ACIAD0349 / SwissProt Alignments

BLASTP 2.2.28+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: 76618e738f22d7cbab3d7db56b8dc2a8.SwissProt.fasta
           21 sequences; 12,754 total letters



Query= ACIAD0349

Length=700
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  Q8ZPN4 Uncharacterized transporter YdhK [Salmonella typhimurium...   153    5e-42
  Q8Z6P7 Uncharacterized transporter YdhK [Salmonella typhi]           151    3e-41
  P76186 Uncharacterized transporter YdhK [Escherichia coli (stra...   139    2e-37
  Q8X638 Uncharacterized transporter YdhK [Escherichia coli O157:H7]   139    4e-37
  D2C1Z6 p-hydroxybenzoic acid efflux pump subunit AaeB [Dickeya ...   136    2e-36
  C6C4L7 p-hydroxybenzoic acid efflux pump subunit AaeB [Dickeya ...   130    3e-34
  C6DIM3 p-hydroxybenzoic acid efflux pump subunit AaeB [Pectobac...   127    3e-33
  A1JRH8 p-hydroxybenzoic acid efflux pump subunit AaeB [Yersinia...   125    6e-33
  Q6DAH4 p-hydroxybenzoic acid efflux pump subunit AaeB [Pectobac...   125    1e-32
  D0KEK2 p-hydroxybenzoic acid efflux pump subunit AaeB [Pectobac...   120    2e-31
  D4GCB2 p-hydroxybenzoic acid efflux pump subunit AaeB [Pantoea ...   115    9e-30
  D8MXN7 p-hydroxybenzoic acid efflux pump subunit AaeB [Erwinia ...   115    9e-30
  D5CDA0 p-hydroxybenzoic acid efflux pump subunit AaeB [Enteroba...   112    9e-29
  P46481 p-hydroxybenzoic acid efflux pump subunit AaeB [Escheric...   103    6e-26
  O05543 Uncharacterized transporter GOX0755 [Gluconobacter oxyda...   102    3e-25
  Q9KWL2 UPF0421 protein SAHV_1874 [Staphylococcus aureus (strain...  57.8    8e-12
  Q2FX03 UPF0421 protein SAOUHSC_02103 [Staphylococcus aureus (st...  57.8    8e-12
  Q93Z29 Aluminum-activated malate transporter 5 [Arabidopsis tha...  53.1    4e-10
  P71083 UPF0421 protein YgaE [Bacillus subtilis (strain 168)]        45.1    1e-07
  Q9SHM1 Aluminum-activated malate transporter 6 [Arabidopsis tha...  43.9    3e-07
  P32715 Multidrug resistance protein MdtO [Escherichia coli (str...  43.1    5e-07


> Q8ZPN4 Uncharacterized transporter YdhK [Salmonella typhimurium 
(strain LT2 / SGSC1412 / ATCC 700720)]
Length=679

 Score =  153 bits (387),  Expect = 5e-42
 Identities = 125/527 (24%), Positives = 227/527 (43%), Gaps = 22/527 (4%)

Query  18   FAVKTFIAMLLALYIAFALDLTYPMWAAGTVIIIAQPYAGMVSSKAVYRLMGTVIGGAFA  77
            +A++  IAM LAL  A+ L+L  P WA  +  +++ P  G V SK++ R+ G+++G   A
Sbjct  23   YALRNTIAMCLALTFAYYLNLDEPYWAMTSAAVVSFPTVGGVISKSLGRIAGSLLGATAA  82

Query  78   IFLTPRMIDMPILFTFVLALWIAFCLYVSLLDRTPRSYVFMLAGYTTAMVACSSINSIDT  137
            + +    ++ P LF F +A WI FC +         +Y F L+GYT A++A   +N ++ 
Sbjct  83   LIIAGHTLNEPWLFLFSMAAWIGFCTWACAHFTNNAAYAFQLSGYTAAIIAFPMVNIVEI  142

Query  138  YSVFDMALSRVLEISIAVICSAVVSATIFPAHLGTQLQHRVQKTLDDTREVFKSILTDPQ  197
              ++D+A +RV E+ + ++C  ++   +     GT L     K +        S+L  P+
Sbjct  143  TQLWDIAQARVCEVIVGILCGGMMMMILPSTSDGTALL-TAFKNMHARLLEHASLLWQPE  201

Query  198  HSSSYAELLAGITRDTSDIHGLAVHLTYEHGELRGMTKPLQELLHQITMVVANLMSMSER  257
             + +      G+      ++ L +   + H   R     L  LLHQ   + + + S+   
Sbjct  202  TTDAIRSAHEGVIGQILTMNLLRIQAFWSHYRFRRQNALLNALLHQQLRLTSVISSLRRM  261

Query  258  ILQLDQSDVQYRQGLGDLYQHVVTFLRAQTEIEEQQLNRLPDEFEQDFHHLIALSQPPQQ  317
            +L         R+ +  L   +    RA +    Q +  L  + EQD+ HL         
Sbjct  262  LLNWPTPPENSREVIEQLLAELAK-PRADSYTVAQIIAPLRPQDEQDYRHL---------  311

Query  318  VMLMALKMDIRHFVQNVMTIKLLWARIQQGDKRIPDHIAALTTQYPSLHRDHGIAVRSSI  377
                A    +R+F Q  +        I+ G     D I    T   + H D+  A+ S +
Sbjct  312  ----AFWQRLRYFCQLYLRSSRQLYLIESGAP--VDQIHIRRTPGLARHTDNAEAIWSGV  365

Query  378  AAGVATSISFLLWIYSGWHAGYMMAQLTAVSVCILSMLDNPVPALKLFVRGSIYAAILTI  437
                  ++     I + W +G     L A+S  + S++  P  +L L +R  +  ++ + 
Sbjct  366  RTFCTLTVIGAWSIGAQWESGPGALTLAAISCVLYSIVATPFKSLSLLMRTLVLLSLFSF  425

Query  438  FYAFVIMPEVKEFWQLAFVLAPMAIYL-LSMFPHPPLMGLALPMLINFIMSLNLQNHYTT  496
               F +M ++ + WQ    L P+ + + L     P L GL   +++     + + N    
Sbjct  426  VVKFGLMVQITDLWQFLLFLFPLFVTMQLLKLQMPKLAGLWGQLIVFMGSFIAVTNPPVY  485

Query  497  NAVILMDTAMAGVVGPIISILAIYFIRAMSPETSATRILASHYRAMR  543
            +    ++   A +VG  IS LA   +R  S    + R    H RA+R
Sbjct  486  DFADFLNDNTAKIVGVAISWLAFAILRPGSDAVKSRR----HIRALR  528


> Q8Z6P7 Uncharacterized transporter YdhK [Salmonella typhi]
Length=679

 Score =  151 bits (381),  Expect = 3e-41
 Identities = 124/527 (24%), Positives = 227/527 (43%), Gaps = 22/527 (4%)

Query  18   FAVKTFIAMLLALYIAFALDLTYPMWAAGTVIIIAQPYAGMVSSKAVYRLMGTVIGGAFA  77
            +A++  IAM LAL  A+ L+L  P WA  +  +++ P  G V SK++ R+ G+++G   A
Sbjct  23   YALRNTIAMCLALTFAYYLNLDEPYWAMTSAAVVSFPTVGGVISKSLGRIAGSLLGATAA  82

Query  78   IFLTPRMIDMPILFTFVLALWIAFCLYVSLLDRTPRSYVFMLAGYTTAMVACSSINSIDT  137
            + +    ++ P LF F +A WI FC +         +Y F L+GYT A++A   +N ++ 
Sbjct  83   LIIAGHTLNEPWLFLFSMAAWIGFCTWACAHFTNNAAYAFQLSGYTAAIIAFPMVNIVEI  142

Query  138  YSVFDMALSRVLEISIAVICSAVVSATIFPAHLGTQLQHRVQKTLDDTREVFKSILTDPQ  197
              ++D+A +RV E+ + ++C  ++   +     GT L   + K +        S+L  P+
Sbjct  143  TQLWDIAQARVCEVIVGILCGGMMMMILPSTSDGTALLTAL-KNMHARLLEHASLLWQPE  201

Query  198  HSSSYAELLAGITRDTSDIHGLAVHLTYEHGELRGMTKPLQELLHQITMVVANLMSMSER  257
             + +      G+      ++ L +   + H   R     L  LLHQ   + + + S+   
Sbjct  202  TTDAIRSAHEGVIGQILTMNLLRIQAFWSHYRFRRQNALLNALLHQQLRLTSVISSLRRM  261

Query  258  ILQLDQSDVQYRQGLGDLYQHVVTFLRAQTEIEEQQLNRLPDEFEQDFHHLIALSQPPQQ  317
            +L         R+ +  L   +    RA +    + +  L  + EQD+ HL         
Sbjct  262  LLNWPTPPENSREVIEQLLAELAK-PRADSYTVARIIAPLCPQDEQDYRHL---------  311

Query  318  VMLMALKMDIRHFVQNVMTIKLLWARIQQGDKRIPDHIAALTTQYPSLHRDHGIAVRSSI  377
                A    +R+F Q  +        I+ G     D I    T   + H D+  A+ S +
Sbjct  312  ----AFWQRLRYFCQLYLRSSRQLYLIESGAP--VDQIHIRRTPGLARHTDNAEAIWSGV  365

Query  378  AAGVATSISFLLWIYSGWHAGYMMAQLTAVSVCILSMLDNPVPALKLFVRGSIYAAILTI  437
                  ++     I   W +G     L A+S  + S++  P  +L L +R  +  ++ + 
Sbjct  366  RTFCTLTVIGAWSIGVQWESGPGALTLAAISCVLYSIVATPFKSLSLLMRTLVLLSLFSF  425

Query  438  FYAFVIMPEVKEFWQLAFVLAPMAIYL-LSMFPHPPLMGLALPMLINFIMSLNLQNHYTT  496
               F +M ++ + WQ    L P+ + + L     P L GL   +++     + + N    
Sbjct  426  VVKFGLMVQITDLWQFLLFLFPLFVTMQLLKLQMPKLAGLWGQLIVFMGSFIAVTNPPVY  485

Query  497  NAVILMDTAMAGVVGPIISILAIYFIRAMSPETSATRILASHYRAMR  543
            +    ++   A +VG  IS LA   +R  S    + R    H RA+R
Sbjct  486  DFADFLNDNTAKIVGVAISWLAFAILRPGSDAVKSRR----HIRALR  528


> P76186 Uncharacterized transporter YdhK [Escherichia coli (strain 
K12)]
Length=670

 Score =  139 bits (351),  Expect = 2e-37
 Identities = 121/538 (22%), Positives = 224/538 (42%), Gaps = 27/538 (5%)

Query  9    FRPNRMDLIFAVKTFIAMLLALYIAFALDLTYPMWAAGTVIIIAQPYAGMVSSKAVYRLM  68
            FR       +A++  IAM LAL +A+ L+L  P WA  +  +++ P  G V SK++ R+ 
Sbjct  14   FRATLAQWRYALRNTIAMCLALTVAYYLNLDEPYWAMTSAAVVSFPTVGGVISKSLGRIA  73

Query  69   GTVIGGAFAIFLTPRMIDMPILFTFVLALWIAFCLYVSLLDRTPRSYVFMLAGYTTAMVA  128
            G+++G   A+ L    ++ P  F   ++ W+ FC +         +Y F LAGYT A++A
Sbjct  74   GSLLGAIAALLLAGHTLNEPWFFLLSMSAWLGFCTWACAHFTNNVAYAFQLAGYTAAIIA  133

Query  129  CSSINSIDTYSVFDMALSRVLEISIAVICSAVVSATIFPAHLGTQLQHRVQKTLDDTREV  188
               +N  +   ++D+A +RV E+ + ++C  ++   I P+           K +      
Sbjct  134  FPMVNITEASQLWDIAQARVCEVIVGILCGGMM-MMILPSSSDATALLTALKNMHARLLE  192

Query  189  FKSILTDPQHSSSYAELLAGITRDTSDIHGLAVHLTYEHGELRGMTKPLQELLHQITMVV  248
              S+L  P+ + +      G+      ++ L +   + H   R     L  LLHQ   + 
Sbjct  193  HASLLWQPETTDAIRAAHEGVIGQILTMNLLRIQAFWSHYRFRQQNARLNALLHQQLRMT  252

Query  249  ANLMSMSERILQLDQSDVQYRQGLGDLYQHVVTFLRAQTEI--EEQQLNRLPDEFEQDFH  306
            + + S+   +L         R+ L  L   +     +QT++    + +  L      D+ 
Sbjct  253  SVISSLRRMLLNWPSPPGATREILEQL---LTALASSQTDVYTVARIIAPLRPTNVADYR  309

Query  307  HLIALSQPPQQVMLMALKMDIRHFVQNVMTIKLLWARIQQGDKRIPDHIAALTTQYPSLH  366
            H             +A    +R+F +  +       R+Q G   + DH     T   + H
Sbjct  310  H-------------VAFWQRLRYFCRLYLQSSQELHRLQSG---VDDHTRLPRTSGLARH  353

Query  367  RDHGIAVRSSIAAGVATSISFLLWIYSGWHAGYMMAQLTAVSVCILSMLDNPVPALKLFV  426
             D+  A+ S +       +     I S W AG     L A+S  + S +  P  +L L +
Sbjct  354  TDNAEAMWSGLRTFCTLMMIGAWSIASQWDAGANALTLAAISCVLYSAVAAPFKSLSLLM  413

Query  427  RGSIYAAILTIFYAFVIMPEVKEFWQLAFVLAPMAIYLLSMFPHPPLMGLALPMLINFIM  486
            R  +  ++ +    F +M ++ + WQ    L P+   +  +    P        LI F+ 
Sbjct  414  RTLVLLSLFSFVVKFGLMVQISDLWQFLLFLFPLLATMQLLKLQMPKFAALWGQLIVFMG  473

Query  487  S-LNLQNHYTTNAVILMDTAMAGVVGPIISILAIYFIRAMSPETSATRILASHYRAMR  543
            S + + N    +    ++  +A +VG  ++ LA   +R  S    + R    H RA+R
Sbjct  474  SFIAVTNPPVYDFADFLNDNLAKIVGVALAWLAFAILRPGSDARKSRR----HIRALR  527


> Q8X638 Uncharacterized transporter YdhK [Escherichia coli O157:H7]
Length=670

 Score =  139 bits (349),  Expect = 4e-37
 Identities = 121/538 (22%), Positives = 223/538 (41%), Gaps = 27/538 (5%)

Query  9    FRPNRMDLIFAVKTFIAMLLALYIAFALDLTYPMWAAGTVIIIAQPYAGMVSSKAVYRLM  68
            FR       +A++  IAM LAL +A+ L+L  P WA  +  +++ P  G V SK++ R+ 
Sbjct  14   FRATLAQWRYALRNTIAMCLALTVAYYLNLDEPYWAMTSAAVVSFPTVGGVISKSLGRIA  73

Query  69   GTVIGGAFAIFLTPRMIDMPILFTFVLALWIAFCLYVSLLDRTPRSYVFMLAGYTTAMVA  128
            G+++G   A+ L    ++ P  F   ++ W+ FC +         +Y F LAGYT A++A
Sbjct  74   GSLLGAIAALLLAGHTLNEPWFFLLSMSAWLGFCTWACAHFTNNVAYAFQLAGYTAAIIA  133

Query  129  CSSINSIDTYSVFDMALSRVLEISIAVICSAVVSATIFPAHLGTQLQHRVQKTLDDTREV  188
               +N  +   ++D+A +RV E+ + ++C  ++   I P+           K +      
Sbjct  134  FPMVNITEASQLWDIAQARVCEVIVGILCGGMM-MMILPSSSDATALLTALKNMHARLLE  192

Query  189  FKSILTDPQHSSSYAELLAGITRDTSDIHGLAVHLTYEHGELRGMTKPLQELLHQITMVV  248
              S+L  P+ + +      G+      ++ L +   + H   R     L  LLHQ   + 
Sbjct  193  HASLLWQPETTDAIRAAHEGVIGQILTMNLLRIQAFWSHYRFRQQNARLNALLHQQLRMT  252

Query  249  ANLMSMSERILQLDQSDVQYRQGLGDLYQHVVTFLRAQTEI--EEQQLNRLPDEFEQDFH  306
            + + S+   +L         R+ L  L   +     +QT++    + +  L      D+ 
Sbjct  253  SVISSLRRMLLNWPSPPGATREILEQL---LTALASSQTDVYTVARIIAPLRPTNVADYR  309

Query  307  HLIALSQPPQQVMLMALKMDIRHFVQNVMTIKLLWARIQQGDKRIPDHIAALTTQYPSLH  366
            H             +A    +R+F +  +       R+Q     + DH     T   + H
Sbjct  310  H-------------VAFWQRLRYFCRLYLQSSQELHRLQSD---VDDHARLPRTSGLARH  353

Query  367  RDHGIAVRSSIAAGVATSISFLLWIYSGWHAGYMMAQLTAVSVCILSMLDNPVPALKLFV  426
             D+  A+ S +       +     I S W AG     L A+S  + S +  P  +L L +
Sbjct  354  TDNAEAMWSGLRTFCTLMMIGAWSIASQWDAGANALTLAAISCVLYSAVAAPFKSLSLLM  413

Query  427  RGSIYAAILTIFYAFVIMPEVKEFWQLAFVLAPMAIYLLSMFPHPPLMGLALPMLINFIM  486
            R  +  ++ +    F +M ++ + WQ    L P+   +  +    P        LI F+ 
Sbjct  414  RTLVLLSLFSFVVKFGLMVQISDLWQFLLFLFPLLATMQLLKLQMPKFAALWGQLIVFMG  473

Query  487  S-LNLQNHYTTNAVILMDTAMAGVVGPIISILAIYFIRAMSPETSATRILASHYRAMR  543
            S + + N    N    ++  +A +VG  ++ LA   +R  S    + R    H RA+R
Sbjct  474  SFIAVTNPPVYNFADFLNDNLAKIVGVALAWLAFAILRPGSDARKSRR----HIRALR  527


> D2C1Z6 p-hydroxybenzoic acid efflux pump subunit AaeB [Dickeya 
zeae (strain Ech586)]
Length=650

 Score =  136 bits (343),  Expect = 2e-36
 Identities = 128/540 (24%), Positives = 231/540 (43%), Gaps = 45/540 (8%)

Query  11   PNRMDLIFAVKTFIAMLLALYIAFALDLTYPMWAAGTVIIIA---------QPYAGMVSS  61
            P  + L FA K   A++L+L + F L L  P WAA T  I+A          P++G +  
Sbjct  5    PAFLRLRFAFKLSTAIVLSLVLGFHLQLETPRWAALTAAIVAAGPAFVAGGDPFSGAIRH  64

Query  62   KAVYRLMGTVIGGAFAIFLTPRMIDMPILFTFVLALWIAFCLYVSLLDRTPRSYVFMLAG  121
            + + R++GT IG   A+ +    +  P L   +  LW   C+++S L +   +YVF LAG
Sbjct  65   RGMLRVIGTFIGCIGALVIIISTVRAPALMLLLCCLWAGVCVWISSLVKVENAYVFALAG  124

Query  122  YTTAMVACSSINSIDTYSVFDMALSRVLEISIAVICSAVVSATIFPAHLGTQLQHRVQKT  181
            YTT ++  +S    +   +   A+ R  EI + ++C+ +      P  +  ++   V++ 
Sbjct  125  YTTLIIIVTS--QSEPLRILQFAVERCSEIVLGIVCAILADLLFSPRSIKQEIDRAVEEL  182

Query  182  LDDTREVFKSILTDPQHSSSYAELLA---GITRDTSDIHGLAVHLTYEHGELRGMTKPLQ  238
            L     + +  +    +  S  EL A   G+ R T  I+G+   L  E    +G ++ + 
Sbjct  183  LVGQYHLLQRCV----NGISKEELDAVWNGLVRKTHAINGMRSVLMMESSRWQGASRRIT  238

Query  239  ELLHQITMVVANLMSMSERILQLDQSDVQYRQGLGDLYQHVVTFLRAQTEIEEQQLNRLP  298
             LL Q  +++    +   R+   D  +         +   +   L    E       RL 
Sbjct  239  TLLTQSWVMIT--QACETRLTLQDHPNA--------VKGAIAVMLEQPAETPADVQRRL-  287

Query  299  DEFEQDFHHLIAL---SQPPQQVMLMALKMDIRHFVQNVMTIKLLWARIQQGDKRIPDHI  355
                +   HL A    S PP  V  +      +   + V T      RI Q +  + D  
Sbjct  288  ----RQLRHLAAAHSRSLPPTLVSWLGAAARYQLLAKGVKTN----VRISQSEAVLLD--  337

Query  356  AALTTQYPSLHRDHGIAVRSSIAAGVATSISFLLWIYSGWHAGYMMAQLTAVSVCILSML  415
            A +  +  S    H  A+ + +   VAT +  L W+++GW +G +   + AV   +   L
Sbjct  338  ADIPVKASSAETHH--AMINGVRTTVATGLGCLFWLWTGWTSGSVCMVMLAVVTSLAMRL  395

Query  416  DNPVPALKLFVRGSIYAAILTIFYAFVIMPEVKEFWQLAFVLAPMAIYLLSMFPHPPLMG  475
             NP+ A K F+ G++ A  L      +++P  ++   L  +      +++ +      +G
Sbjct  396  PNPLMAAKDFLIGTLVALPLGALMFMLVLPSTQQSLLLLCLSLGGVAFVIGIEVQKRRLG  455

Query  476  LALPMLINFIMSLNLQNHYTTNAVILMDTAMAGVVGPIISILAIYFIRAMSPETSATRIL  535
             +L  L + I  L L N    N    +D A+  V+G I+++  I  IR  + E ++  +L
Sbjct  456  -SLGALASTINILVLSNPMKFNLSQFLDNAIGQVIGCILALSVILLIRDNTREQTSRTLL  514


> C6C4L7 p-hydroxybenzoic acid efflux pump subunit AaeB [Dickeya 
paradisiaca (strain Ech703)]
Length=651

 Score =  130 bits (326),  Expect = 3e-34
 Identities = 124/541 (23%), Positives = 229/541 (42%), Gaps = 57/541 (11%)

Query  16   LIFAVKTFIAMLLALYIAFALDLTYPMWAAGTVIIIA---------QPYAGMVSSKAVYR  66
            L FA K  +A++L+L + F  ++  P WAA T  I+A          P++G +  + + R
Sbjct  9    LRFACKLSLAVVLSLVLGFWFEMETPRWAALTAAIVAAGPAFVAGGDPFSGAIRHRGLLR  68

Query  67   LMGTVIGGAFAIFLTPRMIDMPILFTFVLALWIAFCLYVSLLDRTPRSYVFMLAGYTTAM  126
            ++GT IG   A+ +    +  P++   +  LW   C+++S L +T  SYVF LAGYT  +
Sbjct  69   ILGTFIGCFGALVIIMTTVRAPVVMLMLCCLWAGVCVWISSLVKTENSYVFALAGYTALI  128

Query  127  VACSSINSIDTYSVFDMALSRVLEISIAVICSAVVSATIFPAHLGTQLQHRVQKTLDDTR  186
            +  +S +S    ++   A+ R  EI + ++C  +      P  +   +   +   L    
Sbjct  129  IIITSQSS--PRAIPQFAIERCSEIILGIVCVILADLVFSPRSVKQDVDRAIDDLLLGQY  186

Query  187  EVFKSIL----TDPQHSSSYAELLAGITRDTSDIHGLAVHLTYEHGELRGMTKPLQELLH  242
            ++ +  +    TD   S  +     G+ R T  I G+   L  E    +   + ++ LL 
Sbjct  187  QLLQRCVGRAATDDVDSCWH-----GLLRKTQAIGGMRNILLMESSHWQPAWRRMKTLLS  241

Query  243  QITMVVANLMSMSERI-LQLDQSDVQYRQGLGDLYQHVVTF-------LRAQTEIEEQQL  294
            Q  M    +M+++  I L     D   + GL  L +  VT        LR    +     
Sbjct  242  QSWM----MMTLAGEIGLMRRDGDCVVKGGLLMLLEQPVTTPGDLRRQLRQLRHLAASHS  297

Query  295  NRLPDEFEQDFHHLIALSQPPQQVMLMALKMDIRHFVQNVMTIKLLWARIQQGDKRIPDH  354
            +RLP         L+       +  L+A  +                ARI Q +  I + 
Sbjct  298  SRLPAP-------LVGWLAASSRYQLLAAGIRTN-------------ARISQRETEILEA  337

Query  355  IAALTTQYPSLHRDHGIAVRSSIAAGVATSISFLLWIYSGWHAGYMMAQLTAVSVCILSM  414
               +       H     A+ + +  GVAT++  L W+ +GW +G +   +  V   ++  
Sbjct  338  ETPVRASSAETHH----ALINGLRTGVATAVGCLFWLLTGWTSGSVCMVMLGVVTALVMR  393

Query  415  LDNPVPALKLFVRGSIYAAILTIFYAFVIMPEVKEFWQLAFVLAPMAIYLLSMFPHPPLM  474
            L NP+ A K F+ G++ A  L      +++P  ++   L  +   +  +++ +      +
Sbjct  394  LPNPLMAAKDFLIGTLIALPLGAVMFMLVLPATQQSLLLLGLCIGVMTFVIGIEIQKRRL  453

Query  475  GLALPMLINFIMSLNLQNHYTTNAVILMDTAMAGVVGPIISILAIYFIRAMSPETSATRI  534
            G +L  L + I  L L N  T N    +D A+  ++G ++++  I  IR  S   +   +
Sbjct  454  G-SLGALASTINILVLDNPMTFNLSQFLDNAIGQIIGCVLALAVIMLIRDNSRARTGRTL  512

Query  535  L  535
            L
Sbjct  513  L  513


> C6DIM3 p-hydroxybenzoic acid efflux pump subunit AaeB [Pectobacterium 
carotovorum subsp. carotovorum (strain PC1)]
Length=662

 Score =  127 bits (318),  Expect = 3e-33
 Identities = 125/530 (24%), Positives = 220/530 (42%), Gaps = 49/530 (9%)

Query  11   PNRMDLIFAVKTFIAMLLALYIAFALDLTYPMWAAGTVIIIA---------QPYAGMVSS  61
            P    L FA K   A++L+L++ F L L  P W+  T  I+A         +P++G +  
Sbjct  15   PKFARLRFAFKLSFAIVLSLFLGFHLQLETPRWSVLTAAIVAAGPAFAAGGEPFSGAIRH  74

Query  62   KAVYRLMGTVIGGAFAIFLTPRMIDMPILFTFVLALWIAFCLYVSLLDRTPRSYVFMLAG  121
            + + R++GT IG   A+ +    +  P++   +  +W   C +VS L +   +YVF LAG
Sbjct  75   RGMLRVVGTFIGCIGALIIIIATVRAPVVMLMLCCIWAGLCTWVSSLVKVENAYVFGLAG  134

Query  122  YTTAMVACSSINSIDTYSVFDMALSRVLEISIAVICSAVVSATIFPAHLGTQLQHRVQKT  181
            YTT ++  S+  +      F  A+ R  EI + ++C+ +      P  +   +   + + 
Sbjct  135  YTTLIIIVSTQGTPLLTPQF--AVERCSEIVLGIVCAILADLLFSPRSIKQDVDRSMGEL  192

Query  182  LDDTREVFKSILTDPQHSSSYAELLAGITRDTSDIHGLAVHLTYEHGELRGMTKPLQELL  241
            L D   + +  ++  +  +  A   A + R T+ + G+   L  E    +   + L  L 
Sbjct  193  LVDQYRLLQLSMSGAEKETIDAAWHA-LVRKTTALSGMRSSLMLESSRWQNSNRRLTSLH  251

Query  242  HQ-ITMVVANLMSMSERILQLDQSDVQYRQGLG-DLYQHVVTFLRAQTEIEEQQLNRLPD  299
             Q +TM+        E  L L  +    +  L   L Q V +F      ++         
Sbjct  252  TQSLTMIT----QACETYLVLQDAPTPVKSSLKLVLDQPVESFRDVHCRVKA--------  299

Query  300  EFEQDFHHLIALSQ---PPQQVMLMALKMDIRHFVQNVMT---IKLLWARIQQGDKRIPD  353
                   HLIA      PP  V  +          + V T   I  + A +   +  I  
Sbjct  300  -----LRHLIAADSRDVPPTLVSWVGAATRYLLLAKGVQTNGRITTIEADVLNSEVEI--  352

Query  354  HIAALTTQYPSLHRDHGIAVRSSIAAGVATSISFLLWIYSGWHAGYMMAQLTAVSVCILS  413
                   + PS    H  A+ + +  GVAT++  L W+ +GW +G +   + AV   +  
Sbjct  353  -------KAPSAETHH--AMINGLRTGVATALGCLFWLSTGWTSGSVCMVMIAVVTSLAM  403

Query  414  MLDNPVPALKLFVRGSIYAAILTIFYAFVIMPEVKEFWQLAFVLAPMAIYLLSMFPHPPL  473
             L NP    K F+ G+IYA  L       IMP  ++   L  +      + L +      
Sbjct  404  RLPNPQMMAKDFLFGTIYALPLGALMFMFIMPSTQQSMLLLCLSLGAMAFFLGLEVQKRR  463

Query  474  MGLALPMLINFIMSLNLQNHYTTNAVILMDTAMAGVVGPIISILAIYFIR  523
            +G +L  L + I  L L N  T +    +D+A+  ++G  ++++ I  IR
Sbjct  464  LG-SLGALASTINILVLDNPMTFHISQFLDSAIGQIIGCFLALMVILLIR  512


> A1JRH8 p-hydroxybenzoic acid efflux pump subunit AaeB [Yersinia 
enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 
/ 8081)]
Length=651

 Score =  125 bits (315),  Expect = 6e-33
 Identities = 139/674 (21%), Positives = 275/674 (41%), Gaps = 64/674 (9%)

Query  11   PNRMDLIFAVKTFIAMLLALYIAFALDLTYPMWAAGTVIIIA---------QPYAGMVSS  61
            P  + L FA K   A++ AL++ F L L  P W+  T  I+A         +P++G +  
Sbjct  4    PTFIRLRFAFKLSFAIVAALFLGFHLQLETPRWSVLTAAIVAAGPAFAAGGEPFSGAIRH  63

Query  62   KAVYRLMGTVIGGAFAIFLTPRMIDMPILFTFVLALWIAFCLYVSLLDRTPRSYVFMLAG  121
            +   R++GT IG    + +    I  P+L   +  LW   C ++S L R   SY F LAG
Sbjct  64   RGWLRIIGTFIGCIGGLIIIVLTIRAPVLTLMLCCLWAGVCTWISSLVRVENSYAFGLAG  123

Query  122  YTTAMVACSSINSIDTYSVFDMALSRVLEISIAVICSAVVSATIFPAHLGTQLQHRVQKT  181
            YT  ++  ++  +      F  A+ R  EI + ++C+ +      P  +   +   V K 
Sbjct  124  YTALIIIVTTGETPLLTPQF--AVERCSEIVLGIVCAVMADLLFSPRSIKQDIDRLVDKV  181

Query  182  LDDTREVFKSILTDPQHSSSYAELLAGITRDTSDIHGLAVHLTYEHGELRGMTKPLQELL  241
            L D   + + +   P   +        + ++T+ ++G+  +L  E    +   + LQ +L
Sbjct  182  LLDQYRLLQ-LCIRPAEKTDIDRAWNDLVKNTTALNGMRSYLMMESSRWQRCNRRLQ-VL  239

Query  242  HQITMVVANLMSMSERILQLDQSDVQYRQGLGDLYQHVVTFLRAQTEIEEQQLNRLPDEF  301
            H  ++ +    +    ++  +  D+                L A+ +    +    P E 
Sbjct  240  HTESLTLIT-QACETYLVLANHPDI----------------LTAELKAMLSEPAPTPAEI  282

Query  302  EQDFHHLIALSQPPQQVMLMALKMDIRHFVQN---VMTIKLLWAR---IQQGDKRIPDHI  355
             Q    L       +Q + ++    I H + +     T  LL A+         R+ + I
Sbjct  283  HQRMKTL-------RQFIAVSHSEAIPHTISSWVGAATRYLLLAKGIHTNSSISRVEEGI  335

Query  356  AALTTQYPSLHRDHGIAVRSSIAAGVATSISFLLWIYSGWHAGYMMAQLTAVSVCILSML  415
             A       +  +   A+ + +  GVAT+I  L W+++GW +G     + AV   +    
Sbjct  336  LAGVVPVKHVSAEGHHAMINGLRTGVATAIGGLFWLWTGWTSGAGCMVMIAVVTSLAMRT  395

Query  416  DNPVPALKLFVRGSIYAAILTIFYAFVIMPEVKEFWQLAFVLAPMAIYLLSMFPHPPLMG  475
             NP      F+ G I A  +   Y   I+P  ++   L  +   +  +++ +      +G
Sbjct  396  PNPRMVAIDFLLGVIMALPIGALYFMFIIPATQQSMLLLCISLGLLAFIIGIEVQKRRLG  455

Query  476  LALPMLINFIMSLNLQNHYTTNAVILMDTAMAGVVGPIISILAIYFIRAMSPETSATRIL  535
             +L  L + I  + L N    N  + +D+A+  +VG  +S++ +  IR  + + +   +L
Sbjct  456  -SLGTLASTINIMVLSNPMEFNVSLFLDSALGQIVGCFVSLIVLLLIRDNAKDRTGRTLL  514

Query  536  ASHYRAMRAALYIPYGVGFRIHLRGMLDRIG-ILNTKMVQVDELKFAM-----NQALIET  589
                 +  +AL          HL  +  ++  +L      +D+ + A+     +Q L +T
Sbjct  515  NRFVYSAVSALTTNKARRNENHLPALYQQLNQLLMMFPGDIDKYRLALTLIIAHQRLNKT  574

Query  590  SAVVN---------LSRIAELMYQSATSQPLQHALFRLQQLLDRAFRELEKQLTLDLSLK  640
               VN         +   A+ +  +  SQ  ++   RL Q LD+      +Q  +D    
Sbjct  575  EVPVNAELSAFHKQIRYTADRVINAKNSQKRRYYFARLLQELDQ-----YQQKLVDYQSP  629

Query  641  DKILQQIQHIQELL  654
            D + + ++ + ++L
Sbjct  630  DAVTRPVKRLADML  643


> Q6DAH4 p-hydroxybenzoic acid efflux pump subunit AaeB [Pectobacterium 
atrosepticum (strain SCRI 1043 / ATCC BAA-672)]
Length=662

 Score =  125 bits (313),  Expect = 1e-32
 Identities = 122/523 (23%), Positives = 217/523 (41%), Gaps = 35/523 (7%)

Query  11   PNRMDLIFAVKTFIAMLLALYIAFALDLTYPMWAAGTVIIIA---------QPYAGMVSS  61
            P    L FA K   A++L+L++ F L L  P W+  T  I+A         +P++G +  
Sbjct  15   PKFARLRFAFKLSFAIVLSLFLGFHLQLETPRWSVLTAAIVAAGPAFAAGGEPFSGAIRH  74

Query  62   KAVYRLMGTVIGGAFAIFLTPRMIDMPILFTFVLALWIAFCLYVSLLDRTPRSYVFMLAG  121
            + + R++GT IG   A+ +    +  P++   +  +W   C +VS L +   +Y+F LAG
Sbjct  75   RGMLRIIGTFIGCIGALVIIIATVRAPVVMLMLCCIWAGLCTWVSSLVKVENAYIFGLAG  134

Query  122  YTTAMVACSSINSIDTYSVFDMALSRVLEISIAVICSAVVSATIFPAHLGTQLQHRVQKT  181
            YT  ++  S+  +      F  A+ R  EI + ++C+ +      P  +   +   + + 
Sbjct  135  YTALIIIVSTQGTPLLTPQF--AVERCSEIVLGIVCAILADLLFSPRSIKQDVDRSIGEL  192

Query  182  LDDTREVFKSILTDPQHSSSYAELLAGITRDTSDIHGLAVHLTYEHGELRGMTKPLQELL  241
            L D   + +  ++  +  +  A   A + R T+ + G+   L  E    +   + L  L 
Sbjct  193  LVDQYRLLQLSMSGTEKEAIDAAWHA-LVRKTTALSGMRSSLMLESSRWQNSNRRLTSLH  251

Query  242  HQITMVVANLMSMSERILQLDQSDVQYRQGLGDLYQHVVTFLRAQTEIEEQQLNRLPDEF  301
             Q  M++       E  L L       +  L  +    V  LR       + L  L    
Sbjct  252  TQSLMMIT---QACETYLILQDVPTPVKSSLKMVLDQPVESLR-DVHCRVKALRHLIAAD  307

Query  302  EQDF-HHLIALSQPPQQVMLMALKMDIRHFVQNVMTIKLLWARIQQGDKRIPDHIAALTT  360
             +D    LI       + +L+A        VQ    +  + A +   D  I         
Sbjct  308  SRDVPPTLIDWVGAATRYLLLA------KGVQANGRLNTIEADVLNSDVEI---------  352

Query  361  QYPSLHRDHGIAVRSSIAAGVATSISFLLWIYSGWHAGYMMAQLTAVSVCILSMLDNPVP  420
            + PS    H  A+ + +  GVAT++  L W+ +GW +G +   + AV   +   L NP  
Sbjct  353  KAPSAETHH--AMINGLRTGVATALGCLFWLSTGWTSGSVCMVMIAVVTSLAMRLPNPQM  410

Query  421  ALKLFVRGSIYAAILTIFYAFVIMPEVKEFWQLAFVLAPMAIYLLSMFPHPPLMGLALPM  480
              K F+ G+IYA  L       IMP  ++   L  +      + L +      +G +L  
Sbjct  411  MAKDFLFGTIYALPLGALMFMFIMPSTQQSMLLLCLSLGGMAFFLGLEVQKRRLG-SLGA  469

Query  481  LINFIMSLNLQNHYTTNAVILMDTAMAGVVGPIISILAIYFIR  523
            L + I  L L N  T N    +D+A+  ++G  ++++ I  IR
Sbjct  470  LASTINILVLDNPMTFNVSQFLDSAIGQIIGCFLALMVIMLIR  512


> D0KEK2 p-hydroxybenzoic acid efflux pump subunit AaeB [Pectobacterium 
parmentieri (strain WPP163)]
Length=662

 Score =  120 bits (302),  Expect = 2e-31
 Identities = 125/527 (24%), Positives = 222/527 (42%), Gaps = 57/527 (11%)

Query  18   FAVKTFIAMLLALYIAFALDLTYPMWAAGTVIIIA---------QPYAGMVSSKAVYRLM  68
            FA K   A++L+L++ F L L  P  A  T  I+A         +P++G +  + + R++
Sbjct  22   FAFKLTFAVVLSLFLGFHLQLGTPNTAVMTAAIVAGGPAFVAGGEPFSGAIRHRGMLRIV  81

Query  69   GTVIG--GAFAIFLTPRMIDMPILFTFVLALWIAFCLYVSLLDRTPRSYVFMLAGYTTAM  126
            GT IG  GA AI ++   I  PI+   +  +W   C ++S L +   SY+F LAGYTT +
Sbjct  82   GTFIGCIGALAIIIST--IRAPIVMMLLCCIWAGLCNWISSLVKIENSYIFGLAGYTTLI  139

Query  127  VACSSINSIDTYSVFDMALSRVLEISIAVICSAVVSATIFPAHLGTQLQHRVQKTLDDTR  186
            +  ++  +      F  A+ R  EI + + C         P  +   +   +++ +    
Sbjct  140  IILATQGTPMLTPQF--AVERCSEIVLGIACVIFADLLFAPRSIKQDVDRSLRELMVGQY  197

Query  187  EVFKSILTDPQHSSSYAELLAGITRDTSDIHGLAVHLTYEHGELRGMTKPLQELLHQ-IT  245
             + +  ++     +      A + R T+ + G+  +L  E    +   + L  L  Q +T
Sbjct  198  RLLQLSMSGADEGTIDTTWHA-LVRKTTALDGMRSNLMMESSRWQNSNRRLTSLHTQSLT  256

Query  246  MVVANLMSMSERILQLDQSDVQYRQGLGDLYQHVVTFLRAQTEIEEQQLNRLPDEFEQDF  305
            M+        E  L L            D+  HV + L+       Q L+   + F    
Sbjct  257  MIT----QACETYLTLQ-----------DVPTHVKSSLK-------QVLDPPVESFGDVH  294

Query  306  HHLIALSQ---------PPQQVMLMALKMDIRHFVQNVMTIKLLWARIQQGDKRIPDHIA  356
            HH+ AL           PP  V  +         V+ V T      RI + +  + +H  
Sbjct  295  HHVKALRHLIAADSRDVPPTLVSWVGAATRYLLLVKGVQTN----GRISKIEADVLNHDV  350

Query  357  ALTTQYPSLHRDHGIAVRSSIAAGVATSISFLLWIYSGWHAGYMMAQLTAVSVCILSMLD  416
             +  + PS    H  A+ + +  GVAT++  L W+ +GW +G +   + AV   +   L 
Sbjct  351  EI--KVPSAETHH--AMINGLRTGVATALGCLFWLSTGWSSGGICMMMIAVVTSLAMRLP  406

Query  417  NPVPALKLFVRGSIYAAILTIFYAFVIMPEVKEFWQLAFVLAPMAIYLLSMFPHPPLMGL  476
            NP      F+ G+IY+  L       I+P  ++   L  +      + L +      +G 
Sbjct  407  NPKMVGMDFLYGTIYSLPLGALMFMFILPSTQQSILLLCLSLGAMTFFLGVEVQKRRLG-  465

Query  477  ALPMLINFIMSLNLQNHYTTNAVILMDTAMAGVVGPIISILAIYFIR  523
            +L  LI+ I  L L N  T N  + +D A+  ++G  ++++ I  IR
Sbjct  466  SLGALISTINVLLLNNPMTFNISLFLDNAIGQIIGCFVALMVILLIR  512


> D4GCB2 p-hydroxybenzoic acid efflux pump subunit AaeB [Pantoea 
ananatis (strain LMG 20103)]
Length=650

 Score =  115 bits (289),  Expect = 9e-30
 Identities = 120/583 (21%), Positives = 228/583 (39%), Gaps = 44/583 (8%)

Query  16   LIFAVKTFIAMLLALYIAFALDLTYPMWAAGTVIIIA---------QPYAGMVSSKAVYR  66
            L F +K   A++ AL I F L+L  P WA  T  I+A          PY+G +  + + R
Sbjct  5    LRFPIKLTFALVAALMIGFHLNLETPRWAVMTAGIVAGGTAFAAGGDPYSGALRYRGILR  64

Query  67   LMGTVIGGAFAIFLTPRMIDMPILFTFVLALWIAFCLYVSLLDRTPRSYVFMLAGYTTAM  126
            ++GT IG   A+ +    +  P++   +  +W  FC+++S L +   SY   LAGYT  +
Sbjct  65   IIGTFIGCVAALVIMIATVRAPVVMLLLCCIWAGFCVWLSSLIKVENSYALGLAGYTALI  124

Query  127  VACSSINSIDTYSVFDMALSRVLEISIAVICSAVVSATIFPAHLGTQLQHRVQKTLDDTR  186
            +  ++  S     V   A+ R  EI + ++C+ +      P  +   +   V   L    
Sbjct  125  IVVTANASGGLTLVPQYAVERCSEIILGILCAILADMIFSPRSIKKVIDAEVDSLLVAHY  184

Query  187  EVFKSILTDPQHSSSYAELLAGITRDTSDIHGLAVHLTYEHGELRGMTKPLQEL----LH  242
             + + +    +      +    + R T+ +  +   L  E    +  ++ LQ L    L 
Sbjct  185  RLLQ-LCVAHEDKEEVDKAWGALVRRTTALSSMRSQLMMESSRWQNTSRRLQMLNTLSLT  243

Query  243  QITMVVANLMSMSERILQLDQSDVQYRQGLGDLYQHVVTFLRAQTEIEEQQLNRLPDEFE  302
             IT      +  + R    D    QYR             +  +    E    R+     
Sbjct  244  MITQAAETFLIQNSR---PDYIATQYR-----------VLMEKEAATAEDVHKRM-----  284

Query  303  QDFHHLIALSQPPQQVMLMALKMDIRHFVQNVMTIKLLWARIQQGDK--RIPDHIAALTT  360
            +    LIA+S          +   +  +V+     +LL   I+   +   + + I     
Sbjct  285  KALRRLIAVSS-------KTVPETLESWVEAATEYQLLTHGIKSNGRITALEEGILQREV  337

Query  361  QYPSLHRDHGIAVRSSIAAGVATSISFLLWIYSGWHAGYMMAQLTAVSVCILSMLDNPVP  420
               +   ++  A+ + +   VAT++  L W+Y+GW +G     +  V   +   + NP+ 
Sbjct  338  VIQARSAENHHAMINGVRTFVATALGSLFWLYTGWTSGSGCMVMLGVITALAMRMPNPLM  397

Query  421  ALKLFVRGSIYAAILTIFYAFVIMPEVKEFWQLAFVLAPMAIYLLSMFPHPPLMGLALPM  480
              K FV G   A  L   Y   I+P  ++   L  +   +  ++  +      +G  L  
Sbjct  398  MAKDFVYGMTVAVPLGALYFMYILPNTQQSAVLLCIAIGLLGFISGILIQRRQIG-TLGA  456

Query  481  LINFIMSLNLQNHYTTNAVILMDTAMAGVVGPIISILAIYFIRAMSPETSATRILASHYR  540
            ++  I  L L N    N    +D A+   +G  ++++ I  IR  S   +  ++L     
Sbjct  457  MVGTINVLVLDNPMQFNFTQFIDNALGQWIGSFVALMVILLIRDKSKARTGRKLLNRFMY  516

Query  541  AMRAALYIPYGVGFRIHLRGMLDRIG-ILNTKMVQVDELKFAM  582
            A  +A+          HL  +  ++  +LN     +D+ + A+
Sbjct  517  AAVSAMTTNQARRRENHLPALYQQLFLLLNLFPGDIDKYRIAL  559


 Score = 25.4 bits (54),  Expect = 0.16
 Identities = 58/298 (19%), Positives = 114/298 (38%), Gaps = 30/298 (10%)

Query  12   NRMDLIFAVKTFIAMLLALYIAFALDLTYPMWAAG----------TVIIIAQPYAGMVSS  61
            N   +I  V+TF+A  L      +L   Y  W +G          T + +  P   M++ 
Sbjct  346  NHHAMINGVRTFVATALG-----SLFWLYTGWTSGSGCMVMLGVITALAMRMPNPLMMAK  400

Query  62   KAVYRLMGTV-IGGAFAIFLTPRMIDMPILFTFVLALWIAFCLYVSLLDRTPRSYVFMLA  120
              VY +   V +G  + +++ P      +L    + L + F   + L+ R     +  + 
Sbjct  401  DFVYGMTVAVPLGALYFMYILPNTQQSAVLLCIAIGL-LGFISGI-LIQRRQIGTLGAMV  458

Query  121  GYTTAMVACSSINSIDTYSVFDMALSRVLEISIAVICSAVVSATIFPAHLGTQLQHRVQK  180
            G    +V  + +    T  + D AL + +   +A++   ++      A  G +L +R   
Sbjct  459  GTINVLVLDNPMQFNFTQFI-DNALGQWIGSFVALMVILLIRDKS-KARTGRKLLNRFMY  516

Query  181  TLDDTREVFKSILTDPQHSSSYAELLAGITRDTSDI--HGLAVHLTYEHGELRGMTKPLQ  238
                     ++   +    + Y +L   +     DI  + +A+ L   H  LR    P+ 
Sbjct  517  AAVSAMTTNQARRRENHLPALYQQLFLLLNLFPGDIDKYRIALTLIIGHQRLRAADVPVN  576

Query  239  ELLHQITMVVANLMSMSERILQL--DQSDVQYRQGLG---DLYQHVVTFLRAQTEIEE  291
                 ++     L   ++RI+ +  D+    Y + L    D+YQH +    A T + E
Sbjct  577  A---DLSAYHRQLRHTADRIISVRSDEKRRYYFERLLKELDVYQHKLAHYDAPTSVTE  631


> D8MXN7 p-hydroxybenzoic acid efflux pump subunit AaeB [Erwinia 
billingiae (strain Eb661)]
Length=652

 Score =  115 bits (289),  Expect = 9e-30
 Identities = 125/590 (21%), Positives = 228/590 (39%), Gaps = 57/590 (10%)

Query  16   LIFAVKTFIAMLLALYIAFALDLTYPMWAAGTVIIIA---------QPYAGMVSSKAVYR  66
            L F +K   A++L+L I F  +L  P WA  T  I+A          P++G +  + + R
Sbjct  6    LRFPIKLTFAIVLSLLIGFHFNLETPRWAVMTACIVAGGTAFAAGGDPFSGALRHRGMLR  65

Query  67   LMGTVIGGAFAIFLTPRMIDMPILFTFVLALWIAFCLYVSLLDRTPRSYVFMLAGYTTAM  126
            ++GT +G   A+ +    I  P L   +  +W   C+++S L +   SY   LAGYT  +
Sbjct  66   IIGTFLGCIAALTIMIATIRAPALMMLLCCMWAGLCVWLSSLIKIENSYALGLAGYTALI  125

Query  127  VACSSINSIDTYSVFDMALSRVLEISIAVICSAVVSATIFPAHLGTQLQHRVQKTLDDTR  186
            +  S   +         A+ R  EI I ++C+ +      P  +   +   +   L D  
Sbjct  126  IVVSVDANGSVLLAPQFAVERCSEIIIGIVCAILADMLFSPRSVKQDIDREIDALLVDQY  185

Query  187  EVFKSILTDPQHSSSYAELLAGITRDTSDIHGLAVHLTYEHGELRGMTKPLQELLHQITM  246
            ++ +               L     D  ++  L  +L      L GM             
Sbjct  186  KLMQ---------------LCVAHGDKEEVDRLWTNLVRRTTALNGMR------------  218

Query  247  VVANLMSMSERILQLDQSDVQYRQGLGDLYQHVVTFLRAQTEIEEQQLNRLPDEFEQDFH  306
               NLM  S R  ++D+      + L  L   ++T       I++ +   +P +F   F 
Sbjct  219  --GNLMMESSRWQKIDER----MRALNTLSLALITQAAETYLIQDSRKEYVPPQFHIFFD  272

Query  307  HLIA-LSQPPQQVMLMA----------LKMDIRHFVQNVMTIKLLWARIQQGD--KRIPD  353
              +  +    +++ +M             + ++++V       LL   I       RI  
Sbjct  273  KSVENIGDIHKRMKIMRRVITTSGSKNTPVTLQNWVVAATRYLLLLKGIHTNSSISRIER  332

Query  354  HIAALTTQYPSLHRDHGIAVRSSIAAGVATSISFLLWIYSGWHAGYMMAQLTAVSVCILS  413
             +            +   A+ + I   VAT++  L W+++GW +G     + AV   +  
Sbjct  333  EVLKDEPVVKMRSAESRHAMINGIRTFVATAVGSLFWLWTGWASGSGAMVMLAVITALAM  392

Query  414  MLDNPVPALKLFVRGSIYAAILTIFYAFVIMPEVKEFWQLAFVLAPMAIYLLSMFPHPPL  473
             + NP+   K F+ G I A  L   Y  VIMP  ++   L  +   +  ++  +      
Sbjct  393  RMPNPLMMAKDFLYGMIVAIPLGSLYYMVIMPSTQQSMLLLCISLGVMAFIGGILIQRRQ  452

Query  474  MGLALPMLINFIMSLNLQNHYTTNAVILMDTAMAGVVGPIISILAIYFIRAMSPETSATR  533
            +G  L  L+  I  + L N  T N    +D A+   +G  +++L I  IR  S   +   
Sbjct  453  IG-TLGGLVGTINIITLDNPMTFNVTAFLDNALGQAIGCFLALLVILLIRDTSKARTGRI  511

Query  534  ILASHYRAMRAALYIPYGVGFRIHLRGMLDRI-GILNTKMVQVDELKFAM  582
            +L     A  AA+          HL  +  ++  +LN     +D+ + A+
Sbjct  512  LLNRFMYAAVAAMSTNQARRRENHLPALYHQLFMLLNIFPGDIDKFRIAL  561


> D5CDA0 p-hydroxybenzoic acid efflux pump subunit AaeB [Enterobacter 
cloacae subsp. cloacae (strain ATCC 13047 / DSM 30054 
/ NBRC 13535 / NCDC 279-56)]
Length=655

 Score =  112 bits (281),  Expect = 9e-29
 Identities = 124/548 (23%), Positives = 229/548 (42%), Gaps = 67/548 (12%)

Query  18   FAVKTFIAMLLALYIAFALDLTYPMWAAGTVIIIA---------QPYAGMVSSKAVYRLM  68
            FAVK   A++LAL++ F   L  P WA  T  I+A         +PY+G +  + + R++
Sbjct  13   FAVKLASAIVLALFVGFHFQLETPRWAVLTAAIVAAGPAFAAGGEPYSGAIRYRGMLRII  72

Query  69   GTVIGGAFAIFLTPRMIDMPILFTFVLALWIAFCLYVSLLDRTPRSYVFMLAGYTTAMVA  128
            GT IG   A+ +   MI  P+L   V  +W  FC ++S L +   SY + LAGYT  ++ 
Sbjct  73   GTFIGCIAALTIIILMIRTPLLMVLVCCIWAGFCTWLSSLVKVENSYAWGLAGYTALII-  131

Query  129  CSSINSIDTYSVF--DMALSRVLEISIAVICSAVVSATIFPAHLGTQLQHRVQKTLDDTR  186
               + +I T  +     A+ R  EI I ++C+ V      P  +  ++   +   +    
Sbjct  132  ---VITIQTEPLLAPQFAVERCSEIVIGIVCAIVADLLFSPRSIKQEVDRELDALIVSQY  188

Query  187  EVFKSILTDPQHSSSYAELLAGITRDTSDIHGLAVHLTYEHGELRGMTKPLQELLHQITM  246
            ++ +  +     S    +  +G+ R T  + G+  +L  E        + L+ +      
Sbjct  189  QLMQLCIKHGD-SEEVDKAWSGLVRRTQALEGMRSNLNMESSRWARANRRLKAI------  241

Query  247  VVANLMSMSERILQLDQSDVQYRQGLGDLYQHVVTFLRAQTEIEE-----QQLNRLPDEF  301
               N +S++                   + Q   T+L   T  E      ++L   P E 
Sbjct  242  ---NTVSLTL------------------ITQACETYLIQNTRPESVTDTFRELFAEPVET  280

Query  302  EQDFHHLIALSQPPQQVMLMALKMDIRHFVQ---NVMTIKLLWARIQQGDKRI---PDHI  355
             QD H  +   +  ++V+    + D    +       T  LL  R   G+ +I    + +
Sbjct  281  VQDVHKQL---KRMRRVIAWTGERDTPVTIYTWVGAATRYLLLKRGVIGNTKISAAEEEV  337

Query  356  --AALTTQYPSLHRDHGIA--VRSSIAAGVATSISFLLWIYSGWHAGYMMAQLTAVSVCI  411
                +  +  S  R H +    R+++A  + T    L W+++GW +G     + AV   +
Sbjct  338  LQGEVVIKAESAERHHAMVNFWRTTLACMLGT----LFWLWTGWTSGSGAMVMIAVVTAL  393

Query  412  LSMLDNPVPALKLFVRGSIYAAILTIFYAFVIMPEVKEFWQLAFVLAPMAIYLLSMFPHP  471
               L NP      F+ G+I A  L   Y  VI+P  ++   L  +   +  + + +    
Sbjct  394  AMRLPNPRMVAIDFLYGTIAALPLGALYFLVILPSTQQSMLLLCISLAVMAFFIGIEVQK  453

Query  472  PLMGLALPMLINFIMSLNLQNHYTTNAVILMDTAMAGVVGPIISILAIYFIRAMSPETSA  531
              +G +L  L + I  L L N  T +    +D+A+  +VG  ++++ I  +R  S +   
Sbjct  454  RRLG-SLGALASTINILVLDNPMTFHFSQFLDSALGQLVGCFLAMMVILLVRDNS-QART  511

Query  532  TRILASHY  539
             R+L + +
Sbjct  512  GRVLLNQF  519


 Score = 20.8 bits (42),  Expect = 4.2
 Identities = 21/93 (23%), Positives = 40/93 (43%), Gaps = 3/93 (3%)

Query  244  ITMVVANLMSMSERILQLDQSDVQYRQGLGDLYQHVVTFLRAQTEIEEQQLNRLPDEFEQ  303
            +TM++A+    +  +   D     +RQ L     HV++   +  +   +   +L +E + 
Sbjct  564  LTMIIAHQRLRNAPVPINDDLSAFHRQ-LRRTADHVLS--ASSDDKRRRYFKQLLEELDV  620

Query  304  DFHHLIALSQPPQQVMLMALKMDIRHFVQNVMT  336
                L     PPQ    +A  + + H  QNV+T
Sbjct  621  YQEKLRVWEAPPQVTEPVARLVFMLHRYQNVLT  653


> P46481 p-hydroxybenzoic acid efflux pump subunit AaeB [Escherichia 
coli (strain K12)]
Length=655

 Score =  103 bits (258),  Expect = 6e-26
 Identities = 118/568 (21%), Positives = 221/568 (39%), Gaps = 42/568 (7%)

Query  18   FAVKTFIAMLLALYIAFALDLTYPMWAAGTVIIIA---------QPYAGMVSSKAVYRLM  68
            FAVK   A++LAL++ F   L  P WA  T  I+A         +PY+G +  +   R++
Sbjct  13   FAVKLATAIVLALFVGFHFQLETPRWAVLTAAIVAAGTAFAAGGEPYSGAIRYRGFLRII  72

Query  69   GTVIGGAFAIFLTPRMIDMPILFTFVLALWIAFCLYVSLLDRTPRSYVFMLAGYTTAMVA  128
            GT IG    + +   MI  P+L   V  +W  FC ++S L R   SY + LAGYT  ++ 
Sbjct  73   GTFIGCIAGLVIIIAMIRAPLLMILVCCIWAGFCTWISSLVRIENSYAWGLAGYTALIIV  132

Query  129  CSSINSIDTYSVFDMALSRVLEISIAVICSAVVSATIFPAHLGTQLQHRVQKTLDDTREV  188
             +     +       A+ R  EI I ++C+ +      P  +  ++   ++  L    ++
Sbjct  133  ITI--QPEPLLTPQFAVERCSEIVIGIVCAIMADLLFSPRSIKQEVDRELESLLVAQYQL  190

Query  189  FKSILTDPQHSSSYA--ELLAGITRDTSDIHGLAVHLTYEHGELRGMTKPLQEL-LHQIT  245
             +  +   +H       +    + R T+ + G+  +L  E        + L+ +    +T
Sbjct  191  MQLCI---KHGDGEVVDKAWGDLVRRTTALQGMRSNLNMESSRWARANRRLKAINTLSLT  247

Query  246  MVVANLMSMSERILQLDQSDVQYRQGLGDLYQHVVTFLRAQTEIEEQQLNRLPDEFEQDF  305
            ++     S    ++Q  + ++     + D ++          +   +QL RL        
Sbjct  248  LIT---QSCETYLIQNTRPEL-----ITDTFREFFDTPVETAQDVHKQLKRLRRVIAWTG  299

Query  306  HHLIALSQPPQQVMLMALKMDIRHFVQNVMTIKLLWARIQQGDKRIPDHIAALTTQYPSL  365
                 ++           ++  R  + N   I      I QG+  +         +  S 
Sbjct  300  ERETPVTIYSWVAAATRYQLLKRGVISNT-KINATEEEILQGEPEV---------KVESA  349

Query  366  HRDHGIAVRSSIAAGVATSISFLLWIYSGWHAGYMMAQLTAVSVCILSMLDNPVPALKLF  425
             R H +               F LW  +GW +G     + AV   +   L NP      F
Sbjct  350  ERHHAMVNFWRTTLSCILGTLFWLW--TGWTSGSGAMVMIAVVTSLAMRLPNPRMVAIDF  407

Query  426  VRGSIYAAILTIFYAFVIMPEVKEFWQLAFVLAPMAIYLLSMFPHPPLMGL--ALPMLIN  483
            + G++ A  L + Y  VI+P  ++   L  +   +  + L +      +G   AL   IN
Sbjct  408  IYGTLAALPLGLLYFLVIIPNTQQSMLLLCISLAVLGFFLGIEVQKRRLGSMGALASTIN  467

Query  484  FIMSLNLQNHYTTNAVILMDTAMAGVVGPIISILAIYFIRAMSPETSATRILASHYRAMR  543
             I+   L N  T +    +D+A+  +VG +++   I  +R  S + +   +L     A  
Sbjct  468  IIV---LDNPMTFHFSQFLDSALGQIVGCVLAFTVILLVRDKSRDRTGRVLLNQFVSAAV  524

Query  544  AALYIPYGVGFRIHLRGMLDRIGILNTK  571
            +A+          HL  +  ++ +L  K
Sbjct  525  SAMTTNVARRKENHLPALYQQLFLLMNK  552


> O05543 Uncharacterized transporter GOX0755 [Gluconobacter oxydans 
(strain 621H)]
Length=739

 Score =  102 bits (253),  Expect = 3e-25
 Identities = 124/539 (23%), Positives = 224/539 (42%), Gaps = 64/539 (12%)

Query  9    FRPNRMDLIFAVKTFIAMLLALYIAFALDLTYPMWAAGTVIIIAQPYAGMVSSKAVYRLM  68
            + P+ +   +A++T    LLAL IA  ++L  P WAA TV ++AQ   G   +KA + L 
Sbjct  34   YAPDPVMAGYALRTTCTSLLALGIALWMELGSPQWAALTVWMVAQGTRGRSLAKAKWHLF  93

Query  69   GTVIGGAFAIFLTPRMIDMPILFTFVLALWIA-FCLYVSLLDRTP-----RSYVFMLAGY  122
            G V+G    I L   +   P++F  +LA+ I  FC+  + +         R +    +G+
Sbjct  94   GMVVGVISGITLVAAIPQAPLMFILLLAVGIGTFCMIGTFMPGPASMTNYRIHGMRASGF  153

Query  123  TTAMVACSSINSIDTYSVFDMALSRVLEISIAVICSAVVSATIFPAHLGTQLQHRVQKTL  182
            T A+V+   I   D + +F +++SR   I + ++  A +S  +F   L  + +H++  T 
Sbjct  154  TYAIVSLDGI--ADPHHIFAISMSRATYILLGIVLEASISG-LFQLGLTKRTRHQLASTF  210

Query  183  DDTREVFKSILTDPQHSSSYAELLAGITRDTSDIHGLAVHLT----------YEHGELRG  232
            +DT    K  LT      + A +L G      ++  +   +T           E G    
Sbjct  211  EDT---LKPALT------AIAGILVGKEGAMQNVQAIFAQITTLGDQVEFAEVELGRHDH  261

Query  233  MTKPLQELLHQITMVVANLMSMSERI-LQLDQSDV--QYRQGLGDLYQHVVTFLRAQTEI  289
                 +  L  I +++A  + ++  + L L Q D+  Q  + + D+      FL+    +
Sbjct  262  AGDHARAALADIAVLLARALDLATLMRLPLSQDDMFRQEAEAIRDM------FLKLPARL  315

Query  290  EEQQ--------LNRLPDEFEQDFHHLIALSQPPQQVMLMALKMDIRHFVQNVMTIKLLW  341
            EE +        L  L  +  Q      + +QP        L+  +       +   L  
Sbjct  316  EETESMASILADLLTLRRQCRQKVVSDFSTAQPDDAAREAVLRHGMLQQALVELIDALRM  375

Query  342  ARIQQGDKRIP---DHIAALTTQYPSLHRDHGIAVRSSIAAGVATSISFLLWIYSGWHAG  398
            A  Q    R P   DH  +    Y    RD   A+ +S+ + V    + L+WI + W +G
Sbjct  376  ALTQFEASRHPGSHDHFHSPIRSY----RDWQQAITNSLRSSVTVFGAGLIWICTAWPSG  431

Query  399  YMMAQLTAVSVCILSMLDNPVPALKLFVRGSIYAAILTIFYAFVIMPEVKEF-----WQ-  452
                    +   + S L+ P  A + F+RG+  A +        +M +   F     W  
Sbjct  432  LTFIMFVCIVCSLFSTLERPALATQAFLRGACCAVVAAGILNLALMGKSTTFEMLGMWSG  491

Query  453  LAFVLAPMAIYLLSMFPHPPLMGLALPMLINFIMSLNLQNHYTTNAVILMDTAMAGVVG  511
            LA ++  +A      F +PPL   A+   +   + +   N   T+ ++  +TA+  V+G
Sbjct  492  LAMMIGGLA------FAYPPLTLPAVSYNLFLPILIGPSNQAKTDEIVYFNTALPLVLG  544


> Q9KWL2 UPF0421 protein SAHV_1874 [Staphylococcus aureus (strain 
Mu3 / ATCC 700698)]
Length=328

 Score = 57.8 bits (138),  Expect = 8e-12
 Identities = 45/163 (28%), Positives = 71/163 (44%), Gaps = 13/163 (8%)

Query  20   VKTFIAMLLALYIAFALDLTYPMWAAGTVIIIAQPYAGMVSSKAVYRLMGTVIGGAFAIF  79
            +KT IA+ L      ALDLT P++A  T ++  +P A     K   RL  TVIG  FA+ 
Sbjct  15   IKTGIAIFLTAVFCMALDLT-PIYAILTAVVTIEPTAKASLIKGYRRLPATVIGAGFAVL  73

Query  80   LTPRMIDM-PILFTFVLALWIAFCLYVSLLDRTPRSYVFMLAGYTTAMVACSSINSIDTY  138
             T    D  P  +       I FC  + L           +      + + + I  I   
Sbjct  74   FTYLFGDQSPFTYALSATFTILFCTKLKL----------QVGTNVAVLTSLAMIPGIHDA  123

Query  139  SVFDMALSRVLEISIAVICSAVVSATIFPAHLGTQLQHRVQKT  181
             +F+  LSR L   I ++ S +++  +FP     Q++ ++ KT
Sbjct  124  YIFNF-LSRTLTAIIGLVTSGLINFMVFPPKYYGQVEEKLSKT  165


> Q2FX03 UPF0421 protein SAOUHSC_02103 [Staphylococcus aureus (strain 
NCTC 8325)]
Length=328

 Score = 57.8 bits (138),  Expect = 8e-12
 Identities = 45/163 (28%), Positives = 71/163 (44%), Gaps = 13/163 (8%)

Query  20   VKTFIAMLLALYIAFALDLTYPMWAAGTVIIIAQPYAGMVSSKAVYRLMGTVIGGAFAIF  79
            +KT IA+ L      ALDLT P++A  T ++  +P A     K   RL  TVIG  FA+ 
Sbjct  15   IKTGIAIFLTAVFCMALDLT-PIYAILTAVVTIEPTAKASLIKGYRRLPATVIGAGFAVL  73

Query  80   LTPRMIDM-PILFTFVLALWIAFCLYVSLLDRTPRSYVFMLAGYTTAMVACSSINSIDTY  138
             T    D  P  +       I FC  + L           +      + + + I  I   
Sbjct  74   FTYLFGDQSPFTYALSATFTILFCTKLKL----------QVGTNVAVLTSLAMIPGIHDA  123

Query  139  SVFDMALSRVLEISIAVICSAVVSATIFPAHLGTQLQHRVQKT  181
             +F+  LSR L   I ++ S +++  +FP     Q++ ++ KT
Sbjct  124  YIFNF-LSRTLTAIIGLVTSGLINFMVFPPKYYGQVEEKLSKT  165


> Q93Z29 Aluminum-activated malate transporter 5 [Arabidopsis thaliana]
Length=537

 Score = 53.1 bits (126),  Expect = 4e-10
 Identities = 50/182 (27%), Positives = 78/182 (43%), Gaps = 19/182 (10%)

Query  12   NRMDLIFAVKTFIAMLLALYIAFALD-----LTYPMWAAGTVIIIAQPYAGMVSSKAVYR  66
            +R  L F++K  IA+ L  ++ F  +       + +WA  TV++I + Y G    K   R
Sbjct  53   DRRKLYFSIKMGIALALCSFVIFLKEPLQDASKFAVWAILTVVLIFEYYVGATLVKGFNR  112

Query  67   LMGTVIGGAFAI------FLTPRMIDMPILFTFVLALWIA--FCLYVSLLDRTPRSYVFM  118
             +GT++ G  A+       L     ++ I+    LA + A    LY S+    P  Y F 
Sbjct  113  ALGTMLAGGLALGVAQLSVLAGEFEEVIIVICIFLAGFGASYLKLYASM---KPYEYAFR  169

Query  119  LAGYTTAMVACSSINSIDTYSVFDMALSRVLEISIAVICSAVVSATIFPAHLGTQLQHRV  178
            +   T  +V  S  NS D  S    A  R+L I +      +V+  +FP   G  L   V
Sbjct  170  VFKLTYCIVLVSGNNSRDFLST---AYYRILLIGLGATICLLVNVFLFPIWAGEDLHKLV  226

Query  179  QK  180
             K
Sbjct  227  AK  228


> P71083 UPF0421 protein YgaE [Bacillus subtilis (strain 168)]
Length=353

 Score = 45.1 bits (105),  Expect = 1e-07
 Identities = 48/195 (25%), Positives = 84/195 (43%), Gaps = 22/195 (11%)

Query  21   KTFIAMLLALYIAFALDLTYPMWAAGTVIIIAQP--YAG--MVSSKAVYRLMGTVIGGAF  76
            KT IA+ LALY+A  + L  P++A    I   QP  Y    ++  +    ++G VI   F
Sbjct  9    KTGIAITLALYLASWIGLPAPIFAGIAAIFAIQPSIYRSFLIIIDQVQANIIGAVIATVF  68

Query  77   AIFLTPRMIDMPILFTFVLALWIAFCLYVSLLDRTPRSYVFMLAGYTTAMVACSSINSID  136
             +   P     PI+      + I   L + +      + V ++A   +A          D
Sbjct  69   GLIFGP----SPIMIGLTAVIVITIMLKLKIEHTISIALVTVIAILESAG---------D  115

Query  137  TYSVFDMALSRVLEISIAVICSAVVSATIFPAHLGTQLQHRVQKTLDDTREVFKSILTDP  196
             + +F  AL R   + + V+ S +V+    P    T+L H    T+++T E+ K I    
Sbjct  116  DFLMF--ALIRTSTVILGVLSSFIVNLVFLPPKYETKLIH---NTVENTEEIMKWIRLSM  170

Query  197  QHSSSYAELLAGITR  211
            + S+ ++ L   I +
Sbjct  171  RQSTEHSILKEDIEK  185


 Score = 23.5 bits (49),  Expect = 0.56
 Identities = 13/56 (23%), Positives = 26/56 (46%), Gaps = 6/56 (11%)

Query  460  MAIYLLSMFPHPPLMGLALPMLINFIMSLNLQNHYTTNAVILMDTAMAGVVGPIIS  515
            +A+YL S       +GL  P+         +Q     + +I++D   A ++G +I+
Sbjct  16   LALYLASW------IGLPAPIFAGIAAIFAIQPSIYRSFLIIIDQVQANIIGAVIA  65


 Score = 23.1 bits (48),  Expect = 0.74
 Identities = 14/64 (22%), Positives = 36/64 (56%), Gaps = 2/64 (3%)

Query  429  SIYAAILTIFYAFVIMPEVKEFWQLAFVLAPMAIYLLSMFPHPPLMGLALPMLINFIMSL  488
            +I+A   +I+ +F+I+ +  +   +  V+A   ++ L   P P ++GL   ++I  ++ L
Sbjct  36   AIFAIQPSIYRSFLIIIDQVQANIIGAVIA--TVFGLIFGPSPIMIGLTAVIVITIMLKL  93

Query  489  NLQN  492
             +++
Sbjct  94   KIEH  97


> Q9SHM1 Aluminum-activated malate transporter 6 [Arabidopsis thaliana]
Length=538

 Score = 43.9 bits (102),  Expect = 3e-07
 Identities = 50/179 (28%), Positives = 74/179 (41%), Gaps = 17/179 (9%)

Query  12   NRMDLIFAVKTFIAMLLALYIAFALD-----LTYPMWAAGTVIIIAQPYAGMVSSKAVYR  66
            +R  + FAVK  +A+ L   + F  +       Y +W   TV+++ +   G    K   R
Sbjct  36   DRRRIFFAVKMGMALALCSVVIFLKEPLHDASKYSVWGILTVVVVFEYSVGATLVKGFNR  95

Query  67   LMGTVIGGAFAIFLT-----PRMIDMPILFTFV-LALWIAFCLYVSLLD-RTPRSYVFML  119
             +GTV  G  A+ +       R  +  I+ T + LA +IA   Y  L     P  Y F +
Sbjct  96   AIGTVSAGGLALGIARLSVLSRDFEQTIIITCIFLAGFIA--SYSKLHPAMKPYEYAFRV  153

Query  120  AGYTTAMVACSSINSIDTYSVFDMALSRVLEISIAVICSAVVSATIFPAHLGTQLQHRV  178
               T  +V  S  N+ D +S    A  R L I +      VV+  IFP   G  L   V
Sbjct  154  FLLTFCIVLVSGNNTGDFFST---AYYRFLFIVVGATTCLVVNIFIFPIWAGEDLHKLV  209


> P32715 Multidrug resistance protein MdtO [Escherichia coli (strain 
K12)]
Length=683

 Score = 43.1 bits (100),  Expect = 5e-07
 Identities = 69/310 (22%), Positives = 119/310 (38%), Gaps = 40/310 (13%)

Query  18   FAVKTFIAMLLALYIAFALDLTYPMWAAGTVIIIAQPYAGMVSSKAVYRLMGTVIGGAFA  77
            +AVKT +A L+       +D         T +I+A P  G    K V R  G   G   A
Sbjct  353  YAVKTLLACLICYTFYSGVDWEGIHTCMLTCVIVANPNVGSSYQKMVLRFGGAFCGAILA  412

Query  78   IFLTPRMIDMPILFTFVLALWIA---FCLYVSLLDRTPRSYVFMLAGYTTAMVACSSINS  134
            +  T  ++ MP L   V  L++    F L   +   + RS         T MV   ++ +
Sbjct  413  LLFT--LLVMPWLDNIVELLFVLAPIFLLGAWIATSSERSSYI-----GTQMVVTFALAT  465

Query  135  IDTY--SVFDMA--LSRVLEISIAVICSAVVSATIFPAHLGTQLQHRVQKTLDDTREVFK  190
            ++     V+D+     R L I I  + SAV+   ++P      L  ++  TL     +  
Sbjct  466  LENVFGPVYDLVEIRDRALGIIIGTVVSAVIYTFVWPESEARTLPQKLAGTLG----MLS  521

Query  191  SILTDPQHSSSYAELLAGITRDTSDIHGLAVHLTYEHGELRGMTKPLQELLHQITMVVAN  250
             ++  P+                 ++  L  +L    G L       +E+  ++ +    
Sbjct  522  KVMRIPRQ---------------QEVTALRTYLQIRIG-LHAAFNACEEMCQRVAL--ER  563

Query  251  LMSMSERILQLDQSDVQYRQGLGDLYQHVVTFLRAQ---TEIEEQQLNRLPDEFEQDFHH  307
             +   ER L +++S    RQG   L+    T+  AQ     ++  +  +  D  E+    
Sbjct  564  QLDSEERALLIERSQTVIRQGRDLLHAWDATWNSAQALDNALQPDRAGQFADALEKYAAG  623

Query  308  L-IALSQPPQ  316
            L  ALS+ PQ
Sbjct  624  LATALSRSPQ  633


 Score = 35.8 bits (81),  Expect = 1e-04
 Identities = 30/127 (24%), Positives = 59/127 (46%), Gaps = 8/127 (6%)

Query  428  GSIYAAILTIFYAFVIMPEVKEFWQLAFVLAPMAIYLLSMF---PHPPLMGLALPMLINF  484
            G+   AIL + +  ++MP +    +L FVLAP  I+LL  +          +   M++ F
Sbjct  404  GAFCGAILALLFTLLVMPWLDNIVELLFVLAP--IFLLGAWIATSSERSSYIGTQMVVTF  461

Query  485  IMSLNLQNHY--TTNAVILMDTAMAGVVGPIISILAIYFIRAMSPETSATRILASHYRAM  542
             ++  L+N +    + V + D A+  ++G ++S +   F+   S   +  + LA     +
Sbjct  462  ALA-TLENVFGPVYDLVEIRDRALGIIIGTVVSAVIYTFVWPESEARTLPQKLAGTLGML  520

Query  543  RAALYIP  549
               + IP
Sbjct  521  SKVMRIP  527



Lambda      K        H        a         alpha
   0.328    0.138    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 7381115


  Database: 76618e738f22d7cbab3d7db56b8dc2a8.SwissProt.fasta
    Posted date:  Sep 19, 2020  3:03 PM
  Number of letters in database: 12,754
  Number of sequences in database:  21



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40