKLY+L++
Sbjct  61   VALVDIESVHLWTKDEVNAACASSWAVGYFAWVISNVRPFSQPIETIAKRKLYRLEL  117


> A0A1H3FK67 ASCH domain-containing protein [Acinetobacter kyonggiensis]
Length=122

 Score =  148 bits (374),  Expect = 5e-50
 Identities = 70/113 (62%), Positives = 88/113 (78%), Gaps = 0/113 (0%)

Query  7    ALSIVAPSGTRIAQGLKTLEVRSWRPDVLPIRDLLIIENDHFSTQHHATEWGRAVAWIDI  66
            ALSIVAPSG RIAQG+KTLEVRSW+P+ LP++DLLI+EN  F       E G AVA +D+
Sbjct  9    ALSIVAPSGQRIAQGMKTLEVRSWQPEQLPLKDLLIVENKIFLNHDADEELGVAVALVDV  68

Query  67   ESVHPWQAHEVEAACASAWSEGYFAWVISHVRPLNETFRVLAKRKLYKLDMAH  119
            ESVH WQ +EVEAACAS W+EGYFAW +S++RP+ +   V AKRK+Y ++M H
Sbjct  69   ESVHVWQPNEVEAACASYWAEGYFAWQLSNIRPIKDKIEVPAKRKIYLIEMDH  121


> A0A1Q3N838 RNA-binding protein [Acinetobacter sp. 38-8]
Length=119

 Score =  148 bits (373),  Expect = 6e-50
 Identities = 67/117 (57%), Positives = 94/117 (80%), Gaps = 0/117 (0%)

Query  1    MLKDAWALSIVAPSGTRIAQGLKTLEVRSWRPDVLPIRDLLIIENDHFSTQHHATEWGRA  60
            MLK   ALSIVAP+  RIA+ +KTLEVRSW+P++LP++DL+I+EN +F       + G A
Sbjct  1    MLKQYTALSIVAPNAERIAKKIKTLEVRSWQPEMLPLKDLMIVENQNFLLNDGDEDVGFA  60

Query  61   VAWIDIESVHPWQAHEVEAACASAWSEGYFAWVISHVRPLNETFRVLAKRKLYKLDM  117
            VA +DIESVHPWQ+ EV+AACA+ W+EGYFAWVI ++RP++   +V+AKRKLY++++
Sbjct  61   VALVDIESVHPWQSDEVDAACATYWAEGYFAWVIGNIRPIDPPIQVIAKRKLYRIEL  117


> A0A1Q3M543 RNA-binding protein [Acinetobacter sp. 39-4]
Length=119

 Score =  148 bits (373),  Expect = 6e-50
 Identities = 67/117 (57%), Positives = 94/117 (80%), Gaps = 0/117 (0%)

Query  1    MLKDAWALSIVAPSGTRIAQGLKTLEVRSWRPDVLPIRDLLIIENDHFSTQHHATEWGRA  60
            MLK   ALSIVAP+  RIA+ +KTLEVRSW+P++LP++DL+I+EN +F       + G A
Sbjct  1    MLKQYTALSIVAPNAERIAKKIKTLEVRSWQPEMLPLKDLMIVENQNFLLNDGDEDVGFA  60

Query  61   VAWIDIESVHPWQAHEVEAACASAWSEGYFAWVISHVRPLNETFRVLAKRKLYKLDM  117
            VA +DIESVHPWQ+ EV+AACA+ W+EGYFAWVI ++RP++   +V+AKRKLY++++
Sbjct  61   VALVDIESVHPWQSDEVDAACATYWAEGYFAWVIGNIRPIDPPIQVIAKRKLYRIEL  117


> A0A241WS55 RNA-binding protein [Acinetobacter sp. ANC 4654]
Length=120

 Score =  148 bits (373),  Expect = 7e-50
 Identities = 70/113 (62%), Positives = 87/113 (77%), Gaps = 0/113 (0%)

Query  7    ALSIVAPSGTRIAQGLKTLEVRSWRPDVLPIRDLLIIENDHFSTQHHATEWGRAVAWIDI  66
            ALSIVAPSG RIAQG+KTLEVRSW P+ LP++DLL++EN +F       E G AVA +D+
Sbjct  7    ALSIVAPSGQRIAQGMKTLEVRSWHPEQLPLKDLLLVENKNFLNHDADEEQGVAVALVDV  66

Query  67   ESVHPWQAHEVEAACASAWSEGYFAWVISHVRPLNETFRVLAKRKLYKLDMAH  119
            ESVH WQ +EVEAACAS W+EGYFAW +S+VRP+     V AKRK+Y ++M H
Sbjct  67   ESVHVWQRNEVEAACASYWAEGYFAWQLSNVRPIKNRVEVPAKRKIYLIEMDH  119


> A0A1F2VJM7 RNA-binding protein [Acinetobacter sp. GWC1_38_13]
Length=119

 Score =  147 bits (372),  Expect = 9e-50
 Identities = 68/117 (58%), Positives = 87/117 (74%), Gaps = 0/117 (0%)

Query  1    MLKDAWALSIVAPSGTRIAQGLKTLEVRSWRPDVLPIRDLLIIENDHFSTQHHATEWGRA  60
            M K    LS VAP+  RI QG+KTLEVRSWRP+ LP++DL+I+EN HF       E G+ 
Sbjct  1    MTKQYQVLSTVAPNAERIVQGIKTLEVRSWRPEKLPLKDLVIVENTHFLNNDGDEEMGKV  60

Query  61   VAWIDIESVHPWQAHEVEAACASAWSEGYFAWVISHVRPLNETFRVLAKRKLYKLDM  117
            VA IDIESVHPW A E++AACA+ W++ YFAWVIS+VRPL +    +AKRKLY+L++
Sbjct  61   VALIDIESVHPWLAQEIDAACATDWADEYFAWVISNVRPLKQPIEAIAKRKLYRLEL  117


> A0A1B8UB04 RNA-binding protein [Acinetobacter gyllenbergii]
Length=120

 Score =  147 bits (372),  Expect = 9e-50
 Identities = 68/117 (58%), Positives = 90/117 (77%), Gaps = 0/117 (0%)

Query  1    MLKDAWALSIVAPSGTRIAQGLKTLEVRSWRPDVLPIRDLLIIENDHFSTQHHATEWGRA  60
            MLK   ALSIVAPS  RI QGLKTLE+RSW+P+ LP++D++I+EN +F       E G A
Sbjct  1    MLKQYTALSIVAPSAERIVQGLKTLEIRSWQPETLPLKDVVIVENQNFLLNDGDEELGLA  60

Query  61   VAWIDIESVHPWQAHEVEAACASAWSEGYFAWVISHVRPLNETFRVLAKRKLYKLDM  117
            VA +DIE+VH W+  EVEAACASAW+EGY AWVI ++RP++   +V+AKRKLY +++
Sbjct  61   VALVDIETVHAWRVDEVEAACASAWNEGYLAWVIRNIRPIDPPLQVMAKRKLYSIEL  117


> A0A0Q5FNP1 RNA-binding protein [Acinetobacter sp. Leaf130]
Length=120

 Score =  147 bits (372),  Expect = 9e-50
 Identities = 68/117 (58%), Positives = 93/117 (79%), Gaps = 0/117 (0%)

Query  1    MLKDAWALSIVAPSGTRIAQGLKTLEVRSWRPDVLPIRDLLIIENDHFSTQHHATEWGRA  60
            M +   ALSIVAP+GTRIA+G+KTLEVRSW P  LPI+DLLI+EN +F  +    E G A
Sbjct  1    MKRQFLALSIVAPNGTRIAEGIKTLEVRSWVPTKLPIKDLLIVENQNFLVKDTDEEEGVA  60

Query  61   VAWIDIESVHPWQAHEVEAACASAWSEGYFAWVISHVRPLNETFRVLAKRKLYKLDM  117
            VA +DI+S+H W+  E+E ACA+AWSEGYFAWV+S+VRP+++  + LAKRK+Y++++
Sbjct  61   VALVDIDSIHAWRNDEIEPACATAWSEGYFAWVLSNVRPISQPLKTLAKRKIYQVEL  117


> A0A2S2FH07 ASCH domain-containing protein [Acinetobacter defluvii]
Length=120

 Score =  147 bits (372),  Expect = 9e-50
 Identities = 70/119 (59%), Positives = 90/119 (76%), Gaps = 0/119 (0%)

Query  1    MLKDAWALSIVAPSGTRIAQGLKTLEVRSWRPDVLPIRDLLIIENDHFSTQHHATEWGRA  60
            M K   ALSIV PSG++IAQGLKTLE+RSW P+ LP++DL+I+EN    +  +  E G+A
Sbjct  1    MKKKYPALSIVVPSGSKIAQGLKTLEIRSWIPEQLPLKDLVIVENTQLLSAEYTEEMGKA  60

Query  61   VAWIDIESVHPWQAHEVEAACASAWSEGYFAWVISHVRPLNETFRVLAKRKLYKLDMAH  119
            VA +DIESVHPW+  E  AACAS W+EGYFAWVIS+VRP+ +   V AKRK+Y +D+ H
Sbjct  61   VAIVDIESVHPWREDECAAACASDWAEGYFAWVISNVRPITQPLGVPAKRKIYFIDIDH  119


> A0A1Y3DDF4 RNA-binding protein [Acinetobacter sp. ANC 4973]
Length=120

 Score =  147 bits (371),  Expect = 1e-49
 Identities = 69/113 (61%), Positives = 88/113 (78%), Gaps = 0/113 (0%)

Query  7    ALSIVAPSGTRIAQGLKTLEVRSWRPDVLPIRDLLIIENDHFSTQHHATEWGRAVAWIDI  66
            ALSIVAPSG RIAQG+KTLEVRSW+P+ LP+++LLI+EN  F       E G AVA +D+
Sbjct  7    ALSIVAPSGQRIAQGMKTLEVRSWQPEQLPLKNLLIVENKFFLNHDADEELGVAVALVDV  66

Query  67   ESVHPWQAHEVEAACASAWSEGYFAWVISHVRPLNETFRVLAKRKLYKLDMAH  119
            ESVH WQ +EVEAACAS W+EGYFAW +S++RP+ +   V AKRK+Y ++M H
Sbjct  67   ESVHVWQPNEVEAACASYWAEGYFAWQLSNIRPIKDKIEVPAKRKIYLIEMDH  119



Lambda      K        H        a         alpha
   0.327    0.136    0.456    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 126712


  Database: ac37652250c6d09f84293d42c042a07d.TrEMBL.fasta
    Posted date:  Sep 19, 2020  2:45 PM
  Number of letters in database: 1,798
  Number of sequences in database:  15



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40