ACIAD0349 / TrEMBL Alignments

BLASTP 2.2.28+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: 9b6ee02eaa72170a8f405f44c39071d4.TrEMBL.fasta
           12 sequences; 7,759 total letters



Query= ACIAD0349

Length=700
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  Q6FF58 Uncharacterized protein [Acinetobacter baylyi (strain AT...  1356    0.0  
  A0A0M1I2U1 Fusaric acid resistance protein [Acinetobacter sp. C15]  1091    0.0  
  A0A1P8EM71 Fusaric acid resistance protein [Acinetobacter soli]     1087    0.0  
  N9BZ29 Uncharacterized protein [Acinetobacter soli NIPH 2899]       1087    0.0  
  A0A009ZAM9 Uncharacterized protein [Acinetobacter sp. 479375]       1024    0.0  
  N9S771 Uncharacterized protein [Acinetobacter ursingii NIPH 706]    1024    0.0  
  N9C6I3 Uncharacterized protein [Acinetobacter ursingii ANC 3649]    1023    0.0  
  A0A2L0HZU7 Fusaric acid resistance protein [Acinetobacter sp. A...   969    0.0  
  R9AQ40 Uncharacterized protein [Acinetobacter tandoii DSM 14970...   967    0.0  
  L0GBB1 Transmembrane fusaric acid efflux protein [Stenotrophomo...   201    3e-58
  Q5MXK9 Uncharacterized protein [Agrobacterium vitis]                 133    6e-37
  Q14UU8 Putative aluminum activated malate transporter [Brassica...  43.1    3e-07


> Q6FF58 Uncharacterized protein [Acinetobacter baylyi (strain 
ATCC 33305 / BD413 / ADP1)]
Length=699

 Score = 1356 bits (3510),  Expect = 0.0
 Identities = 699/699 (100%), Positives = 699/699 (100%), Gaps = 0/699 (0%)

Query  1    MLWKQILAFRPNRMDLIFAVKTFIAMLLALYIAFALDLTYPMWAAGTVIIIAQPYAGMVS  60
            MLWKQILAFRPNRMDLIFAVKTFIAMLLALYIAFALDLTYPMWAAGTVIIIAQPYAGMVS
Sbjct  1    MLWKQILAFRPNRMDLIFAVKTFIAMLLALYIAFALDLTYPMWAAGTVIIIAQPYAGMVS  60

Query  61   SKAVYRLMGTVIGGAFAIFLTPRMIDMPILFTFVLALWIAFCLYVSLLDRTPRSYVFMLA  120
            SKAVYRLMGTVIGGAFAIFLTPRMIDMPILFTFVLALWIAFCLYVSLLDRTPRSYVFMLA
Sbjct  61   SKAVYRLMGTVIGGAFAIFLTPRMIDMPILFTFVLALWIAFCLYVSLLDRTPRSYVFMLA  120

Query  121  GYTTAMVACSSINSIDTYSVFDMALSRVLEISIAVICSAVVSATIFPAHLGTQLQHRVQK  180
            GYTTAMVACSSINSIDTYSVFDMALSRVLEISIAVICSAVVSATIFPAHLGTQLQHRVQK
Sbjct  121  GYTTAMVACSSINSIDTYSVFDMALSRVLEISIAVICSAVVSATIFPAHLGTQLQHRVQK  180

Query  181  TLDDTREVFKSILTDPQHSSSYAELLAGITRDTSDIHGLAVHLTYEHGELRGMTKPLQEL  240
            TLDDTREVFKSILTDPQHSSSYAELLAGITRDTSDIHGLAVHLTYEHGELRGMTKPLQEL
Sbjct  181  TLDDTREVFKSILTDPQHSSSYAELLAGITRDTSDIHGLAVHLTYEHGELRGMTKPLQEL  240

Query  241  LHQITMVVANLMSMSERILQLDQSDVQYRQGLGDLYQHVVTFLRAQTEIEEQQLNRLPDE  300
            LHQITMVVANLMSMSERILQLDQSDVQYRQGLGDLYQHVVTFLRAQTEIEEQQLNRLPDE
Sbjct  241  LHQITMVVANLMSMSERILQLDQSDVQYRQGLGDLYQHVVTFLRAQTEIEEQQLNRLPDE  300

Query  301  FEQDFHHLIALSQPPQQVMLMALKMDIRHFVQNVMTIKLLWARIQQGDKRIPDHIAALTT  360
            FEQDFHHLIALSQPPQQVMLMALKMDIRHFVQNVMTIKLLWARIQQGDKRIPDHIAALTT
Sbjct  301  FEQDFHHLIALSQPPQQVMLMALKMDIRHFVQNVMTIKLLWARIQQGDKRIPDHIAALTT  360

Query  361  QYPSLHRDHGIAVRSSIAAGVATSISFLLWIYSGWHAGYMMAQLTAVSVCILSMLDNPVP  420
            QYPSLHRDHGIAVRSSIAAGVATSISFLLWIYSGWHAGYMMAQLTAVSVCILSMLDNPVP
Sbjct  361  QYPSLHRDHGIAVRSSIAAGVATSISFLLWIYSGWHAGYMMAQLTAVSVCILSMLDNPVP  420

Query  421  ALKLFVRGSIYAAILTIFYAFVIMPEVKEFWQLAFVLAPMAIYLLSMFPHPPLMGLALPM  480
            ALKLFVRGSIYAAILTIFYAFVIMPEVKEFWQLAFVLAPMAIYLLSMFPHPPLMGLALPM
Sbjct  421  ALKLFVRGSIYAAILTIFYAFVIMPEVKEFWQLAFVLAPMAIYLLSMFPHPPLMGLALPM  480

Query  481  LINFIMSLNLQNHYTTNAVILMDTAMAGVVGPIISILAIYFIRAMSPETSATRILASHYR  540
            LINFIMSLNLQNHYTTNAVILMDTAMAGVVGPIISILAIYFIRAMSPETSATRILASHYR
Sbjct  481  LINFIMSLNLQNHYTTNAVILMDTAMAGVVGPIISILAIYFIRAMSPETSATRILASHYR  540

Query  541  AMRAALYIPYGVGFRIHLRGMLDRIGILNTKMVQVDELKFAMNQALIETSAVVNLSRIAE  600
            AMRAALYIPYGVGFRIHLRGMLDRIGILNTKMVQVDELKFAMNQALIETSAVVNLSRIAE
Sbjct  541  AMRAALYIPYGVGFRIHLRGMLDRIGILNTKMVQVDELKFAMNQALIETSAVVNLSRIAE  600

Query  601  LMYQSATSQPLQHALFRLQQLLDRAFRELEKQLTLDLSLKDKILQQIQHIQELLVNETHT  660
            LMYQSATSQPLQHALFRLQQLLDRAFRELEKQLTLDLSLKDKILQQIQHIQELLVNETHT
Sbjct  601  LMYQSATSQPLQHALFRLQQLLDRAFRELEKQLTLDLSLKDKILQQIQHIQELLVNETHT  660

Query  661  EIRQRIEISLNNIQSSILHVQGTETVQALAKVREIDGRV  699
            EIRQRIEISLNNIQSSILHVQGTETVQALAKVREIDGRV
Sbjct  661  EIRQRIEISLNNIQSSILHVQGTETVQALAKVREIDGRV  699


> A0A0M1I2U1 Fusaric acid resistance protein [Acinetobacter sp. 
C15]
Length=696

 Score = 1091 bits (2821),  Expect = 0.0
 Identities = 549/691 (79%), Positives = 611/691 (88%), Gaps = 0/691 (0%)

Query  1    MLWKQILAFRPNRMDLIFAVKTFIAMLLALYIAFALDLTYPMWAAGTVIIIAQPYAGMVS  60
            MLWKQILAFRP+RMDLIFAVKTFIAM+LALYIAF+LDLTYPMWAAGTVIIIAQPYAGMVS
Sbjct  1    MLWKQILAFRPSRMDLIFAVKTFIAMMLALYIAFSLDLTYPMWAAGTVIIIAQPYAGMVS  60

Query  61   SKAVYRLMGTVIGGAFAIFLTPRMIDMPILFTFVLALWIAFCLYVSLLDRTPRSYVFMLA  120
            SKA+YRL+GTV GGA AIFLTP MIDMPILFTFVL+LWIA CLY+SLLDRTPRSYVFMLA
Sbjct  61   SKALYRLLGTVAGGAVAIFLTPHMIDMPILFTFVLSLWIALCLYISLLDRTPRSYVFMLA  120

Query  121  GYTTAMVACSSINSIDTYSVFDMALSRVLEISIAVICSAVVSATIFPAHLGTQLQHRVQK  180
            GYTTAMVACSSINSIDTYSVFDMALSRVLEIS+AVICSAVVSATIFPAHLGTQLQ RVQK
Sbjct  121  GYTTAMVACSSINSIDTYSVFDMALSRVLEISVAVICSAVVSATIFPAHLGTQLQRRVQK  180

Query  181  TLDDTREVFKSILTDPQHSSSYAELLAGITRDTSDIHGLAVHLTYEHGELRGMTKPLQEL  240
            TLDDTRE F+ ILTD QHSS Y +LLAG+ RDTSDIHGLAVHL YE GELRGMTKPLQEL
Sbjct  181  TLDDTREAFERILTDEQHSSQYTQLLAGVARDTSDIHGLAVHLAYERGELRGMTKPLQEL  240

Query  241  LHQITMVVANLMSMSERILQLDQSDVQYRQGLGDLYQHVVTFLRAQTEIEEQQLNRLPDE  300
            LHQITM+VANL+SMSERI Q+D+ D++YRQ L  L+ HVV FLR Q +I++ QL+ LP E
Sbjct  241  LHQITMIVANLVSMSERIAQMDELDLRYRQVLPQLHTHVVRFLREQQDIQDDQLDHLPAE  300

Query  301  FEQDFHHLIALSQPPQQVMLMALKMDIRHFVQNVMTIKLLWARIQQGDKRIPDHIAALTT  360
            F  DF HL  L  P Q+VML A +MD+RHF+QNVMTIKLLW RIQ+GDKRIPD IAALTT
Sbjct  301  FTTDFQHLFELIHPSQRVMLQAFQMDVRHFIQNVMTIKLLWTRIQRGDKRIPDRIAALTT  360

Query  361  QYPSLHRDHGIAVRSSIAAGVATSISFLLWIYSGWHAGYMMAQLTAVSVCILSMLDNPVP  420
            QYPSLHRDHGIAVRSSIAAG+AT+ SFLLWIYSGWHAGYMMAQLTAVS CILS LDNPVP
Sbjct  361  QYPSLHRDHGIAVRSSIAAGIATAASFLLWIYSGWHAGYMMAQLTAVSACILSTLDNPVP  420

Query  421  ALKLFVRGSIYAAILTIFYAFVIMPEVKEFWQLAFVLAPMAIYLLSMFPHPPLMGLALPM  480
            ALKLF++GSI +A+LT+FYAF+IMPEVKEFWQLAFVLAPMAIYLLSMFP P LMGLALPM
Sbjct  421  ALKLFIKGSILSAVLTVFYAFIIMPEVKEFWQLAFVLAPMAIYLLSMFPQPALMGLALPM  480

Query  481  LINFIMSLNLQNHYTTNAVILMDTAMAGVVGPIISILAIYFIRAMSPETSATRILASHYR  540
            LINF+MSLNLQNHY TNAV+LMDTAMAGV+GPIISILAI FIRAMSPETSATRILA HY+
Sbjct  481  LINFVMSLNLQNHYATNAVVLMDTAMAGVMGPIISILAIQFIRAMSPETSATRILALHYK  540

Query  541  AMRAALYIPYGVGFRIHLRGMLDRIGILNTKMVQVDELKFAMNQALIETSAVVNLSRIAE  600
            AMR ALY+PYGV FR+HLR MLDRIGILNTKMVQ DELK AMN+ALIE SAVVNLSRIAE
Sbjct  541  AMREALYLPYGVRFRVHLRSMLDRIGILNTKMVQSDELKQAMNRALIEASAVVNLSRIAE  600

Query  601  LMYQSATSQPLQHALFRLQQLLDRAFRELEKQLTLDLSLKDKILQQIQHIQELLVNETHT  660
            +++    S  L+ ALFR QQLLDR F+E EKQL    +L++K+L QIQ I+ +LVNE + 
Sbjct  601  VLHGDTGSTELKRALFRFQQLLDRGFKEQEKQLETPQALQEKLLAQIQQIEMVLVNEPNL  660

Query  661  EIRQRIEISLNNIQSSILHVQGTETVQALAK  691
             ++QRIE+S+NNI+SSI H Q  +    ++K
Sbjct  661  SLKQRIEVSMNNIRSSIFHAQQNKPAALMSK  691


> A0A1P8EM71 Fusaric acid resistance protein [Acinetobacter soli]
Length=696

 Score = 1087 bits (2812),  Expect = 0.0
 Identities = 547/691 (79%), Positives = 610/691 (88%), Gaps = 0/691 (0%)

Query  1    MLWKQILAFRPNRMDLIFAVKTFIAMLLALYIAFALDLTYPMWAAGTVIIIAQPYAGMVS  60
            MLWKQILAFRP+RMDLIFAVKTFIAM+LALYIAF+LDLTYPMWAAGTVIIIAQPYAGMVS
Sbjct  1    MLWKQILAFRPSRMDLIFAVKTFIAMMLALYIAFSLDLTYPMWAAGTVIIIAQPYAGMVS  60

Query  61   SKAVYRLMGTVIGGAFAIFLTPRMIDMPILFTFVLALWIAFCLYVSLLDRTPRSYVFMLA  120
            SKA+YRL+GTV GGA AIFLTP MIDMPILFTFVL+LWIA CLY+SLLDRTPRSYVFMLA
Sbjct  61   SKALYRLLGTVAGGAVAIFLTPHMIDMPILFTFVLSLWIALCLYISLLDRTPRSYVFMLA  120

Query  121  GYTTAMVACSSINSIDTYSVFDMALSRVLEISIAVICSAVVSATIFPAHLGTQLQHRVQK  180
            GYTTAMVACSSINSIDTYSVFDMALSRVLEIS+AVICSAVVSATIFPAHLGTQLQ RVQK
Sbjct  121  GYTTAMVACSSINSIDTYSVFDMALSRVLEISVAVICSAVVSATIFPAHLGTQLQRRVQK  180

Query  181  TLDDTREVFKSILTDPQHSSSYAELLAGITRDTSDIHGLAVHLTYEHGELRGMTKPLQEL  240
            TLDDTRE F+ ILTD QHSS Y +LLAG+ RDTSDIHGLAVHL YE GELRGMTKPLQEL
Sbjct  181  TLDDTREAFERILTDEQHSSQYTQLLAGVARDTSDIHGLAVHLAYERGELRGMTKPLQEL  240

Query  241  LHQITMVVANLMSMSERILQLDQSDVQYRQGLGDLYQHVVTFLRAQTEIEEQQLNRLPDE  300
            LHQITM+VANL+SMSERI Q+D+ D++YRQ L  L+ HVV FLR Q +I++ QL+ LP E
Sbjct  241  LHQITMIVANLVSMSERIAQMDELDLRYRQVLPQLHTHVVRFLREQQDIQDDQLDHLPAE  300

Query  301  FEQDFHHLIALSQPPQQVMLMALKMDIRHFVQNVMTIKLLWARIQQGDKRIPDHIAALTT  360
            F  DF HL  L  P Q VML A +MD+RHF+QNVMTIKLLW RIQ+GDKRIPD IAALTT
Sbjct  301  FTTDFQHLFELIHPSQWVMLQAFQMDVRHFIQNVMTIKLLWTRIQRGDKRIPDRIAALTT  360

Query  361  QYPSLHRDHGIAVRSSIAAGVATSISFLLWIYSGWHAGYMMAQLTAVSVCILSMLDNPVP  420
            QYPSLHRDHGIAVRSSIAAG+AT+ SFLLWIYSGWHAGYMMAQLTAVS CILS LDNPVP
Sbjct  361  QYPSLHRDHGIAVRSSIAAGIATAASFLLWIYSGWHAGYMMAQLTAVSACILSTLDNPVP  420

Query  421  ALKLFVRGSIYAAILTIFYAFVIMPEVKEFWQLAFVLAPMAIYLLSMFPHPPLMGLALPM  480
            ALKLF++GSI +A+LT+FYAF+IMPEVKEFWQLAFVLAPMAIYLLSMFP P LMGLALPM
Sbjct  421  ALKLFIKGSILSAVLTVFYAFIIMPEVKEFWQLAFVLAPMAIYLLSMFPQPALMGLALPM  480

Query  481  LINFIMSLNLQNHYTTNAVILMDTAMAGVVGPIISILAIYFIRAMSPETSATRILASHYR  540
            LINF+MSLNLQNHY TNAV+LMDTAMAGV+GPIISILAI FIRAMSPETSATRILA HY+
Sbjct  481  LINFVMSLNLQNHYATNAVVLMDTAMAGVMGPIISILAIQFIRAMSPETSATRILALHYK  540

Query  541  AMRAALYIPYGVGFRIHLRGMLDRIGILNTKMVQVDELKFAMNQALIETSAVVNLSRIAE  600
            AMR ALY+PYGV FR+HLR MLDRIGILNTKMVQ DELK AMN+ALIE SAVVNLSRIAE
Sbjct  541  AMREALYLPYGVRFRVHLRSMLDRIGILNTKMVQSDELKQAMNRALIEASAVVNLSRIAE  600

Query  601  LMYQSATSQPLQHALFRLQQLLDRAFRELEKQLTLDLSLKDKILQQIQHIQELLVNETHT  660
            +++    S  L+ ALFR QQLLDR F++ EK+L    +L++K+L QIQ I+ +L NE + 
Sbjct  601  VLHGDTGSTELKRALFRFQQLLDRGFKDQEKRLETPQALQEKLLAQIQQIETVLANEPNL  660

Query  661  EIRQRIEISLNNIQSSILHVQGTETVQALAK  691
             ++QRIE+S+NNI+SSI HVQ  +    ++K
Sbjct  661  SLKQRIEVSMNNIRSSIFHVQQNKPAALMSK  691


> N9BZ29 Uncharacterized protein [Acinetobacter soli NIPH 2899]
Length=696

 Score = 1087 bits (2811),  Expect = 0.0
 Identities = 546/691 (79%), Positives = 610/691 (88%), Gaps = 0/691 (0%)

Query  1    MLWKQILAFRPNRMDLIFAVKTFIAMLLALYIAFALDLTYPMWAAGTVIIIAQPYAGMVS  60
            MLWKQILAFRP+RMDLIFAVKTFIAM+LALYIAF+LDLTYPMWAAGTVIIIAQPYAGMVS
Sbjct  1    MLWKQILAFRPSRMDLIFAVKTFIAMMLALYIAFSLDLTYPMWAAGTVIIIAQPYAGMVS  60

Query  61   SKAVYRLMGTVIGGAFAIFLTPRMIDMPILFTFVLALWIAFCLYVSLLDRTPRSYVFMLA  120
            SKA+YRL+GTV GGA AIFLTP MIDMPILFTFVL+LWIA CLY+SLLDRTPRSYVFMLA
Sbjct  61   SKALYRLLGTVAGGAVAIFLTPHMIDMPILFTFVLSLWIALCLYISLLDRTPRSYVFMLA  120

Query  121  GYTTAMVACSSINSIDTYSVFDMALSRVLEISIAVICSAVVSATIFPAHLGTQLQHRVQK  180
            GYTTAMVACSSINSIDTYSVFDMALSRVLEIS+AVICSAVVSATIFPAHLGTQLQ RVQK
Sbjct  121  GYTTAMVACSSINSIDTYSVFDMALSRVLEISVAVICSAVVSATIFPAHLGTQLQRRVQK  180

Query  181  TLDDTREVFKSILTDPQHSSSYAELLAGITRDTSDIHGLAVHLTYEHGELRGMTKPLQEL  240
            TLDDTRE F+ ILTD QHSS Y +LLAG+ RDTSDIHGLAVHL YE GELRGMTKPLQEL
Sbjct  181  TLDDTREAFERILTDEQHSSQYTQLLAGVARDTSDIHGLAVHLAYERGELRGMTKPLQEL  240

Query  241  LHQITMVVANLMSMSERILQLDQSDVQYRQGLGDLYQHVVTFLRAQTEIEEQQLNRLPDE  300
            LHQITM+VANL+SMSERI Q+D+ D++YRQ L  L+ HVV FLR Q +I++ QL+ LP E
Sbjct  241  LHQITMIVANLVSMSERIAQMDELDLRYRQVLPQLHTHVVRFLREQQDIQDDQLDHLPAE  300

Query  301  FEQDFHHLIALSQPPQQVMLMALKMDIRHFVQNVMTIKLLWARIQQGDKRIPDHIAALTT  360
            F  DF HL  L  P Q+VML A +MD+RHF+QNVMTIKLLW RIQ+GDKRIPD IAALTT
Sbjct  301  FTTDFQHLFELIHPSQRVMLQAFQMDVRHFIQNVMTIKLLWTRIQRGDKRIPDRIAALTT  360

Query  361  QYPSLHRDHGIAVRSSIAAGVATSISFLLWIYSGWHAGYMMAQLTAVSVCILSMLDNPVP  420
            QYPSLHRDHGIAVRSSIAAG+AT+ SFLLWIYSGWHAGYMMAQLTAVS CILS LDNPVP
Sbjct  361  QYPSLHRDHGIAVRSSIAAGIATAASFLLWIYSGWHAGYMMAQLTAVSACILSTLDNPVP  420

Query  421  ALKLFVRGSIYAAILTIFYAFVIMPEVKEFWQLAFVLAPMAIYLLSMFPHPPLMGLALPM  480
            ALKLF++GSI +A+LT+FYAF+IMPEVKEFWQLAFVLAPMAIYLLSMFP P LMGLALPM
Sbjct  421  ALKLFIKGSILSAVLTVFYAFIIMPEVKEFWQLAFVLAPMAIYLLSMFPQPALMGLALPM  480

Query  481  LINFIMSLNLQNHYTTNAVILMDTAMAGVVGPIISILAIYFIRAMSPETSATRILASHYR  540
            LINF+MSLNLQNHY TNAV+LMDTAMAGV+GPIISILAI FIRAMSPETSATRILA HY+
Sbjct  481  LINFVMSLNLQNHYATNAVVLMDTAMAGVMGPIISILAIQFIRAMSPETSATRILALHYK  540

Query  541  AMRAALYIPYGVGFRIHLRGMLDRIGILNTKMVQVDELKFAMNQALIETSAVVNLSRIAE  600
            AMR ALY+PYGV FR+HLR MLDRIGILNTKMVQ DELK AMN+ALIE SAVVNLSRIAE
Sbjct  541  AMREALYLPYGVRFRVHLRSMLDRIGILNTKMVQSDELKQAMNRALIEASAVVNLSRIAE  600

Query  601  LMYQSATSQPLQHALFRLQQLLDRAFRELEKQLTLDLSLKDKILQQIQHIQELLVNETHT  660
            +++    S  L+ ALFR QQLLDR F++ EK+L    +L++K+L QIQ I+ +L NE + 
Sbjct  601  VLHGDTGSTELKRALFRFQQLLDRGFKDQEKRLETPQALQEKLLAQIQQIETVLANEPNL  660

Query  661  EIRQRIEISLNNIQSSILHVQGTETVQALAK  691
             ++QRIE+S+NNI+SSI H Q  +    ++K
Sbjct  661  SLKQRIEVSMNNIRSSIFHAQQNKPAALMSK  691


> A0A009ZAM9 Uncharacterized protein [Acinetobacter sp. 479375]
Length=696

 Score = 1024 bits (2647),  Expect = 0.0
 Identities = 518/681 (76%), Positives = 584/681 (86%), Gaps = 0/681 (0%)

Query  1    MLWKQILAFRPNRMDLIFAVKTFIAMLLALYIAFALDLTYPMWAAGTVIIIAQPYAGMVS  60
            ML+KQILAFRP+RMDLIFAVKTFIAM+LALY AF LDLTYPMWAAGTVIIIAQPYAGMVS
Sbjct  1    MLFKQILAFRPSRMDLIFAVKTFIAMMLALYTAFVLDLTYPMWAAGTVIIIAQPYAGMVS  60

Query  61   SKAVYRLMGTVIGGAFAIFLTPRMIDMPILFTFVLALWIAFCLYVSLLDRTPRSYVFMLA  120
            SKA+YRL GT++GG  AIF TPR+IDMPILFT +L++W+  CLY+SLLDRTPRSYVFMLA
Sbjct  61   SKALYRLTGTILGGILAIFFTPRLIDMPILFTCILSIWVGVCLYISLLDRTPRSYVFMLA  120

Query  121  GYTTAMVACSSINSIDTYSVFDMALSRVLEISIAVICSAVVSATIFPAHLGTQLQHRVQK  180
            GYTT M+ACSSI +ID++SVFDMALSRVLEISIAVICSAVVSATIFPAHLG QLQ RVQK
Sbjct  121  GYTTVMIACSSIYNIDSHSVFDMALSRVLEISIAVICSAVVSATIFPAHLGAQLQQRVQK  180

Query  181  TLDDTREVFKSILTDPQHSSSYAELLAGITRDTSDIHGLAVHLTYEHGELRGMTKPLQEL  240
            TLDDTR+VF SILTD QHS SY +LL  I RDT+DIHGLAVHL YE GEL GMTKP+QEL
Sbjct  181  TLDDTRDVFASILTDQQHSQSYTQLLGHIARDTTDIHGLAVHLAYESGELHGMTKPIQEL  240

Query  241  LHQITMVVANLMSMSERILQLDQSDVQYRQGLGDLYQHVVTFLRAQTEIEEQQLNRLPDE  300
            LHQ TMVVANL+SMSERI QLDQ D  YR GL  L+QHVV+FLRAQT+I E +LN+LP E
Sbjct  241  LHQETMVVANLVSMSERIFQLDQIDQHYRLGLEQLHQHVVSFLRAQTDIHESELNQLPPE  300

Query  301  FEQDFHHLIALSQPPQQVMLMALKMDIRHFVQNVMTIKLLWARIQQGDKRIPDHIAALTT  360
            FE DF HL+ LSQP Q++ML ALKMDIRHF+QNVM +KLLW  I +G+KRIPD IA +TT
Sbjct  301  FESDFEHLLVLSQPQQEIMLDALKMDIRHFIQNVMAVKLLWQLINKGEKRIPDTIATITT  360

Query  361  QYPSLHRDHGIAVRSSIAAGVATSISFLLWIYSGWHAGYMMAQLTAVSVCILSMLDNPVP  420
            QYPSLHRDHGIAVRSSIAA VAT+ SFLLWIY+GWHAGYMMAQLTAVS CILS +DNP+P
Sbjct  361  QYPSLHRDHGIAVRSSIAAAVATATSFLLWIYTGWHAGYMMAQLTAVSACILSTMDNPIP  420

Query  421  ALKLFVRGSIYAAILTIFYAFVIMPEVKEFWQLAFVLAPMAIYLLSMFPHPPLMGLALPM  480
            ALK F+RGS+YAAILTI YAF IMP+V  FWQLA VLAP+ IYL SMFP P LM LALPM
Sbjct  421  ALKTFIRGSVYAAILTIIYAFTIMPQVHAFWQLAVVLAPLVIYLASMFPTPMLMMLALPM  480

Query  481  LINFIMSLNLQNHYTTNAVILMDTAMAGVVGPIISILAIYFIRAMSPETSATRILASHYR  540
            LINFIMSLNLQN Y  +AVILMDTAMAGVVGPIISILAIYFIRAMSPETSA RIL+ HYR
Sbjct  481  LINFIMSLNLQNRYAMDAVILMDTAMAGVVGPIISILAIYFIRAMSPETSARRILSLHYR  540

Query  541  AMRAALYIPYGVGFRIHLRGMLDRIGILNTKMVQVDELKFAMNQALIETSAVVNLSRIAE  600
            A++ ALYIPYG  FRIHLR MLDRIG+LNTK+VQ D LK AMN ALIETSAVVNLSRIAE
Sbjct  541  ALKEALYIPYGSAFRIHLRSMLDRIGVLNTKLVQSDGLKHAMNLALIETSAVVNLSRIAE  600

Query  601  LMYQSATSQPLQHALFRLQQLLDRAFRELEKQLTLDLSLKDKILQQIQHIQELLVNETHT  660
            L   S T   L+ AL  LQQLL+ +FR+ EK + L+  LKDK+L Q+ +I+ L++NE   
Sbjct  601  LSQNSKTLPELKQALKHLQQLLEASFRDQEKHIALNTVLKDKVLAQMDYIETLVLNEPGI  660

Query  661  EIRQRIEISLNNIQSSILHVQ  681
            E++ RI++S+NNI+SSI HVQ
Sbjct  661  EVKHRIQMSMNNIRSSIFHVQ  681


> N9S771 Uncharacterized protein [Acinetobacter ursingii NIPH 706]
Length=696

 Score = 1024 bits (2647),  Expect = 0.0
 Identities = 518/681 (76%), Positives = 584/681 (86%), Gaps = 0/681 (0%)

Query  1    MLWKQILAFRPNRMDLIFAVKTFIAMLLALYIAFALDLTYPMWAAGTVIIIAQPYAGMVS  60
            ML+KQILAFRP+RMDLIFAVKTFIAM+LALY AF LDLTYPMWAAGTVIIIAQPYAGMVS
Sbjct  1    MLFKQILAFRPSRMDLIFAVKTFIAMMLALYTAFVLDLTYPMWAAGTVIIIAQPYAGMVS  60

Query  61   SKAVYRLMGTVIGGAFAIFLTPRMIDMPILFTFVLALWIAFCLYVSLLDRTPRSYVFMLA  120
            SKA+YRL GT++GG  AIF TPR+IDMPILFT +L++W+  CLY+SLLDRTPRSYVFMLA
Sbjct  61   SKALYRLTGTILGGILAIFFTPRLIDMPILFTCILSIWVGVCLYISLLDRTPRSYVFMLA  120

Query  121  GYTTAMVACSSINSIDTYSVFDMALSRVLEISIAVICSAVVSATIFPAHLGTQLQHRVQK  180
            GYTT M+ACSSI +ID++SVFDMALSRVLEISIAVICSAVVSATIFPAHLG QLQ RVQK
Sbjct  121  GYTTVMIACSSIYNIDSHSVFDMALSRVLEISIAVICSAVVSATIFPAHLGAQLQQRVQK  180

Query  181  TLDDTREVFKSILTDPQHSSSYAELLAGITRDTSDIHGLAVHLTYEHGELRGMTKPLQEL  240
            TLDDTR+VF SILTD QHS SY +LL  I RDT+DIHGLAVHL YE GEL GMTKP+QEL
Sbjct  181  TLDDTRDVFASILTDQQHSQSYTQLLGHIARDTTDIHGLAVHLAYESGELHGMTKPIQEL  240

Query  241  LHQITMVVANLMSMSERILQLDQSDVQYRQGLGDLYQHVVTFLRAQTEIEEQQLNRLPDE  300
            LHQ TMVVANL+SMSERI QLDQ D  YR GL  L+QHVV+FLRAQT+I E +LN+LP E
Sbjct  241  LHQETMVVANLVSMSERIFQLDQIDQHYRLGLEQLHQHVVSFLRAQTDIHESELNQLPPE  300

Query  301  FEQDFHHLIALSQPPQQVMLMALKMDIRHFVQNVMTIKLLWARIQQGDKRIPDHIAALTT  360
            FE DF HL+ LSQP Q++ML ALKMDIRHF+QNVM +KLLW  I +G+KRIPD IA +TT
Sbjct  301  FESDFEHLLVLSQPQQEIMLDALKMDIRHFIQNVMAVKLLWQLINKGEKRIPDTIATITT  360

Query  361  QYPSLHRDHGIAVRSSIAAGVATSISFLLWIYSGWHAGYMMAQLTAVSVCILSMLDNPVP  420
            QYPSLHRDHGIAVRSSIAA VAT+ SFLLWIY+GWHAGYMMAQLTAVS CILS +DNP+P
Sbjct  361  QYPSLHRDHGIAVRSSIAAAVATATSFLLWIYTGWHAGYMMAQLTAVSACILSTMDNPIP  420

Query  421  ALKLFVRGSIYAAILTIFYAFVIMPEVKEFWQLAFVLAPMAIYLLSMFPHPPLMGLALPM  480
            ALK F+RGS+YAAILTI YAF IMP+V  FWQLA VLAP+ IYL SMFP P LM LALPM
Sbjct  421  ALKTFIRGSVYAAILTIIYAFTIMPQVHAFWQLAVVLAPLVIYLASMFPTPMLMMLALPM  480

Query  481  LINFIMSLNLQNHYTTNAVILMDTAMAGVVGPIISILAIYFIRAMSPETSATRILASHYR  540
            LINFIMSLNLQN Y  +AVILMDTAMAGVVGPIISILAIYFIRAMSPETSA RIL+ HYR
Sbjct  481  LINFIMSLNLQNRYAMDAVILMDTAMAGVVGPIISILAIYFIRAMSPETSARRILSLHYR  540

Query  541  AMRAALYIPYGVGFRIHLRGMLDRIGILNTKMVQVDELKFAMNQALIETSAVVNLSRIAE  600
            A++ ALYIPYG  FRIHLR MLDRIG+LNTK+VQ D LK AMN ALIETSAVVNLSRIAE
Sbjct  541  ALKEALYIPYGSAFRIHLRSMLDRIGVLNTKLVQSDGLKHAMNLALIETSAVVNLSRIAE  600

Query  601  LMYQSATSQPLQHALFRLQQLLDRAFRELEKQLTLDLSLKDKILQQIQHIQELLVNETHT  660
            L   S T   L+ AL  LQQLL+ +FR+ EK + L+  LKDK+L Q+ +I+ L++NE   
Sbjct  601  LSQNSKTLPELKQALKHLQQLLEASFRDQEKHIALNTVLKDKVLAQMDYIETLVLNEPGI  660

Query  661  EIRQRIEISLNNIQSSILHVQ  681
            E++ RI++S+NNI+SSI HVQ
Sbjct  661  EVKHRIQMSMNNIRSSIFHVQ  681


> N9C6I3 Uncharacterized protein [Acinetobacter ursingii ANC 3649]
Length=696

 Score = 1023 bits (2646),  Expect = 0.0
 Identities = 517/681 (76%), Positives = 584/681 (86%), Gaps = 0/681 (0%)

Query  1    MLWKQILAFRPNRMDLIFAVKTFIAMLLALYIAFALDLTYPMWAAGTVIIIAQPYAGMVS  60
            ML+KQILAFRP+RMDLIFAVKTFIAM+LALY AF LDLTYPMWAAGTVIIIAQPYAGMVS
Sbjct  1    MLFKQILAFRPSRMDLIFAVKTFIAMMLALYTAFVLDLTYPMWAAGTVIIIAQPYAGMVS  60

Query  61   SKAVYRLMGTVIGGAFAIFLTPRMIDMPILFTFVLALWIAFCLYVSLLDRTPRSYVFMLA  120
            SKA+YRL GT++GG  AIF TPR+IDMPILFT +L++W+  CLY+SLLDRTPRSYVFMLA
Sbjct  61   SKALYRLTGTILGGILAIFFTPRLIDMPILFTCILSIWVGVCLYISLLDRTPRSYVFMLA  120

Query  121  GYTTAMVACSSINSIDTYSVFDMALSRVLEISIAVICSAVVSATIFPAHLGTQLQHRVQK  180
            GYTT M+ACSSI +ID++SVFDMALSRVLEISIAVICSAVVSATIFPAHLG QLQ RVQK
Sbjct  121  GYTTVMIACSSIYNIDSHSVFDMALSRVLEISIAVICSAVVSATIFPAHLGAQLQQRVQK  180

Query  181  TLDDTREVFKSILTDPQHSSSYAELLAGITRDTSDIHGLAVHLTYEHGELRGMTKPLQEL  240
            TLDDTR+VF SILTD QHS SY +LL  I RDT+DIHGLAVHL YE GEL GMTKP+QEL
Sbjct  181  TLDDTRDVFASILTDQQHSQSYTQLLGHIARDTTDIHGLAVHLAYESGELHGMTKPIQEL  240

Query  241  LHQITMVVANLMSMSERILQLDQSDVQYRQGLGDLYQHVVTFLRAQTEIEEQQLNRLPDE  300
            LHQ+TMVVANL+SMSERI QLDQ D  YR GL  L+  VV+FLRAQT+I E +LN+LP E
Sbjct  241  LHQLTMVVANLVSMSERIFQLDQIDQHYRLGLEQLHHDVVSFLRAQTDIHESELNQLPPE  300

Query  301  FEQDFHHLIALSQPPQQVMLMALKMDIRHFVQNVMTIKLLWARIQQGDKRIPDHIAALTT  360
            FE DF HL+ LSQP Q++ML ALKMDIRHF+QNVM +KLLW  I +G+KRIPD IA +TT
Sbjct  301  FESDFEHLLVLSQPQQEIMLDALKMDIRHFIQNVMAVKLLWQLINKGEKRIPDTIATITT  360

Query  361  QYPSLHRDHGIAVRSSIAAGVATSISFLLWIYSGWHAGYMMAQLTAVSVCILSMLDNPVP  420
            QYPSLHRDHGIAVRSSIAA VAT+ SFLLWIY+GWHAGYMMAQLTAVS CILS +DNP+P
Sbjct  361  QYPSLHRDHGIAVRSSIAAAVATATSFLLWIYTGWHAGYMMAQLTAVSACILSTMDNPIP  420

Query  421  ALKLFVRGSIYAAILTIFYAFVIMPEVKEFWQLAFVLAPMAIYLLSMFPHPPLMGLALPM  480
            ALK F+RGS+YAAILTI YAF IMP+V  FWQLA VLAP+ IYL SMFP P LM LALPM
Sbjct  421  ALKTFIRGSVYAAILTIIYAFTIMPQVHAFWQLAVVLAPLVIYLASMFPTPMLMMLALPM  480

Query  481  LINFIMSLNLQNHYTTNAVILMDTAMAGVVGPIISILAIYFIRAMSPETSATRILASHYR  540
            LINFIMSLNLQN Y  +AVILMDTAMAGVVGPIISILAIYFIRAMSPETSA RIL+ HYR
Sbjct  481  LINFIMSLNLQNRYAMDAVILMDTAMAGVVGPIISILAIYFIRAMSPETSARRILSLHYR  540

Query  541  AMRAALYIPYGVGFRIHLRGMLDRIGILNTKMVQVDELKFAMNQALIETSAVVNLSRIAE  600
            A++ ALYIPYG  FRIHLR MLDRIG+LNTK+VQ DELK AMN ALIETSAVVNLSRIAE
Sbjct  541  ALKEALYIPYGSAFRIHLRSMLDRIGVLNTKLVQSDELKHAMNLALIETSAVVNLSRIAE  600

Query  601  LMYQSATSQPLQHALFRLQQLLDRAFRELEKQLTLDLSLKDKILQQIQHIQELLVNETHT  660
            L   S T   L+ AL  LQQLL+ +FR+ EK + L+  LKDK+L Q+ +I+ L++NE   
Sbjct  601  LSQNSKTLPELKQALKHLQQLLEASFRDQEKHIALNTVLKDKVLAQMDYIETLVLNEPDI  660

Query  661  EIRQRIEISLNNIQSSILHVQ  681
            E++ RI++S+NNI+SSI HVQ
Sbjct  661  EVKHRIQMSMNNIRSSIFHVQ  681


> A0A2L0HZU7 Fusaric acid resistance protein [Acinetobacter sp. 
ACNIH2]
Length=694

 Score =  969 bits (2505),  Expect = 0.0
 Identities = 481/679 (71%), Positives = 574/679 (85%), Gaps = 0/679 (0%)

Query  1    MLWKQILAFRPNRMDLIFAVKTFIAMLLALYIAFALDLTYPMWAAGTVIIIAQPYAGMVS  60
            ML K ILAFRP+RMD++FAVKTFIAMLLAL+IAF+LDLTYPMWAAGTVII+A PYAGMVS
Sbjct  1    MLIKPILAFRPSRMDMVFAVKTFIAMLLALFIAFSLDLTYPMWAAGTVIIVAHPYAGMVS  60

Query  61   SKAVYRLMGTVIGGAFAIFLTPRMIDMPILFTFVLALWIAFCLYVSLLDRTPRSYVFMLA  120
            SKAVYR++GT+IGG  AI LTP+ ID+PI FT VLA W+  CLY+SLLDRTPRSYVFMLA
Sbjct  61   SKAVYRILGTLIGGIIAIVLTPQFIDLPIFFTLVLAGWVGLCLYISLLDRTPRSYVFMLA  120

Query  121  GYTTAMVACSSINSIDTYSVFDMALSRVLEISIAVICSAVVSATIFPAHLGTQLQHRVQK  180
            GYTT MV CSSINSI T+SVFDMAL R+LEIS+AV+CSAVVS+T+FP HLG  +Q RVQK
Sbjct  121  GYTTVMVVCSSINSISTHSVFDMALGRILEISVAVLCSAVVSSTLFPVHLGALVQKRVQK  180

Query  181  TLDDTREVFKSILTDPQHSSSYAELLAGITRDTSDIHGLAVHLTYEHGELRGMTKPLQEL  240
            TLDDTR+VF SILTDP+HS  Y +LLA ITRDTSDIHGLAVHL+YE G L+GMTK LQEL
Sbjct  181  TLDDTRQVFHSILTDPEHSHRYTQLLAAITRDTSDIHGLAVHLSYERGALQGMTKSLQEL  240

Query  241  LHQITMVVANLMSMSERILQLDQSDVQYRQGLGDLYQHVVTFLRAQTEIEEQQLNRLPDE  300
            LHQ++M VANL++MSER+ QLDQ D +YRQ L  L++HV+ FLRAQ  ++  QL +LP+ 
Sbjct  241  LHQVSMTVANLVAMSERVAQLDQIDTRYRQVLPVLHEHVLQFLRAQQHVQVDQLKQLPES  300

Query  301  FEQDFHHLIALSQPPQQVMLMALKMDIRHFVQNVMTIKLLWARIQQGDKRIPDHIAALTT  360
            FEQDF  L  L+   QQ++L ALKMD+RHFV+NV+TIK LW  IQQGDKRIP+ I  LTT
Sbjct  301  FEQDFTALSELAVAEQQIILHALKMDVRHFVENVVTIKCLWDLIQQGDKRIPEQIVTLTT  360

Query  361  QYPSLHRDHGIAVRSSIAAGVATSISFLLWIYSGWHAGYMMAQLTAVSVCILSMLDNPVP  420
             YPSLHRDHG+AVRS++AA +AT+I+FLLWIYSGWHAGYMMAQLTAV+VCILS LDNPVP
Sbjct  361  SYPSLHRDHGMAVRSAVAAVIATTIAFLLWIYSGWHAGYMMAQLTAVTVCILSGLDNPVP  420

Query  421  ALKLFVRGSIYAAILTIFYAFVIMPEVKEFWQLAFVLAPMAIYLLSMFPHPPLMGLALPM  480
            AL+LF+RGS+YAAI+T+FYAFVIMPEV EFWQLAFVLAP+++YLLSM P+PPLMGLALPM
Sbjct  421  ALRLFIRGSVYAAIITMFYAFVIMPEVHEFWQLAFVLAPLSLYLLSMLPNPPLMGLALPM  480

Query  481  LINFIMSLNLQNHYTTNAVILMDTAMAGVVGPIISILAIYFIRAMSPETSATRILASHYR  540
            LINFIMSLNLQN Y+T+AV+L+DTA+AGV+GPIISI AIYFIRAMSPETSA+RIL  HYR
Sbjct  481  LINFIMSLNLQNRYSTDAVLLIDTALAGVMGPIISIFAIYFIRAMSPETSASRILTLHYR  540

Query  541  AMRAALYIPYGVGFRIHLRGMLDRIGILNTKMVQVDELKFAMNQALIETSAVVNLSRIAE  600
            AMR AL+IPYGV FRIHLR MLDRIG+LNTK+VQ ++LK AMN ALIETSAV+NLSR+AE
Sbjct  541  AMREALFIPYGVQFRIHLRSMLDRIGVLNTKLVQSEQLKQAMNLALIETSAVINLSRLAE  600

Query  601  LMYQSATSQPLQHALFRLQQLLDRAFRELEKQLTLDLSLKDKILQQIQHIQELLVNETHT  660
             +     S  LQ A   LQ  L++AF   EKQ  L   LK ++  ++QH+++ L  E + 
Sbjct  601  FIQNPNVSVSLQQAFIALQHSLEQAFLVQEKQQILPEGLKQQVFAELQHVEQCLAAEPNA  660

Query  661  EIRQRIEISLNNIQSSILH  679
            +   R+++++NNI+SSI H
Sbjct  661  DFCMRVKMNINNIRSSIFH  679


> R9AQ40 Uncharacterized protein [Acinetobacter tandoii DSM 14970 
= CIP 107469]
Length=695

 Score =  967 bits (2499),  Expect = 0.0
 Identities = 479/679 (71%), Positives = 574/679 (85%), Gaps = 0/679 (0%)

Query  1    MLWKQILAFRPNRMDLIFAVKTFIAMLLALYIAFALDLTYPMWAAGTVIIIAQPYAGMVS  60
            +L K ILAFRP+RMD++FAVKTFIAMLLAL+IAF+LDLTYPMWAAGTVII+A P+AGMVS
Sbjct  2    LLIKPILAFRPSRMDMVFAVKTFIAMLLALFIAFSLDLTYPMWAAGTVIIVAHPFAGMVS  61

Query  61   SKAVYRLMGTVIGGAFAIFLTPRMIDMPILFTFVLALWIAFCLYVSLLDRTPRSYVFMLA  120
            SKAVYR++GT+IGG  AI LTP+ ID+PI FT VLA W+  CLY+SLLDRTPRSYVFMLA
Sbjct  62   SKAVYRILGTLIGGIVAIVLTPQFIDLPIFFTLVLAGWVGLCLYISLLDRTPRSYVFMLA  121

Query  121  GYTTAMVACSSINSIDTYSVFDMALSRVLEISIAVICSAVVSATIFPAHLGTQLQHRVQK  180
            GYTT MV CSSINSI T+SVFDMAL R+LEIS+AV+CSAVVS+T+FPAHLG  +Q RVQK
Sbjct  122  GYTTVMVVCSSINSISTHSVFDMALGRILEISVAVLCSAVVSSTLFPAHLGALVQKRVQK  181

Query  181  TLDDTREVFKSILTDPQHSSSYAELLAGITRDTSDIHGLAVHLTYEHGELRGMTKPLQEL  240
            TLDDTR+VF+SILTDP+HS  Y +LLA ITRDTSDIHGLAVHL+YE G L+GMTK LQEL
Sbjct  182  TLDDTRQVFRSILTDPEHSHRYTQLLAAITRDTSDIHGLAVHLSYERGALQGMTKSLQEL  241

Query  241  LHQITMVVANLMSMSERILQLDQSDVQYRQGLGDLYQHVVTFLRAQTEIEEQQLNRLPDE  300
            LHQ++M VANL++MSER+ QLDQ D  YRQ L  L++HV+ FLR Q  ++  QL +LP+ 
Sbjct  242  LHQVSMTVANLVAMSERVAQLDQIDTNYRQVLPVLHEHVLQFLRTQQHVQVDQLKQLPES  301

Query  301  FEQDFHHLIALSQPPQQVMLMALKMDIRHFVQNVMTIKLLWARIQQGDKRIPDHIAALTT  360
            FEQDF  L  L+   QQ++L ALKMD+RHFV+NV+TIK LW  IQQGDKRIP+ I  LTT
Sbjct  302  FEQDFTALSELAVAEQQIILHALKMDVRHFVENVVTIKCLWDLIQQGDKRIPEQIVTLTT  361

Query  361  QYPSLHRDHGIAVRSSIAAGVATSISFLLWIYSGWHAGYMMAQLTAVSVCILSMLDNPVP  420
             YPSLHRDHG+AVRS++AA +AT+I+FLLWIYSGWHAGYMMAQLTAV+VCILS LDNPVP
Sbjct  362  SYPSLHRDHGMAVRSAVAAVIATTIAFLLWIYSGWHAGYMMAQLTAVTVCILSGLDNPVP  421

Query  421  ALKLFVRGSIYAAILTIFYAFVIMPEVKEFWQLAFVLAPMAIYLLSMFPHPPLMGLALPM  480
            AL+LF+RGS+YAAI+T+FYAFVIMPEV EFWQLAFVLAP+++YLLSM P+PPLMGLALPM
Sbjct  422  ALRLFIRGSVYAAIITMFYAFVIMPEVHEFWQLAFVLAPLSLYLLSMLPNPPLMGLALPM  481

Query  481  LINFIMSLNLQNHYTTNAVILMDTAMAGVVGPIISILAIYFIRAMSPETSATRILASHYR  540
            LINFIMSLNLQN Y+T+AV+L+DTA+AGV+GPIISI AIYFIRAMSPETSA+RIL  HYR
Sbjct  482  LINFIMSLNLQNRYSTDAVLLIDTALAGVMGPIISIFAIYFIRAMSPETSASRILTLHYR  541

Query  541  AMRAALYIPYGVGFRIHLRGMLDRIGILNTKMVQVDELKFAMNQALIETSAVVNLSRIAE  600
            AMR AL+IPYGV FRIHLR MLDRIG+LNTK+VQ ++LK AMN ALIETSAV+NLSR+AE
Sbjct  542  AMREALFIPYGVQFRIHLRSMLDRIGVLNTKLVQSEQLKQAMNLALIETSAVINLSRLAE  601

Query  601  LMYQSATSQPLQHALFRLQQLLDRAFRELEKQLTLDLSLKDKILQQIQHIQELLVNETHT  660
             +     S  LQ A   LQ  L++AF   EKQ  L   LK ++  ++QH+++ L  E + 
Sbjct  602  FIQNPNVSVSLQQAFIALQHSLEQAFLVQEKQQILPEGLKQQVFAELQHVEQCLAAEPNA  661

Query  661  EIRQRIEISLNNIQSSILH  679
            +   R+++++NNI+SSI H
Sbjct  662  DFCMRVKMNINNIRSSIFH  680


> L0GBB1 Transmembrane fusaric acid efflux protein [Stenotrophomonas 
maltophilia]
Length=656

 Score =  201 bits (510),  Expect = 3e-58
 Identities = 142/569 (25%), Positives = 259/569 (46%), Gaps = 50/569 (9%)

Query  8    AFRPNRMDLIFAVKTFIAMLLALYIAFALDLTYPMWAAGTVIIIAQPYAGMVSSKAVYRL  67
            A R ++  ++F++K  +A  L LY++  + L  P W  GTV +++QP +G   S+ ++RL
Sbjct  25   ALRTDQEAVLFSLKCLLAASLGLYVSLRIGLNRPFWVVGTVYLVSQPLSGATLSRGLFRL  84

Query  68   MGTVIGGAFAIFLTPRMIDMPILFTFVLALWIAFCLYVSLLDRTPRSYVFMLAGYTTAMV  127
            +G V G    + L PR  + P++ +  LA W+A CLY+++LDRTPR+Y F+LAGYTT+++
Sbjct  85   LGAVGGAVATVALVPRFANAPLVLSATLATWMALCLYLAMLDRTPRAYAFLLAGYTTSLI  144

Query  128  ACSSINSIDTYSVFDMALSRVLEISIAVICSAVVSATIFPAHLGTQLQHRVQKTLDDTRE  187
               ++  +    VF +A++RV EI+I ++ + +V   + P  +  ++  RV   L+D   
Sbjct  145  GFPAV--MVPGEVFTIAITRVQEIAIGILAATLVHGLVLPRRVSMRVHARVAAVLEDAER  202

Query  188  VFKSILTDPQHSSSYAELLAGITRDTSDIHGLAVHLTYEHGELRGMTKPLQELLHQITMV  247
              + +       +  A   + +  D  ++H  ++HL ++               H +  V
Sbjct  203  WTRDMRASAS-DTVLATDRSKVAADLLELHVQSIHLPFDSA-------------HGVAQV  248

Query  248  VANLMSMSERILQLDQSDVQYRQGLGDLYQHVVTFLRAQTEIEEQQLN-RLPDEFEQD--  304
                                  Q L  L+  ++  L   + +E+     R P     D  
Sbjct  249  ----------------------QILRALHDRMLDVLMLSSAVEDSTARLRSPQAGTMDAS  286

Query  305  -FHHLIALSQPPQQVMLMALKMDIRHFVQNVMTIKLLWARIQQGDKRIPDHIAALTTQYP  363
             +  L+  S   QQ      ++D+ H    V+  +L  AR       +PD +A    Q  
Sbjct  287  GWRDLLQASLAAQQA-----ELDLAHSHCRVLQAQLHTAR-PDWRLHVPDRLAR-NVQGA  339

Query  364  SLHRDHGIAVRSSIAAGVATSISFLLWIYSGWHAGYMMAQLTAVSVCILSMLDNPVPALK  423
             +HRDH    RS++ A V   +S +LWI +GW  G     +   +  +   ++   P + 
Sbjct  340  LIHRDHRNDARSALGAFVGILLSCVLWIITGWSDGATAVSIIGTACVLFGTIEARAPHVM  399

Query  424  LFVRGSIYAAILTIFYAFVIMPEVKEFWQLAFVLAPMAIYLLSMFPHPPLMGLALPMLIN  483
             ++ GS     + + Y  +I P + +F  L   LAP  +   S    PP +  AL +++ 
Sbjct  400  RYLVGSCIGVAVGLLYGLLIFPALSDFVGLMAALAPALLLCGSFLARPPFIMAALGVVLT  459

Query  484  FIMSLNLQNHYTTNAVILMDTAMAGVVGPIISILAIYFIRAMSPETSATRILASHYRAMR  543
            F +   L    +TN V  ++  +A  +G  +++ ++   +      +  R+  S  R + 
Sbjct  460  FPLIAGLGATNSTNIVGALNNGVALFIGTTVALCSMQLFQTADAGRNRARLERSIRREI-  518

Query  544  AALYIPYGVGFRIHLRGMLDRIGILNTKM  572
            A      G      L  MLDRIG+L  ++
Sbjct  519  AGHAAGQGGATHAWLSRMLDRIGLLAPRL  547


> Q5MXK9 Uncharacterized protein [Agrobacterium vitis]
Length=341

 Score =  133 bits (334),  Expect = 6e-37
 Identities = 78/253 (31%), Positives = 134/253 (53%), Gaps = 4/253 (2%)

Query  11   PNRMDLIFAVKTFIAMLLALYIAFALDLTYPMWAAGTVIIIAQPYAGMVSSKAVYRLMGT  70
            P   D +F+ K F A +LALY+A   DL+ P WA   V I++ P+AG   SKA+YR++GT
Sbjct  4    PTWRDWVFSGKAFAAAVLALYLALMFDLSRPYWAVSAVYIVSNPFAGATKSKALYRVLGT  63

Query  71   VIGGAFAIFLTPRMIDMPILFTFVLALWIAFCLYVSLLDRTPRSYVFMLAGYTTAMVACS  130
            ++G + A+   P  ++ P L + V+ALW    L++S+LDR+ R+YVFML  +  A     
Sbjct  64   LLGASAAVLFVPIFVNAPELLSLVVALWTGTLLFLSMLDRSARAYVFMLPVHAAADCLAQ  123

Query  131  SINSIDTYSVFDMALSRVLEISIAVICSAVVSATIFPAHLGTQLQHRVQKTLDDTREVFK  190
               S      F  AL+R  EI++ ++C+ +V+  +FP+ +G     R+   L D     +
Sbjct  124  RQWS---RRRFRFALARSEEITLGILCATLVNQVVFPSSIGRLFGDRINVWLADAGAWAE  180

Query  191  SILTDPQHSSSYAELLAGITRDTSDIHGLAVHLTYEHGELRGMTKPLQELLHQITMVVAN  250
             IL     + S       +  D S +  +   L+Y+ G  + +    +EL  ++ M++  
Sbjct  181  DILRGEGATPSTPLKRQQLASDVSSLDLMISQLSYDPG-TKDVVGQARELRGRLLMLLPV  239

Query  251  LMSMSERILQLDQ  263
              S+++R+  + Q
Sbjct  240  FSSLADRLHAVKQ  252


> Q14UU8 Putative aluminum activated malate transporter [Brassica 
napus]
Length=498

 Score = 43.1 bits (100),  Expect = 3e-07
 Identities = 33/148 (22%), Positives = 65/148 (44%), Gaps = 8/148 (5%)

Query  42   MWAAGTVIIIAQPYAGMVSSKAVYRLMGTVIGGAFAI------FLTPRMIDMPILFTFVL  95
            MWA  TV+++ +   G   SK + R + T++ G  A+       L+ R I+  +L TFV 
Sbjct  56   MWAVMTVVVVFEFSVGATLSKGLNRGVATLVAGGLALGAHQLASLSGRTIEPILLATFVF  115

Query  96   ALWIAFCLYVSLLDRTPRSYVFMLAGYTTAMVACSSINSIDTYSVFDMALSRVLEISIAV  155
             +  A   +V    R   ++ + +  +     +  S++      + D+A SR+  + +  
Sbjct  116  -VTAALATFVRFFPRVKATFDYGMLIFILTF-SLISLSQFRDEEILDLAESRLSTVLVGG  173

Query  156  ICSAVVSATIFPAHLGTQLQHRVQKTLD  183
            +   ++S  + P   G  L   +   LD
Sbjct  174  VSCILISIFVCPVWAGQDLHSLLVSNLD  201



Lambda      K        H        a         alpha
   0.328    0.138    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4564028


  Database: 9b6ee02eaa72170a8f405f44c39071d4.TrEMBL.fasta
    Posted date:  Sep 18, 2020  3:52 PM
  Number of letters in database: 7,759
  Number of sequences in database:  12



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40