ACIAD0497 / SwissProt Alignments

BLASTP 2.2.28+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: d2041ae747a396b06c562bf9ef75d2d4.SwissProt.fasta
           1 sequences; 414 total letters



Query= ACIAD0497

Length=124
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  P9WMY9 Glycogen synthase [Mycobacterium tuberculosis (strain AT...  32.3    2e-06


> P9WMY9 Glycogen synthase [Mycobacterium tuberculosis (strain 
ATCC 25618 / H37Rv)]
Length=414

 Score = 32.3 bits (72),  Expect = 2e-06
 Identities = 27/103 (26%), Positives = 44/103 (43%), Gaps = 23/103 (22%)

Query  5    AWALSIVAPSGTRIAQGLKTLEV---RSWRPDVLPIRDLLIIENDHFSTQH---------  52
            AW L++       I  GL+  ++   RSWRPDV+   D L+        Q          
Sbjct  81   AWTLAM---GHAMIRAGLRLKKLGTDRSWRPDVVHAHDWLVAHPAIALAQFYDVPMVSTI  137

Query  53   HATEWGRAVAWI------DIESVHPWQAHEVEA--ACASAWSE  87
            HATE GR   W+       + +V  W   E ++   C+++ ++
Sbjct  138  HATEAGRHSGWVSGALSRQVHAVESWLVRESDSLITCSASMND  180



Lambda      K        H        a         alpha
   0.327    0.136    0.456    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 39984


  Database: d2041ae747a396b06c562bf9ef75d2d4.SwissProt.fasta
    Posted date:  Sep 24, 2020  3:30 AM
  Number of letters in database: 414
  Number of sequences in database:  1



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40