ACIAD0352 / SwissProt Alignments

BLASTP 2.2.28+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: c7a332148195ceb35ae91f1d37f40611.SwissProt.fasta
           20 sequences; 2,796 total letters



Query= ACIAD0352

Length=148
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  Q6FF55 Putative pre-16S rRNA nuclease [Acinetobacter baylyi (st...   295    9e-107
  A1U763 Putative pre-16S rRNA nuclease [Marinobacter hydrocarbon...   135    6e-44 
  Q7VKS6 Putative pre-16S rRNA nuclease [Haemophilus ducreyi (str...   131    1e-42 
  B4EUS0 Putative pre-16S rRNA nuclease [Proteus mirabilis (strai...   127    7e-41 
  Q0I1B3 Putative pre-16S rRNA nuclease [Haemophilus somnus (stra...   126    1e-40 
  B0UWW2 Putative pre-16S rRNA nuclease [Histophilus somni (strai...   126    1e-40 
  Q21EI6 Putative pre-16S rRNA nuclease [Saccharophagus degradans...   126    1e-40 
  C5BCS0 Putative pre-16S rRNA nuclease [Edwardsiella ictaluri (s...   125    4e-40 
  A3MYV3 Putative pre-16S rRNA nuclease [Actinobacillus pleuropne...   124    6e-40 
  B0BSN8 Putative pre-16S rRNA nuclease [Actinobacillus pleuropne...   124    6e-40 
  B8F5F8 Putative pre-16S rRNA nuclease [Haemophilus parasuis ser...   124    1e-39 
  C6DFI9 Putative pre-16S rRNA nuclease [Pectobacterium carotovor...   124    1e-39 
  P43981 Putative pre-16S rRNA nuclease [Haemophilus influenzae (...   119    5e-38 
  Q9L3I7 Putative pre-16S rRNA nuclease [Aeromonas hydrophila]         119    1e-37 
  Q8Z3V1 Putative pre-16S rRNA nuclease [Salmonella typhi]             114    4e-36 
  P0A8I1 Putative pre-16S rRNA nuclease [Escherichia coli (strain...   114    8e-36 
  O34634 Putative pre-16S rRNA nuclease [Bacillus subtilis (strai...  50.4    2e-12 
  P57114 Putative pre-16S rRNA nuclease [Mycoplasma pneumoniae (s...  50.1    3e-12 
  Q8DRE2 Putative pre-16S rRNA nuclease [Streptococcus pneumoniae...  47.0    4e-11 
  Q2FXW1 Putative pre-16S rRNA nuclease [Staphylococcus aureus (s...  40.0    2e-08 


> Q6FF55 Putative pre-16S rRNA nuclease [Acinetobacter baylyi (strain 
ATCC 33305 / BD413 / ADP1)]
Length=147

 Score =  295 bits (755),  Expect = 9e-107
 Identities = 147/147 (100%), Positives = 147/147 (100%), Gaps = 0/147 (0%)

Query  1    MPDSMSHQMIMAFDFGTQKMGIAIGQAAIESSTPLALFPMKDGIPDWNQLLKIVKEWQPT  60
            MPDSMSHQMIMAFDFGTQKMGIAIGQAAIESSTPLALFPMKDGIPDWNQLLKIVKEWQPT
Sbjct  1    MPDSMSHQMIMAFDFGTQKMGIAIGQAAIESSTPLALFPMKDGIPDWNQLLKIVKEWQPT  60

Query  61   LFLVGLPLNMDDSESELSARARKFARRLRHQTNITTWMVDERLTTREARDELESYQEQGR  120
            LFLVGLPLNMDDSESELSARARKFARRLRHQTNITTWMVDERLTTREARDELESYQEQGR
Sbjct  61   LFLVGLPLNMDDSESELSARARKFARRLRHQTNITTWMVDERLTTREARDELESYQEQGR  120

Query  121  AKKIAADSIAASLLIQSWYRAPQGVQP  147
            AKKIAADSIAASLLIQSWYRAPQGVQP
Sbjct  121  AKKIAADSIAASLLIQSWYRAPQGVQP  147


> A1U763 Putative pre-16S rRNA nuclease [Marinobacter hydrocarbonoclasticus 
(strain ATCC 700491 / DSM 11845 / VT8)]
Length=143

 Score =  135 bits (339),  Expect = 6e-44
 Identities = 65/144 (45%), Positives = 98/144 (68%), Gaps = 1/144 (1%)

Query  1    MPDSMSHQMIMAFDFGTQKMGIAIGQAAIESSTPLALFPMKDGIPDWNQLLKIVKEWQPT  60
            MPD   ++ ++AFDFGT+++G+A GQ  + +  PLA+ P +DGIPDW Q+  ++ +WQP 
Sbjct  1    MPDP-GNRRLLAFDFGTRRIGVASGQEMLGTGQPLAMLPARDGIPDWQQIEALLADWQPD  59

Query  61   LFLVGLPLNMDDSESELSARARKFARRLRHQTNITTWMVDERLTTREARDELESYQEQGR  120
            + LVGLPLNMDD+E+E+ ARARKF +RL  + ++T  MVDERLT+ EA+ E+ +      
Sbjct  60   IVLVGLPLNMDDTENEMCARARKFGKRLHGRYHVTVEMVDERLTSYEAKGEVMAGGGSRD  119

Query  121  AKKIAADSIAASLLIQSWYRAPQG  144
              +   D  AA L++++W R   G
Sbjct  120  FGRHGVDDRAAVLILETWCREQAG  143


> Q7VKS6 Putative pre-16S rRNA nuclease [Haemophilus ducreyi (strain 
35000HP / ATCC 700724)]
Length=138

 Score =  131 bits (330),  Expect = 1e-42
 Identities = 64/130 (49%), Positives = 88/130 (68%), Gaps = 0/130 (0%)

Query  10   IMAFDFGTQKMGIAIGQAAIESSTPLALFPMKDGIPDWNQLLKIVKEWQPTLFLVGLPLN  69
            I+AFDFGT  +G A+GQ+  +++  L  F  +DGIP+W  + KI+KEWQP L +VGLPLN
Sbjct  5    ILAFDFGTYSIGCAVGQSITKTAQSLTAFKSQDGIPNWQHIEKIIKEWQPDLLVVGLPLN  64

Query  70   MDDSESELSARARKFARRLRHQTNITTWMVDERLTTREARDELESYQEQGRAKKIAADSI  129
            MD SE  L+ RARKFA RL  + N+   + DERLTT EA+ E+ S       KK   D+I
Sbjct  65   MDGSEQPLTQRARKFANRLNGRFNLPVALQDERLTTTEAKSEIFSRGGYKALKKDKIDTI  124

Query  130  AASLLIQSWY  139
            +A L+++SW+
Sbjct  125  SACLILESWF  134


> B4EUS0 Putative pre-16S rRNA nuclease [Proteus mirabilis (strain 
HI4320)]
Length=139

 Score =  127 bits (318),  Expect = 7e-41
 Identities = 62/135 (46%), Positives = 90/135 (67%), Gaps = 0/135 (0%)

Query  5    MSHQMIMAFDFGTQKMGIAIGQAAIESSTPLALFPMKDGIPDWNQLLKIVKEWQPTLFLV  64
            MS++ +M FDFGT+ +G AIGQ    ++ PLA F  KDGIPDW+Q+ KI+KEWQP L +V
Sbjct  1    MSNRTVMGFDFGTKSIGAAIGQEVTGTARPLASFKAKDGIPDWSQIEKIIKEWQPDLVVV  60

Query  65   GLPLNMDDSESELSARARKFARRLRHQTNITTWMVDERLTTREARDELESYQEQGRAKKI  124
            GLPLNMD +E  ++ +A+KFA RL  +  +   + DERL+T EAR  L          K 
Sbjct  61   GLPLNMDGTEQLVTTQAKKFANRLHGRFGVQIALHDERLSTVEARAHLFEQGGYRSLDKG  120

Query  125  AADSIAASLLIQSWY  139
            + D+ +A ++++SW+
Sbjct  121  SVDATSAVIILESWF  135


> Q0I1B3 Putative pre-16S rRNA nuclease [Haemophilus somnus (strain 
129Pt)]
Length=141

 Score =  126 bits (317),  Expect = 1e-40
 Identities = 60/130 (46%), Positives = 88/130 (68%), Gaps = 0/130 (0%)

Query  10   IMAFDFGTQKMGIAIGQAAIESSTPLALFPMKDGIPDWNQLLKIVKEWQPTLFLVGLPLN  69
            ++AFDFGT+ +G A+GQ+   ++  L  F  +DGIPDW ++ K +K+WQP + +VGLPLN
Sbjct  5    VLAFDFGTKSIGCAVGQSITGTAQALPAFKAQDGIPDWLKIEKCLKDWQPNIVVVGLPLN  64

Query  70   MDDSESELSARARKFARRLRHQTNITTWMVDERLTTREARDELESYQEQGRAKKIAADSI  129
            MD SE +L+  ARKFA RL  +  +   + DERLTT++ARDE+         KK   DSI
Sbjct  65   MDGSEQDLTHLARKFANRLNGRFGVKVELQDERLTTKQARDEIFQRGGYRALKKEKVDSI  124

Query  130  AASLLIQSWY  139
            +A L+++SW+
Sbjct  125  SACLILESWF  134


> B0UWW2 Putative pre-16S rRNA nuclease [Histophilus somni (strain 
2336)]
Length=141

 Score =  126 bits (317),  Expect = 1e-40
 Identities = 60/130 (46%), Positives = 88/130 (68%), Gaps = 0/130 (0%)

Query  10   IMAFDFGTQKMGIAIGQAAIESSTPLALFPMKDGIPDWNQLLKIVKEWQPTLFLVGLPLN  69
            ++AFDFGT+ +G A+GQ+   ++  L  F  +DGIPDW ++ K +K+WQP + +VGLPLN
Sbjct  5    VLAFDFGTKSIGCAVGQSITGTAQALPAFKAQDGIPDWLKIEKCLKDWQPNIVVVGLPLN  64

Query  70   MDDSESELSARARKFARRLRHQTNITTWMVDERLTTREARDELESYQEQGRAKKIAADSI  129
            MD SE +L+  ARKFA RL  +  +   + DERLTT++ARDE+         KK   DSI
Sbjct  65   MDGSEQDLTHLARKFANRLNGRFGVKVELQDERLTTKQARDEIFQRGGYRALKKEKVDSI  124

Query  130  AASLLIQSWY  139
            +A L+++SW+
Sbjct  125  SACLILESWF  134


> Q21EI6 Putative pre-16S rRNA nuclease [Saccharophagus degradans 
(strain 2-40 / ATCC 43961 / DSM 17024)]
Length=142

 Score =  126 bits (317),  Expect = 1e-40
 Identities = 60/136 (44%), Positives = 90/136 (66%), Gaps = 0/136 (0%)

Query  5    MSHQMIMAFDFGTQKMGIAIGQAAIESSTPLALFPMKDGIPDWNQLLKIVKEWQPTLFLV  64
            M+ Q ++AFDFGT+++G A+GQ+   ++  L   P K+GIP+W+ +  ++KEWQP   +V
Sbjct  1    MTSQTLLAFDFGTKRIGAAVGQSITCTANILNTIPAKEGIPNWDTIEALLKEWQPDTVIV  60

Query  65   GLPLNMDDSESELSARARKFARRLRHQTNITTWMVDERLTTREARDELESYQEQGRAKKI  124
            GLPLNMD +E+EL  RA+KF  R+  +  +   M DERLTTREA++       +G     
Sbjct  61   GLPLNMDGTENELCRRAKKFGNRIHGRFRVPVEMFDERLTTREAKELAWEEGHKGNYAND  120

Query  125  AADSIAASLLIQSWYR  140
              DSIAA L+++SW+R
Sbjct  121  PVDSIAARLILESWWR  136


> C5BCS0 Putative pre-16S rRNA nuclease [Edwardsiella ictaluri 
(strain 93-146)]
Length=140

 Score =  125 bits (313),  Expect = 4e-40
 Identities = 62/135 (46%), Positives = 89/135 (66%), Gaps = 0/135 (0%)

Query  5    MSHQMIMAFDFGTQKMGIAIGQAAIESSTPLALFPMKDGIPDWNQLLKIVKEWQPTLFLV  64
            M+ + I+AFDFGT+ +G AIGQ    S+ PL  F   DG+PDW Q+ K+++EWQP L +V
Sbjct  1    MNPRTILAFDFGTRSIGCAIGQELTGSARPLQSFKANDGVPDWQQIEKVLREWQPDLVVV  60

Query  65   GLPLNMDDSESELSARARKFARRLRHQTNITTWMVDERLTTREARDELESYQEQGRAKKI  124
            GLPLNMD SE  L+ +ARKFA RL  +  +   + DERL+T EAR  L +       +K 
Sbjct  61   GLPLNMDGSEQPLTQQARKFANRLHGRFGVQIALQDERLSTVEARAHLFAGGGYRALEKG  120

Query  125  AADSIAASLLIQSWY  139
              D+ +A+L+++SW+
Sbjct  121  RVDAASAALILESWF  135


> A3MYV3 Putative pre-16S rRNA nuclease [Actinobacillus pleuropneumoniae 
serotype 5b (strain L20)]
Length=137

 Score =  124 bits (312),  Expect = 6e-40
 Identities = 62/132 (47%), Positives = 86/132 (65%), Gaps = 0/132 (0%)

Query  10   IMAFDFGTQKMGIAIGQAAIESSTPLALFPMKDGIPDWNQLLKIVKEWQPTLFLVGLPLN  69
            I+AFDFGT  +G A+GQ    ++  L  F  +DGIP+W+Q+ K++KEWQP   +VGLPLN
Sbjct  5    ILAFDFGTYSIGCAVGQDITGTAQGLPSFKAQDGIPNWDQIEKVIKEWQPERLVVGLPLN  64

Query  70   MDDSESELSARARKFARRLRHQTNITTWMVDERLTTREARDELESYQEQGRAKKIAADSI  129
            MD SE  L+ RA+KFA RL  + N+   + DERLTT  A+ E+         KK   DSI
Sbjct  65   MDGSEQPLTQRAKKFANRLNGRFNLPVELQDERLTTVSAKAEIFERGGYKALKKDKVDSI  124

Query  130  AASLLIQSWYRA  141
            +A L+++SW+ A
Sbjct  125  SACLILESWFEA  136


> B0BSN8 Putative pre-16S rRNA nuclease [Actinobacillus pleuropneumoniae 
serotype 3 (strain JL03)]
Length=137

 Score =  124 bits (312),  Expect = 6e-40
 Identities = 62/132 (47%), Positives = 86/132 (65%), Gaps = 0/132 (0%)

Query  10   IMAFDFGTQKMGIAIGQAAIESSTPLALFPMKDGIPDWNQLLKIVKEWQPTLFLVGLPLN  69
            I+AFDFGT  +G A+GQ    ++  L  F  +DGIP+W+Q+ K++KEWQP   +VGLPLN
Sbjct  5    ILAFDFGTYSIGCAVGQDITGTAQGLPSFKAQDGIPNWDQIEKVIKEWQPERLVVGLPLN  64

Query  70   MDDSESELSARARKFARRLRHQTNITTWMVDERLTTREARDELESYQEQGRAKKIAADSI  129
            MD SE  L+ RA+KFA RL  + N+   + DERLTT  A+ E+         KK   DSI
Sbjct  65   MDGSEQPLTQRAKKFANRLNGRFNLPVELQDERLTTVSAKAEIFERGGYKALKKDKVDSI  124

Query  130  AASLLIQSWYRA  141
            +A L+++SW+ A
Sbjct  125  SACLILESWFEA  136


> B8F5F8 Putative pre-16S rRNA nuclease [Haemophilus parasuis serovar 
5 (strain SH0165)]
Length=138

 Score =  124 bits (310),  Expect = 1e-39
 Identities = 59/132 (45%), Positives = 88/132 (67%), Gaps = 0/132 (0%)

Query  8    QMIMAFDFGTQKMGIAIGQAAIESSTPLALFPMKDGIPDWNQLLKIVKEWQPTLFLVGLP  67
            Q ++AFDFGT  +G A+GQ+   ++  L  F  +DGIP+W Q+ K++ +WQP L +VGLP
Sbjct  3    QTVLAFDFGTNSIGCAVGQSITGTAQGLPAFKAQDGIPNWEQIGKVIAQWQPDLLVVGLP  62

Query  68   LNMDDSESELSARARKFARRLRHQTNITTWMVDERLTTREARDELESYQEQGRAKKIAAD  127
            LNMD +E  L+ RA+KFA RL  + N+   + DERLTT EA+ E+ +       KK   D
Sbjct  63   LNMDGTEQPLTQRAKKFANRLNGRFNLPVELQDERLTTVEAKSEIFARGGFKALKKGKVD  122

Query  128  SIAASLLIQSWY  139
            +I+A L+++SW+
Sbjct  123  AISACLILESWF  134


> C6DFI9 Putative pre-16S rRNA nuclease [Pectobacterium carotovorum 
subsp. carotovorum (strain PC1)]
Length=139

 Score =  124 bits (310),  Expect = 1e-39
 Identities = 61/137 (45%), Positives = 90/137 (66%), Gaps = 0/137 (0%)

Query  5    MSHQMIMAFDFGTQKMGIAIGQAAIESSTPLALFPMKDGIPDWNQLLKIVKEWQPTLFLV  64
            M  + I+AFDFGT+ +G+AIGQ    ++ PL  F  ++GIPDW ++ K++ EWQP L +V
Sbjct  1    MKSRTILAFDFGTKSIGVAIGQEITGTARPLTSFKAQEGIPDWQKVEKLLSEWQPDLVVV  60

Query  65   GLPLNMDDSESELSARARKFARRLRHQTNITTWMVDERLTTREARDELESYQEQGRAKKI  124
            GLPLNMD +E  L+ARARKFA RL  +  +   + DERL+T EAR +L          K 
Sbjct  61   GLPLNMDGTEQPLTARARKFANRLHGRFGVAIALHDERLSTVEARADLFERGGFKALDKG  120

Query  125  AADSIAASLLIQSWYRA  141
            + D+ +A ++++SW+ A
Sbjct  121  SVDAASAVIILESWFEA  137


> P43981 Putative pre-16S rRNA nuclease [Haemophilus influenzae 
(strain ATCC 51907 / DSM 11121 / KW20 / Rd)]
Length=139

 Score =  119 bits (299),  Expect = 5e-38
 Identities = 57/129 (44%), Positives = 85/129 (66%), Gaps = 0/129 (0%)

Query  11   MAFDFGTQKMGIAIGQAAIESSTPLALFPMKDGIPDWNQLLKIVKEWQPTLFLVGLPLNM  70
            +AFDFGT+ +G AIGQ+   ++  L  F  +DGIP+W  + K +KEW+P + +VGLPLNM
Sbjct  6    LAFDFGTKSIGCAIGQSITGTAQALPAFKAQDGIPNWEAIEKCLKEWKPDVVIVGLPLNM  65

Query  71   DDSESELSARARKFARRLRHQTNITTWMVDERLTTREARDELESYQEQGRAKKIAADSIA  130
            D +E +L+ RARKFA RL+ +  +   + DERLTT +AR E+         KK   D ++
Sbjct  66   DGTEQDLTLRARKFANRLQGRFGVNVHLQDERLTTTQARSEIFERGGFKALKKGKIDGVS  125

Query  131  ASLLIQSWY  139
            A L+++SW+
Sbjct  126  ACLILESWF  134


> Q9L3I7 Putative pre-16S rRNA nuclease [Aeromonas hydrophila]
Length=140

 Score =  119 bits (297),  Expect = 1e-37
 Identities = 59/140 (42%), Positives = 84/140 (60%), Gaps = 0/140 (0%)

Query  5    MSHQMIMAFDFGTQKMGIAIGQAAIESSTPLALFPMKDGIPDWNQLLKIVKEWQPTLFLV  64
            MS + IM FD+GT+ +G+AIGQ    +  PL      DGIP+W+ + K++KEWQP L +V
Sbjct  1    MSSRSIMGFDYGTKSIGVAIGQELTGTGQPLRAIKANDGIPNWDDIDKLLKEWQPDLLVV  60

Query  65   GLPLNMDDSESELSARARKFARRLRHQTNITTWMVDERLTTREARDELESYQEQGRAKKI  124
            GLPLNMD +E E++ RARKF  RL  +        DERLTT +AR  L         +K 
Sbjct  61   GLPLNMDGTEQEITVRARKFGNRLHGRFWQAVEFKDERLTTTDARARLFERGGYRALEKG  120

Query  125  AADSIAASLLIQSWYRAPQG  144
            + D ++A L++++W     G
Sbjct  121  SVDGVSAQLILEAWMEEQYG  140


> Q8Z3V1 Putative pre-16S rRNA nuclease [Salmonella typhi]
Length=138

 Score =  114 bits (286),  Expect = 4e-36
 Identities = 56/130 (43%), Positives = 83/130 (64%), Gaps = 0/130 (0%)

Query  10   IMAFDFGTQKMGIAIGQAAIESSTPLALFPMKDGIPDWNQLLKIVKEWQPTLFLVGLPLN  69
            ++AFDFGT+ +G+AIGQ    ++ PL     +DG PDW  + +++KEWQP   +VGLPLN
Sbjct  5    LLAFDFGTKSIGVAIGQRITGTARPLPAIKAQDGTPDWTLIERLLKEWQPDEIIVGLPLN  64

Query  70   MDDSESELSARARKFARRLRHQTNITTWMVDERLTTREARDELESYQEQGRAKKIAADSI  129
            MD +E  L+ARARKFA R+  +  +T  + DERL+T EAR  L          K   DS 
Sbjct  65   MDGTEQPLTARARKFANRIHGRFGVTVTLHDERLSTVEARSGLFERGGYRALNKGKVDSA  124

Query  130  AASLLIQSWY  139
            +A ++++S++
Sbjct  125  SAVIILESYF  134


> P0A8I1 Putative pre-16S rRNA nuclease [Escherichia coli (strain 
K12)]
Length=138

 Score =  114 bits (284),  Expect = 8e-36
 Identities = 55/130 (42%), Positives = 83/130 (64%), Gaps = 0/130 (0%)

Query  10   IMAFDFGTQKMGIAIGQAAIESSTPLALFPMKDGIPDWNQLLKIVKEWQPTLFLVGLPLN  69
            ++AFDFGT+ +G+A+GQ    ++ PL     +DG PDWN + +++KEWQP   +VGLPLN
Sbjct  5    LLAFDFGTKSIGVAVGQRITGTARPLPAIKAQDGTPDWNIIERLLKEWQPDEIIVGLPLN  64

Query  70   MDDSESELSARARKFARRLRHQTNITTWMVDERLTTREARDELESYQEQGRAKKIAADSI  129
            MD +E  L+ARARKFA R+  +  +   + DERL+T EAR  L          K   DS 
Sbjct  65   MDGTEQPLTARARKFANRIHGRFGVEVKLHDERLSTVEARSGLFEQGGYRALNKGKVDSA  124

Query  130  AASLLIQSWY  139
            +A ++++S++
Sbjct  125  SAVIILESYF  134


> O34634 Putative pre-16S rRNA nuclease [Bacillus subtilis (strain 
168)]
Length=138

 Score = 50.4 bits (119),  Expect = 2e-12
 Identities = 30/131 (23%), Positives = 65/131 (50%), Gaps = 2/131 (2%)

Query  10   IMAFDFGTQKMGIAIGQAAIESSTPLALFPMKDGIPDW--NQLLKIVKEWQPTLFLVGLP  67
            I+  D GT+ +G+A+      ++  +    + +   D+  ++L +++K++     ++G P
Sbjct  3    ILGLDLGTKTLGVALSDEMGWTAQGIETIKINEAEGDYGLSRLSELIKDYTIDKIVLGFP  62

Query  68   LNMDDSESELSARARKFARRLRHQTNITTWMVDERLTTREARDELESYQEQGRAKKIAAD  127
             NM+ +       ++ FA+ L    N+   + DERLTT  A   L +     + +K   D
Sbjct  63   KNMNGTVGPRGEASQTFAKVLETTYNVPVVLWDERLTTMAAEKMLIAADVSRQKRKKVID  122

Query  128  SIAASLLIQSW  138
             +AA +++Q +
Sbjct  123  KMAAVMILQGY  133


> P57114 Putative pre-16S rRNA nuclease [Mycoplasma pneumoniae 
(strain ATCC 29342 / M129)]
Length=140

 Score = 50.1 bits (118),  Expect = 3e-12
 Identities = 31/130 (24%), Positives = 63/130 (48%), Gaps = 1/130 (1%)

Query  8    QMIMAFDFGTQKMGIAIGQAAIESSTPLALFPMKDGIPDW-NQLLKIVKEWQPTLFLVGL  66
            Q I+  DFG +++G A+        +P  +F +++ +    N L K +K+    L  + +
Sbjct  2    QYILGIDFGLKRIGTALVNTIDRFPSPFRVFAVQNNLQQAVNTLFKDLKQAGYELVQIVI  61

Query  67   PLNMDDSESELSARARKFARRLRHQTNITTWMVDERLTTREARDELESYQEQGRAKKIAA  126
                   +S +     KF   ++ + N+   ++DE  TT E +  L+    + R  K A 
Sbjct  62   GFPHFHYQSSIQVSIHKFVELIKTRFNVPVTLIDESGTTSEVKANLQELGLKNRTFKKAK  121

Query  127  DSIAASLLIQ  136
            D++AA+L+++
Sbjct  122  DTLAATLILE  131


> Q8DRE2 Putative pre-16S rRNA nuclease [Streptococcus pneumoniae 
(strain ATCC BAA-255 / R6)]
Length=139

 Score = 47.0 bits (110),  Expect = 4e-11
 Identities = 34/132 (26%), Positives = 66/132 (50%), Gaps = 3/132 (2%)

Query  10   IMAFDFGTQKMGIAIGQAAIESSTPLALFPMKD--GIPDWNQLLKIVKEWQPTLFLVGLP  67
            IM  D G++ +G+AI      ++  L +  + +  G   ++++ ++V  ++   F+VGLP
Sbjct  3    IMGLDVGSKTVGVAISDPLGFTAQGLEIIQINEEQGQFGFDRVKELVDTYKVERFVVGLP  62

Query  68   LNMDDSESELSARARKFARRLRHQTNITTWMVDERLTTREARDELESYQEQGRAK-KIAA  126
             NM+++       ++ +  +L     +     DERLTT  A   L    +  R K K   
Sbjct  63   KNMNNTSGPRVEASQAYGAKLEEFFGLPVDYQDERLTTVAAERMLIEQADISRNKRKKVI  122

Query  127  DSIAASLLIQSW  138
            D +AA L++Q++
Sbjct  123  DKLAAQLILQNY  134


> Q2FXW1 Putative pre-16S rRNA nuclease [Staphylococcus aureus 
(strain NCTC 8325)]
Length=142

 Score = 40.0 bits (92),  Expect = 2e-08
 Identities = 36/139 (26%), Positives = 64/139 (46%), Gaps = 7/139 (5%)

Query  5    MSHQMIMAFDFGTQKMGIAIGQAAIESSTPLALFPMKDGIPDW--NQLLKIVKEWQPTLF  62
            M    I+  D G++ +GIAI      ++  L    + +   +   +QL+ I+K+      
Sbjct  1    MLQHKILGLDVGSRTVGIAISDIMGWTAQGLDTLRINEENNELGIDQLVDIIKKHNVGTV  60

Query  63   LVGLPLNMDDS---ESELSARARKFARRLRHQTNITTWMVDERLTTREARDELESYQEQG  119
            ++GLP NM++S     E S   ++  + L    +I   M DERL+T  A   L       
Sbjct  61   VIGLPKNMNNSIGFRGEASLTYKE--KLLEAYPSIEIVMWDERLSTMAAERSLLEADVSR  118

Query  120  RAKKIAADSIAASLLIQSW  138
            + +K   D +AA  ++Q +
Sbjct  119  QKRKQVIDKMAAVFILQGY  137



Lambda      K        H        a         alpha
   0.323    0.133    0.400    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 236848


  Database: c7a332148195ceb35ae91f1d37f40611.SwissProt.fasta
    Posted date:  Sep 19, 2020  12:09 PM
  Number of letters in database: 2,796
  Number of sequences in database:  20



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40