ACIAD0352 / TrEMBL Alignments

BLASTP 2.2.28+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: 22c412ff7f7ef29dfcda8b52c9639b14.TrEMBL.fasta
           14 sequences; 2,044 total letters



Query= ACIAD0352

Length=148
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  A0A1P8ELX0 Putative pre-16S rRNA nuclease [Acinetobacter soli]       260    3e-93
  N9BYN8 Putative pre-16S rRNA nuclease [Acinetobacter soli NIPH ...   259    1e-92
  A0A0M1I2T4 Putative pre-16S rRNA nuclease [Acinetobacter sp. C15]    258    3e-92
  N9QX81 Putative pre-16S rRNA nuclease [Acinetobacter ursingii N...   254    8e-91
  N9DEN9 Putative pre-16S rRNA nuclease [Acinetobacter ursingii A...   253    2e-90
  N9K5S2 Putative pre-16S rRNA nuclease [Acinetobacter sp. NIPH 284]   251    2e-89
  A0A2R4TMN8 Putative pre-16S rRNA nuclease [Acinetobacter sp. WC...   251    2e-89
  V2TTC4 Putative pre-16S rRNA nuclease [Acinetobacter gyllenberg...   250    4e-89
  A0A1B8UAL1 Putative pre-16S rRNA nuclease [Acinetobacter gyllen...   250    4e-89
  D0SPI7 Putative pre-16S rRNA nuclease [Acinetobacter junii SH205]    249    8e-89
  A0A1F2VA91 Putative pre-16S rRNA nuclease [Acinetobacter sp. GW...   249    8e-89
  S7WD75 Putative pre-16S rRNA nuclease [Acinetobacter junii MTCC...   249    8e-89
  Q8VVM5 Putative pre-16S rRNA nuclease [Escherichia coli]             120    3e-38
  C1IXZ0 Putative pre-16S rRNA nuclease [Klebsiella aerogenes]         120    3e-38


> A0A1P8ELX0 Putative pre-16S rRNA nuclease [Acinetobacter soli]
Length=147

 Score =  260 bits (665),  Expect = 3e-93
 Identities = 127/147 (86%), Positives = 135/147 (92%), Gaps = 0/147 (0%)

Query  1    MPDSMSHQMIMAFDFGTQKMGIAIGQAAIESSTPLALFPMKDGIPDWNQLLKIVKEWQPT  60
            MPD  +H MIMAFDFGTQKMGIAIGQAAIESSTPLALFPMKDGIP+W QLLKIV+EW+PT
Sbjct  1    MPDISTHSMIMAFDFGTQKMGIAIGQAAIESSTPLALFPMKDGIPNWEQLLKIVQEWKPT  60

Query  61   LFLVGLPLNMDDSESELSARARKFARRLRHQTNITTWMVDERLTTREARDELESYQEQGR  120
            LFLVGLPLNMDDSESELSARARKFARRLRHQTNITTWMVDERLTTREARDEL+ Y  QGR
Sbjct  61   LFLVGLPLNMDDSESELSARARKFARRLRHQTNITTWMVDERLTTREARDELDHYHSQGR  120

Query  121  AKKIAADSIAASLLIQSWYRAPQGVQP  147
            AK +AADS+AA LLIQSWYR P G+ P
Sbjct  121  AKGVAADSLAAGLLIQSWYRNPTGITP  147


> N9BYN8 Putative pre-16S rRNA nuclease [Acinetobacter soli NIPH 
2899]
Length=147

 Score =  259 bits (661),  Expect = 1e-92
 Identities = 126/147 (86%), Positives = 135/147 (92%), Gaps = 0/147 (0%)

Query  1    MPDSMSHQMIMAFDFGTQKMGIAIGQAAIESSTPLALFPMKDGIPDWNQLLKIVKEWQPT  60
            MP+  +H MIMAFDFGTQKMGIAIGQAAIESSTPLALFPMKDGIP+W QLLKIV+EW+PT
Sbjct  1    MPEISTHSMIMAFDFGTQKMGIAIGQAAIESSTPLALFPMKDGIPNWEQLLKIVQEWKPT  60

Query  61   LFLVGLPLNMDDSESELSARARKFARRLRHQTNITTWMVDERLTTREARDELESYQEQGR  120
            LFLVGLPLNMDDSESELSARARKFARRLRHQTNITTWMVDERLTTREARDEL+ Y  QGR
Sbjct  61   LFLVGLPLNMDDSESELSARARKFARRLRHQTNITTWMVDERLTTREARDELDHYHSQGR  120

Query  121  AKKIAADSIAASLLIQSWYRAPQGVQP  147
            AK +AADS+AA LLIQSWYR P G+ P
Sbjct  121  AKGVAADSLAAGLLIQSWYRNPTGITP  147


> A0A0M1I2T4 Putative pre-16S rRNA nuclease [Acinetobacter sp. 
C15]
Length=147

 Score =  258 bits (659),  Expect = 3e-92
 Identities = 126/147 (86%), Positives = 134/147 (91%), Gaps = 0/147 (0%)

Query  1    MPDSMSHQMIMAFDFGTQKMGIAIGQAAIESSTPLALFPMKDGIPDWNQLLKIVKEWQPT  60
            MPD  +H MIMAFDFGTQKMGIAIGQAAIESSTPLALFPMKDGIP+W QLLKIV+EW+PT
Sbjct  1    MPDISTHSMIMAFDFGTQKMGIAIGQAAIESSTPLALFPMKDGIPNWEQLLKIVQEWKPT  60

Query  61   LFLVGLPLNMDDSESELSARARKFARRLRHQTNITTWMVDERLTTREARDELESYQEQGR  120
            LFLVGLPLNMDDSESELSARARKFARRLRHQTNI TWMVDERLTTREARDEL+ Y  QGR
Sbjct  61   LFLVGLPLNMDDSESELSARARKFARRLRHQTNIITWMVDERLTTREARDELDHYHSQGR  120

Query  121  AKKIAADSIAASLLIQSWYRAPQGVQP  147
            AK +AADS+AA LLIQSWYR P G+ P
Sbjct  121  AKGVAADSLAAGLLIQSWYRNPTGITP  147


> N9QX81 Putative pre-16S rRNA nuclease [Acinetobacter ursingii 
NIPH 706]
Length=147

 Score =  254 bits (649),  Expect = 8e-91
 Identities = 120/147 (82%), Positives = 135/147 (92%), Gaps = 0/147 (0%)

Query  1    MPDSMSHQMIMAFDFGTQKMGIAIGQAAIESSTPLALFPMKDGIPDWNQLLKIVKEWQPT  60
            MP++ S QMIMAFDFGTQKMG+A+GQ+ IES+ PLALFPMKDGIPDWNQLLKIVKEWQP 
Sbjct  1    MPETPSMQMIMAFDFGTQKMGMAVGQSTIESANPLALFPMKDGIPDWNQLLKIVKEWQPN  60

Query  61   LFLVGLPLNMDDSESELSARARKFARRLRHQTNITTWMVDERLTTREARDELESYQEQGR  120
            LFLVGLPLNMDDSESELS RARKFARRLRHQTNI TWMVDERLTTREARDEL++Y +QGR
Sbjct  61   LFLVGLPLNMDDSESELSTRARKFARRLRHQTNIETWMVDERLTTREARDELDAYHDQGR  120

Query  121  AKKIAADSIAASLLIQSWYRAPQGVQP  147
             K+++ADS+AA+LLIQSWY  P G+QP
Sbjct  121  GKRLSADSLAAALLIQSWYHHPHGIQP  147


> N9DEN9 Putative pre-16S rRNA nuclease [Acinetobacter ursingii 
ANC 3649]
Length=147

 Score =  253 bits (647),  Expect = 2e-90
 Identities = 120/147 (82%), Positives = 134/147 (91%), Gaps = 0/147 (0%)

Query  1    MPDSMSHQMIMAFDFGTQKMGIAIGQAAIESSTPLALFPMKDGIPDWNQLLKIVKEWQPT  60
            MP+  S  MIMAFDFGTQKMG+A+GQ+ IES+ PLALFPMKDGIPDWNQLLKIVKEWQP 
Sbjct  1    MPEMPSMHMIMAFDFGTQKMGMAVGQSTIESANPLALFPMKDGIPDWNQLLKIVKEWQPN  60

Query  61   LFLVGLPLNMDDSESELSARARKFARRLRHQTNITTWMVDERLTTREARDELESYQEQGR  120
            LFLVGLPLNMDDSESELS RARKFARRLRHQTNI TWMVDERLTTREARDEL++Y +QGR
Sbjct  61   LFLVGLPLNMDDSESELSTRARKFARRLRHQTNIETWMVDERLTTREARDELDAYHDQGR  120

Query  121  AKKIAADSIAASLLIQSWYRAPQGVQP  147
             K+++ADS+AA+LLIQSWY  PQG+QP
Sbjct  121  GKRLSADSLAAALLIQSWYHHPQGIQP  147


> N9K5S2 Putative pre-16S rRNA nuclease [Acinetobacter sp. NIPH 
284]
Length=147

 Score =  251 bits (640),  Expect = 2e-89
 Identities = 121/147 (82%), Positives = 133/147 (90%), Gaps = 0/147 (0%)

Query  1    MPDSMSHQMIMAFDFGTQKMGIAIGQAAIESSTPLALFPMKDGIPDWNQLLKIVKEWQPT  60
            MPD  + Q IMAFDFGTQKMG+AIGQ+ IES+TPL LF MKDGIPDWNQLLK+VKEWQP 
Sbjct  1    MPDFKTSQSIMAFDFGTQKMGMAIGQSTIESATPLPLFAMKDGIPDWNQLLKLVKEWQPN  60

Query  61   LFLVGLPLNMDDSESELSARARKFARRLRHQTNITTWMVDERLTTREARDELESYQEQGR  120
            LFLVGLPLNMDDSESELSARARKFARRLRHQTNI TWMVDERLTTREAR+ELESYQ +GR
Sbjct  61   LFLVGLPLNMDDSESELSARARKFARRLRHQTNIETWMVDERLTTREAREELESYQNKGR  120

Query  121  AKKIAADSIAASLLIQSWYRAPQGVQP  147
            AK+++ADS AA+LLIQSWYR P G+ P
Sbjct  121  AKRLSADSFAAALLIQSWYRDPNGITP  147


> A0A2R4TMN8 Putative pre-16S rRNA nuclease [Acinetobacter sp. 
WCHA45]
Length=147

 Score =  251 bits (640),  Expect = 2e-89
 Identities = 121/147 (82%), Positives = 133/147 (90%), Gaps = 0/147 (0%)

Query  1    MPDSMSHQMIMAFDFGTQKMGIAIGQAAIESSTPLALFPMKDGIPDWNQLLKIVKEWQPT  60
            MPD  + Q IMAFDFGTQKMG+AIGQ+ IES+TPL LF MKDGIPDWNQLLK+VKEWQP 
Sbjct  1    MPDFKTSQSIMAFDFGTQKMGMAIGQSTIESATPLPLFAMKDGIPDWNQLLKLVKEWQPN  60

Query  61   LFLVGLPLNMDDSESELSARARKFARRLRHQTNITTWMVDERLTTREARDELESYQEQGR  120
            LFLVGLPLNMDDSESELSARARKFARRLRHQTNI TWMVDERLTTREAR+ELESYQ +GR
Sbjct  61   LFLVGLPLNMDDSESELSARARKFARRLRHQTNIETWMVDERLTTREAREELESYQNKGR  120

Query  121  AKKIAADSIAASLLIQSWYRAPQGVQP  147
            AK+++ADS AA+LLIQSWYR P G+ P
Sbjct  121  AKRLSADSFAAALLIQSWYRDPNGITP  147


> V2TTC4 Putative pre-16S rRNA nuclease [Acinetobacter gyllenbergii 
NIPH 230]
Length=147

 Score =  250 bits (638),  Expect = 4e-89
 Identities = 120/147 (82%), Positives = 134/147 (91%), Gaps = 0/147 (0%)

Query  1    MPDSMSHQMIMAFDFGTQKMGIAIGQAAIESSTPLALFPMKDGIPDWNQLLKIVKEWQPT  60
            MPD  + Q IMAFDFGTQKMG+AIGQ++IESSTPL LFPMKDGIPDW++LLKIVKEWQP 
Sbjct  1    MPDMQNAQSIMAFDFGTQKMGMAIGQSSIESSTPLPLFPMKDGIPDWDKLLKIVKEWQPN  60

Query  61   LFLVGLPLNMDDSESELSARARKFARRLRHQTNITTWMVDERLTTREARDELESYQEQGR  120
            LF+VGLPLNMDDSESELSARARKFARRLRHQTNI TWMVDERLTTREAR+ELESYQ +G+
Sbjct  61   LFIVGLPLNMDDSESELSARARKFARRLRHQTNIETWMVDERLTTREAREELESYQSKGQ  120

Query  121  AKKIAADSIAASLLIQSWYRAPQGVQP  147
            AK+++ADS AA LLIQSWYR P G+ P
Sbjct  121  AKRLSADSFAAGLLIQSWYRDPAGITP  147


> A0A1B8UAL1 Putative pre-16S rRNA nuclease [Acinetobacter gyllenbergii]
Length=147

 Score =  250 bits (638),  Expect = 4e-89
 Identities = 120/147 (82%), Positives = 134/147 (91%), Gaps = 0/147 (0%)

Query  1    MPDSMSHQMIMAFDFGTQKMGIAIGQAAIESSTPLALFPMKDGIPDWNQLLKIVKEWQPT  60
            MPD  + Q IMAFDFGTQKMG+AIGQ++IESSTPL LFPMKDGIPDW++LLKIVKEWQP 
Sbjct  1    MPDMQNAQSIMAFDFGTQKMGMAIGQSSIESSTPLPLFPMKDGIPDWDKLLKIVKEWQPN  60

Query  61   LFLVGLPLNMDDSESELSARARKFARRLRHQTNITTWMVDERLTTREARDELESYQEQGR  120
            LF+VGLPLNMDDSESELSARARKFARRLRHQTNI TWMVDERLTTREAR+ELESYQ +G+
Sbjct  61   LFIVGLPLNMDDSESELSARARKFARRLRHQTNIETWMVDERLTTREAREELESYQSKGQ  120

Query  121  AKKIAADSIAASLLIQSWYRAPQGVQP  147
            AK+++ADS AA LLIQSWYR P G+ P
Sbjct  121  AKRLSADSFAAGLLIQSWYRDPAGITP  147


> D0SPI7 Putative pre-16S rRNA nuclease [Acinetobacter junii SH205]
Length=147

 Score =  249 bits (636),  Expect = 8e-89
 Identities = 121/147 (82%), Positives = 133/147 (90%), Gaps = 0/147 (0%)

Query  1    MPDSMSHQMIMAFDFGTQKMGIAIGQAAIESSTPLALFPMKDGIPDWNQLLKIVKEWQPT  60
            MPD  + Q IMAFDFGTQKMGIAIGQ+AIES+ PL LF MKDGIPDWNQLLK+VKEWQP 
Sbjct  1    MPDIQTSQSIMAFDFGTQKMGIAIGQSAIESANPLPLFIMKDGIPDWNQLLKLVKEWQPN  60

Query  61   LFLVGLPLNMDDSESELSARARKFARRLRHQTNITTWMVDERLTTREARDELESYQEQGR  120
            LFLVGLPLNMDDSESELSARARKFARRLRHQTNI TWMVDERLTTREAR+ELESYQ +G+
Sbjct  61   LFLVGLPLNMDDSESELSARARKFARRLRHQTNIQTWMVDERLTTREAREELESYQSKGQ  120

Query  121  AKKIAADSIAASLLIQSWYRAPQGVQP  147
            AK+++ADS AA+LLIQSWYR P G+ P
Sbjct  121  AKRLSADSFAAALLIQSWYRDPTGITP  147


> A0A1F2VA91 Putative pre-16S rRNA nuclease [Acinetobacter sp. 
GWC1_38_13]
Length=147

 Score =  249 bits (636),  Expect = 8e-89
 Identities = 121/147 (82%), Positives = 133/147 (90%), Gaps = 0/147 (0%)

Query  1    MPDSMSHQMIMAFDFGTQKMGIAIGQAAIESSTPLALFPMKDGIPDWNQLLKIVKEWQPT  60
            MPD  + Q IMAFDFGTQKMGIAIGQ+AIES+ PL LF MKDGIPDWNQLLK+VKEWQP 
Sbjct  1    MPDIQTSQSIMAFDFGTQKMGIAIGQSAIESANPLPLFIMKDGIPDWNQLLKLVKEWQPN  60

Query  61   LFLVGLPLNMDDSESELSARARKFARRLRHQTNITTWMVDERLTTREARDELESYQEQGR  120
            LFLVGLPLNMDDSESELSARARKFARRLRHQTNI TWMVDERLTTREAR+ELESYQ +G+
Sbjct  61   LFLVGLPLNMDDSESELSARARKFARRLRHQTNIQTWMVDERLTTREAREELESYQSKGQ  120

Query  121  AKKIAADSIAASLLIQSWYRAPQGVQP  147
            AK+++ADS AA+LLIQSWYR P G+ P
Sbjct  121  AKRLSADSFAAALLIQSWYRDPTGITP  147


> S7WD75 Putative pre-16S rRNA nuclease [Acinetobacter junii MTCC 
11364]
Length=147

 Score =  249 bits (636),  Expect = 8e-89
 Identities = 121/147 (82%), Positives = 133/147 (90%), Gaps = 0/147 (0%)

Query  1    MPDSMSHQMIMAFDFGTQKMGIAIGQAAIESSTPLALFPMKDGIPDWNQLLKIVKEWQPT  60
            MPD  + Q IMAFDFGTQKMGIAIGQ+AIES+ PL LF MKDGIPDWNQLLK+VKEWQP 
Sbjct  1    MPDIQTSQSIMAFDFGTQKMGIAIGQSAIESANPLPLFIMKDGIPDWNQLLKLVKEWQPN  60

Query  61   LFLVGLPLNMDDSESELSARARKFARRLRHQTNITTWMVDERLTTREARDELESYQEQGR  120
            LFLVGLPLNMDDSESELSARARKFARRLRHQTNI TWMVDERLTTREAR+ELESYQ +G+
Sbjct  61   LFLVGLPLNMDDSESELSARARKFARRLRHQTNIQTWMVDERLTTREAREELESYQSKGQ  120

Query  121  AKKIAADSIAASLLIQSWYRAPQGVQP  147
            AK+++ADS AA+LLIQSWYR P G+ P
Sbjct  121  AKRLSADSFAAALLIQSWYRDPTGITP  147


> Q8VVM5 Putative pre-16S rRNA nuclease [Escherichia coli]
Length=140

 Score =  120 bits (300),  Expect = 3e-38
 Identities = 58/134 (43%), Positives = 84/134 (63%), Gaps = 0/134 (0%)

Query  5    MSHQMIMAFDFGTQKMGIAIGQAAIESSTPLALFPMKDGIPDWNQLLKIVKEWQPTLFLV  64
            MS + IM FD+GT+ +G+AIGQ    S+ PL      DGIP+W+++ K++KEWQP L +V
Sbjct  1    MSSRSIMGFDYGTKSIGVAIGQEITGSARPLRSLKANDGIPNWDEIEKLLKEWQPDLLVV  60

Query  65   GLPLNMDDSESELSARARKFARRLRHQTNITTWMVDERLTTREARDELESYQEQGRAKKI  124
            GLPLNMD ++ E++ RARKF  RL  +        DERLTT +AR  L          K 
Sbjct  61   GLPLNMDGTDQEITVRARKFGNRLHGRFGKPVEFKDERLTTTDARARLFERGGYKALDKG  120

Query  125  AADSIAASLLIQSW  138
            + D ++A L++++W
Sbjct  121  SVDGVSAQLIVEAW  134


> C1IXZ0 Putative pre-16S rRNA nuclease [Klebsiella aerogenes]
Length=140

 Score =  120 bits (300),  Expect = 3e-38
 Identities = 58/134 (43%), Positives = 84/134 (63%), Gaps = 0/134 (0%)

Query  5    MSHQMIMAFDFGTQKMGIAIGQAAIESSTPLALFPMKDGIPDWNQLLKIVKEWQPTLFLV  64
            MS + IM FD+GT+ +G+AIGQ    S+ PL      DGIP+W+++ K++KEWQP L +V
Sbjct  1    MSSRSIMGFDYGTKSIGVAIGQEITGSARPLRSLKANDGIPNWDEIEKLLKEWQPDLLVV  60

Query  65   GLPLNMDDSESELSARARKFARRLRHQTNITTWMVDERLTTREARDELESYQEQGRAKKI  124
            GLPLNMD ++ E++ RARKF  RL  +        DERLTT +AR  L          K 
Sbjct  61   GLPLNMDGTDQEITVRARKFGNRLHGRFGKPVEFKDERLTTTDARARLFERGGYKALDKG  120

Query  125  AADSIAASLLIQSW  138
            + D ++A L++++W
Sbjct  121  SVDGVSAQLIVEAW  134



Lambda      K        H        a         alpha
   0.323    0.133    0.400    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 181930


  Database: 22c412ff7f7ef29dfcda8b52c9639b14.TrEMBL.fasta
    Posted date:  Sep 19, 2020  10:10 AM
  Number of letters in database: 2,044
  Number of sequences in database:  14



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40