ACIAD0246 / TrEMBL Alignments

BLASTP 2.2.28+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: 5e9053e14b4980993ff276d7cf0cb768.TrEMBL.fasta
           29 sequences; 4,390 total letters



Query= ACIAD0246

Length=160
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  A0A0M1I6U0 Transcriptional repressor NrdR [Acinetobacter sp. C15]    302    6e-109
  A0A1P8EM11 Transcriptional repressor NrdR [Acinetobacter soli]       302    6e-109
  N9BSV3 Transcriptional repressor NrdR [Acinetobacter soli NIPH ...   302    6e-109
  A0A009YID5 Transcriptional repressor NrdR [Acinetobacter sp. 47...   297    5e-107
  N9QVG9 Transcriptional repressor NrdR [Acinetobacter ursingii N...   297    5e-107
  A0A2T5QR61 Transcriptional repressor NrdR [Acinetobacter pittii]     296    1e-106
  N9RX31 Transcriptional repressor NrdR [Acinetobacter sp. NIPH 542]   296    1e-106
  A0A2T5Q8Z3 Transcriptional repressor NrdR [Acinetobacter oleivo...   296    1e-106
  D8JID2 Transcriptional repressor NrdR [Acinetobacter oleivorans...   296    1e-106
  N9ETG0 Transcriptional repressor NrdR [Acinetobacter calcoaceti...   295    2e-106
  R8XYS2 Transcriptional repressor NrdR [Acinetobacter calcoaceti...   295    2e-106
  K9A7V5 Transcriptional repressor NrdR [Acinetobacter sp. WC-141]     295    2e-106
  A0A0B2UGF1 Transcriptional repressor NrdR [Acinetobacter oleivo...   295    2e-106
  A0A0A8XK27 Transcriptional repressor NrdR [Acinetobacter calcoa...   295    2e-106
  A0A2L0HZU8 Transcriptional repressor NrdR [Acinetobacter sp. AC...   295    4e-106
  R9AQA3 Transcriptional repressor NrdR [Acinetobacter tandoii DS...   295    5e-106
  A0A2N6VEW5 Transcriptional repressor NrdR [Acinetobacter ursingii]   294    6e-106
  N9C3Q2 Transcriptional repressor NrdR [Acinetobacter ursingii A...   294    6e-106
  A0A0M3BXB1 Transcriptional repressor NrdR [Acinetobacter pittii]     294    8e-106
  A0A009K219 Transcriptional repressor NrdR [Acinetobacter bauman...   294    8e-106
  A0A255UJK7 Transcriptional repressor NrdR [Acinetobacter sp. BS1]    294    8e-106
  A0A009SHV7 Transcriptional repressor NrdR [Acinetobacter bauman...   294    8e-106
  A0A1V2V6G8 Transcriptional repressor NrdR [Acinetobacter genomo...   293    1e-105
  N8SC69 Transcriptional repressor NrdR [Acinetobacter seifertii]      293    1e-105
  A0A0B2XSU9 Transcriptional repressor NrdR [Acinetobacter bauman...   293    1e-105
  Q8G9G8 Transcriptional repressor NrdR [Aliivibrio fischeri]          181    2e-61 
  Q8G9I0 Transcriptional repressor NrdR [Photobacterium phosphoreum]   181    2e-61 
  Q7BD53 Transcriptional repressor NrdR [Rhizobium meliloti]           132    2e-42 
  O50470 Uncharacterized protein orf4 [Neisseria gonorrhoeae]         89.0    4e-26 


> A0A0M1I6U0 Transcriptional repressor NrdR [Acinetobacter sp. 
C15]
Length=154

 Score =  302 bits (773),  Expect = 6e-109
 Identities = 151/153 (99%), Positives = 153/153 (100%), Gaps = 0/153 (0%)

Query  1    MHCPFCNAADSKVIDSRLAAEGCQIRRRRECISCGERFTTFESYEVVMPRVIKSNGKNEP  60
            MHCPFCNAADSKVIDSRLAAEGCQIRRRRECISCGERFTTFESYEVVMPRVIKSNGKNEP
Sbjct  1    MHCPFCNAADSKVIDSRLAAEGCQIRRRRECISCGERFTTFESYEVVMPRVIKSNGKNEP  60

Query  61   FDEAKLRRSLMHALQKRPVTQEQIEAVLSDIQLKIRRLGERDVKSRMIGEIVMQALFALD  120
            FDEAKLRRSLMHALQKRPVTQ+QIEAVLSDIQLKIRRLGERDVKSR+IGEIVMQALFALD
Sbjct  61   FDEAKLRRSLMHALQKRPVTQDQIEAVLSDIQLKIRRLGERDVKSRVIGEIVMQALFALD  120

Query  121  HVAYVRFASVYQDFQDVEAFRRQIEQMQQREQE  153
            HVAYVRFASVYQDFQDVEAFRRQIEQMQQREQE
Sbjct  121  HVAYVRFASVYQDFQDVEAFRRQIEQMQQREQE  153


> A0A1P8EM11 Transcriptional repressor NrdR [Acinetobacter soli]
Length=154

 Score =  302 bits (773),  Expect = 6e-109
 Identities = 151/153 (99%), Positives = 153/153 (100%), Gaps = 0/153 (0%)

Query  1    MHCPFCNAADSKVIDSRLAAEGCQIRRRRECISCGERFTTFESYEVVMPRVIKSNGKNEP  60
            MHCPFCNAADSKVIDSRLAAEGCQIRRRRECISCGERFTTFESYEVVMPRVIKSNGKNEP
Sbjct  1    MHCPFCNAADSKVIDSRLAAEGCQIRRRRECISCGERFTTFESYEVVMPRVIKSNGKNEP  60

Query  61   FDEAKLRRSLMHALQKRPVTQEQIEAVLSDIQLKIRRLGERDVKSRMIGEIVMQALFALD  120
            FDEAKLRRSLMHALQKRPVTQ+QIEAVLSDIQLKIRRLGERDVKSR+IGEIVMQALFALD
Sbjct  61   FDEAKLRRSLMHALQKRPVTQDQIEAVLSDIQLKIRRLGERDVKSRVIGEIVMQALFALD  120

Query  121  HVAYVRFASVYQDFQDVEAFRRQIEQMQQREQE  153
            HVAYVRFASVYQDFQDVEAFRRQIEQMQQREQE
Sbjct  121  HVAYVRFASVYQDFQDVEAFRRQIEQMQQREQE  153


> N9BSV3 Transcriptional repressor NrdR [Acinetobacter soli NIPH 
2899]
Length=154

 Score =  302 bits (773),  Expect = 6e-109
 Identities = 151/153 (99%), Positives = 153/153 (100%), Gaps = 0/153 (0%)

Query  1    MHCPFCNAADSKVIDSRLAAEGCQIRRRRECISCGERFTTFESYEVVMPRVIKSNGKNEP  60
            MHCPFCNAADSKVIDSRLAAEGCQIRRRRECISCGERFTTFESYEVVMPRVIKSNGKNEP
Sbjct  1    MHCPFCNAADSKVIDSRLAAEGCQIRRRRECISCGERFTTFESYEVVMPRVIKSNGKNEP  60

Query  61   FDEAKLRRSLMHALQKRPVTQEQIEAVLSDIQLKIRRLGERDVKSRMIGEIVMQALFALD  120
            FDEAKLRRSLMHALQKRPVTQ+QIEAVLSDIQLKIRRLGERDVKSR+IGEIVMQALFALD
Sbjct  61   FDEAKLRRSLMHALQKRPVTQDQIEAVLSDIQLKIRRLGERDVKSRVIGEIVMQALFALD  120

Query  121  HVAYVRFASVYQDFQDVEAFRRQIEQMQQREQE  153
            HVAYVRFASVYQDFQDVEAFRRQIEQMQQREQE
Sbjct  121  HVAYVRFASVYQDFQDVEAFRRQIEQMQQREQE  153


> A0A009YID5 Transcriptional repressor NrdR [Acinetobacter sp. 
479375]
Length=155

 Score =  297 bits (760),  Expect = 5e-107
 Identities = 148/155 (95%), Positives = 151/155 (97%), Gaps = 0/155 (0%)

Query  1    MHCPFCNAADSKVIDSRLAAEGCQIRRRRECISCGERFTTFESYEVVMPRVIKSNGKNEP  60
            MHCPFCNAADSKVIDSRLAAEGCQIRRRREC+ CGERFTTFESYEVVMPRVIKSNGKNEP
Sbjct  1    MHCPFCNAADSKVIDSRLAAEGCQIRRRRECLHCGERFTTFESYEVVMPRVIKSNGKNEP  60

Query  61   FDEAKLRRSLMHALQKRPVTQEQIEAVLSDIQLKIRRLGERDVKSRMIGEIVMQALFALD  120
            FDEAKLRRSLMHALQKRPVTQEQIE VLSDIQL+IRRLGERDVKSR IGE+VMQALFALD
Sbjct  61   FDEAKLRRSLMHALQKRPVTQEQIETVLSDIQLQIRRLGERDVKSRKIGEVVMQALFALD  120

Query  121  HVAYVRFASVYQDFQDVEAFRRQIEQMQQREQECE  155
            HVAYVRFASVYQDFQDVEAFRRQIEQMQQREQE E
Sbjct  121  HVAYVRFASVYQDFQDVEAFRRQIEQMQQREQEHE  155


> N9QVG9 Transcriptional repressor NrdR [Acinetobacter ursingii 
NIPH 706]
Length=155

 Score =  297 bits (760),  Expect = 5e-107
 Identities = 148/155 (95%), Positives = 151/155 (97%), Gaps = 0/155 (0%)

Query  1    MHCPFCNAADSKVIDSRLAAEGCQIRRRRECISCGERFTTFESYEVVMPRVIKSNGKNEP  60
            MHCPFCNAADSKVIDSRLAAEGCQIRRRREC+ CGERFTTFESYEVVMPRVIKSNGKNEP
Sbjct  1    MHCPFCNAADSKVIDSRLAAEGCQIRRRRECLHCGERFTTFESYEVVMPRVIKSNGKNEP  60

Query  61   FDEAKLRRSLMHALQKRPVTQEQIEAVLSDIQLKIRRLGERDVKSRMIGEIVMQALFALD  120
            FDEAKLRRSLMHALQKRPVTQEQIE VLSDIQL+IRRLGERDVKSR IGE+VMQALFALD
Sbjct  61   FDEAKLRRSLMHALQKRPVTQEQIETVLSDIQLQIRRLGERDVKSRKIGEVVMQALFALD  120

Query  121  HVAYVRFASVYQDFQDVEAFRRQIEQMQQREQECE  155
            HVAYVRFASVYQDFQDVEAFRRQIEQMQQREQE E
Sbjct  121  HVAYVRFASVYQDFQDVEAFRRQIEQMQQREQEHE  155


> A0A2T5QR61 Transcriptional repressor NrdR [Acinetobacter pittii]
Length=152

 Score =  296 bits (757),  Expect = 1e-106
 Identities = 147/152 (97%), Positives = 150/152 (99%), Gaps = 0/152 (0%)

Query  1    MHCPFCNAADSKVIDSRLAAEGCQIRRRRECISCGERFTTFESYEVVMPRVIKSNGKNEP  60
            MHCPFCNAADSKVIDSRLAAEGCQIRRRREC+SCGERFTTFESYEVVMPRVIKSNGKNEP
Sbjct  1    MHCPFCNAADSKVIDSRLAAEGCQIRRRRECVSCGERFTTFESYEVVMPRVIKSNGKNEP  60

Query  61   FDEAKLRRSLMHALQKRPVTQEQIEAVLSDIQLKIRRLGERDVKSRMIGEIVMQALFALD  120
            FDEAKLRRSLMHALQKRPVTQEQIE VLSDIQL+IRRLGERDVKSR IGEIVMQ+LFALD
Sbjct  61   FDEAKLRRSLMHALQKRPVTQEQIETVLSDIQLQIRRLGERDVKSRTIGEIVMQSLFALD  120

Query  121  HVAYVRFASVYQDFQDVEAFRRQIEQMQQREQ  152
            HVAYVRFASVYQDFQDVEAFRRQIEQMQQREQ
Sbjct  121  HVAYVRFASVYQDFQDVEAFRRQIEQMQQREQ  152


> N9RX31 Transcriptional repressor NrdR [Acinetobacter sp. NIPH 
542]
Length=152

 Score =  296 bits (757),  Expect = 1e-106
 Identities = 147/152 (97%), Positives = 150/152 (99%), Gaps = 0/152 (0%)

Query  1    MHCPFCNAADSKVIDSRLAAEGCQIRRRRECISCGERFTTFESYEVVMPRVIKSNGKNEP  60
            MHCPFCNAADSKVIDSRLAAEGCQIRRRREC+SCGERFTTFESYEVVMPRVIKSNGKNEP
Sbjct  1    MHCPFCNAADSKVIDSRLAAEGCQIRRRRECVSCGERFTTFESYEVVMPRVIKSNGKNEP  60

Query  61   FDEAKLRRSLMHALQKRPVTQEQIEAVLSDIQLKIRRLGERDVKSRMIGEIVMQALFALD  120
            FDEAKLRRSLMHALQKRPVTQEQIE VLSDIQL+IRRLGERDVKSR IGEIVMQ+LFALD
Sbjct  61   FDEAKLRRSLMHALQKRPVTQEQIETVLSDIQLQIRRLGERDVKSRTIGEIVMQSLFALD  120

Query  121  HVAYVRFASVYQDFQDVEAFRRQIEQMQQREQ  152
            HVAYVRFASVYQDFQDVEAFRRQIEQMQQREQ
Sbjct  121  HVAYVRFASVYQDFQDVEAFRRQIEQMQQREQ  152


> A0A2T5Q8Z3 Transcriptional repressor NrdR [Acinetobacter oleivorans]
Length=152

 Score =  296 bits (757),  Expect = 1e-106
 Identities = 147/152 (97%), Positives = 150/152 (99%), Gaps = 0/152 (0%)

Query  1    MHCPFCNAADSKVIDSRLAAEGCQIRRRRECISCGERFTTFESYEVVMPRVIKSNGKNEP  60
            MHCPFCNAADSKVIDSRLAAEGCQIRRRREC+SCGERFTTFESYEVVMPRVIKSNGKNEP
Sbjct  1    MHCPFCNAADSKVIDSRLAAEGCQIRRRRECVSCGERFTTFESYEVVMPRVIKSNGKNEP  60

Query  61   FDEAKLRRSLMHALQKRPVTQEQIEAVLSDIQLKIRRLGERDVKSRMIGEIVMQALFALD  120
            FDEAKLRRSLMHALQKRPVTQEQIE VLSDIQL+IRRLGERDVKSR IGEIVMQ+LFALD
Sbjct  61   FDEAKLRRSLMHALQKRPVTQEQIETVLSDIQLQIRRLGERDVKSRTIGEIVMQSLFALD  120

Query  121  HVAYVRFASVYQDFQDVEAFRRQIEQMQQREQ  152
            HVAYVRFASVYQDFQDVEAFRRQIEQMQQREQ
Sbjct  121  HVAYVRFASVYQDFQDVEAFRRQIEQMQQREQ  152


> D8JID2 Transcriptional repressor NrdR [Acinetobacter oleivorans 
(strain JCM 16667 / KCTC 23045 / DR1)]
Length=152

 Score =  296 bits (757),  Expect = 1e-106
 Identities = 147/152 (97%), Positives = 150/152 (99%), Gaps = 0/152 (0%)

Query  1    MHCPFCNAADSKVIDSRLAAEGCQIRRRRECISCGERFTTFESYEVVMPRVIKSNGKNEP  60
            MHCPFCNAADSKVIDSRLAAEGCQIRRRREC+SCGERFTTFESYEVVMPRVIKSNGKNEP
Sbjct  1    MHCPFCNAADSKVIDSRLAAEGCQIRRRRECVSCGERFTTFESYEVVMPRVIKSNGKNEP  60

Query  61   FDEAKLRRSLMHALQKRPVTQEQIEAVLSDIQLKIRRLGERDVKSRMIGEIVMQALFALD  120
            FDEAKLRRSLMHALQKRPVTQEQIE VLSDIQL+IRRLGERDVKSR IGEIVMQ+LFALD
Sbjct  61   FDEAKLRRSLMHALQKRPVTQEQIETVLSDIQLQIRRLGERDVKSRTIGEIVMQSLFALD  120

Query  121  HVAYVRFASVYQDFQDVEAFRRQIEQMQQREQ  152
            HVAYVRFASVYQDFQDVEAFRRQIEQMQQREQ
Sbjct  121  HVAYVRFASVYQDFQDVEAFRRQIEQMQQREQ  152


> N9ETG0 Transcriptional repressor NrdR [Acinetobacter calcoaceticus 
ANC 3680]
Length=152

 Score =  295 bits (756),  Expect = 2e-106
 Identities = 146/152 (96%), Positives = 150/152 (99%), Gaps = 0/152 (0%)

Query  1    MHCPFCNAADSKVIDSRLAAEGCQIRRRRECISCGERFTTFESYEVVMPRVIKSNGKNEP  60
            MHCPFCNAADSKVIDSRLAAEGCQIRRRREC+SCGERFTTFESYEVVMPRVIKSNGKNEP
Sbjct  1    MHCPFCNAADSKVIDSRLAAEGCQIRRRRECVSCGERFTTFESYEVVMPRVIKSNGKNEP  60

Query  61   FDEAKLRRSLMHALQKRPVTQEQIEAVLSDIQLKIRRLGERDVKSRMIGEIVMQALFALD  120
            FDEAKLRRSLMHALQKRPVTQEQIE VLSDIQL+IRRLGERDVKSR IGE+VMQ+LFALD
Sbjct  61   FDEAKLRRSLMHALQKRPVTQEQIETVLSDIQLQIRRLGERDVKSRTIGEVVMQSLFALD  120

Query  121  HVAYVRFASVYQDFQDVEAFRRQIEQMQQREQ  152
            HVAYVRFASVYQDFQDVEAFRRQIEQMQQREQ
Sbjct  121  HVAYVRFASVYQDFQDVEAFRRQIEQMQQREQ  152


> R8XYS2 Transcriptional repressor NrdR [Acinetobacter calcoaceticus 
ANC 3811]
Length=152

 Score =  295 bits (756),  Expect = 2e-106
 Identities = 146/152 (96%), Positives = 150/152 (99%), Gaps = 0/152 (0%)

Query  1    MHCPFCNAADSKVIDSRLAAEGCQIRRRRECISCGERFTTFESYEVVMPRVIKSNGKNEP  60
            MHCPFCNAADSKVIDSRLAAEGCQIRRRREC+SCGERFTTFESYEVVMPRVIKSNGKNEP
Sbjct  1    MHCPFCNAADSKVIDSRLAAEGCQIRRRRECVSCGERFTTFESYEVVMPRVIKSNGKNEP  60

Query  61   FDEAKLRRSLMHALQKRPVTQEQIEAVLSDIQLKIRRLGERDVKSRMIGEIVMQALFALD  120
            FDEAKLRRSLMHALQKRPVTQEQIE VLSDIQL+IRRLGERDVKSR IGE+VMQ+LFALD
Sbjct  61   FDEAKLRRSLMHALQKRPVTQEQIETVLSDIQLQIRRLGERDVKSRTIGEVVMQSLFALD  120

Query  121  HVAYVRFASVYQDFQDVEAFRRQIEQMQQREQ  152
            HVAYVRFASVYQDFQDVEAFRRQIEQMQQREQ
Sbjct  121  HVAYVRFASVYQDFQDVEAFRRQIEQMQQREQ  152


> K9A7V5 Transcriptional repressor NrdR [Acinetobacter sp. WC-141]
Length=152

 Score =  295 bits (756),  Expect = 2e-106
 Identities = 146/152 (96%), Positives = 150/152 (99%), Gaps = 0/152 (0%)

Query  1    MHCPFCNAADSKVIDSRLAAEGCQIRRRRECISCGERFTTFESYEVVMPRVIKSNGKNEP  60
            MHCPFCNAADSKVIDSRLAAEGCQIRRRREC+SCGERFTTFESYEVVMPRVIKSNGKNEP
Sbjct  1    MHCPFCNAADSKVIDSRLAAEGCQIRRRRECVSCGERFTTFESYEVVMPRVIKSNGKNEP  60

Query  61   FDEAKLRRSLMHALQKRPVTQEQIEAVLSDIQLKIRRLGERDVKSRMIGEIVMQALFALD  120
            FDEAKLRRSLMHALQKRPVTQEQIE VLSDIQL+IRRLGERDVKSR IGE+VMQ+LFALD
Sbjct  61   FDEAKLRRSLMHALQKRPVTQEQIETVLSDIQLQIRRLGERDVKSRTIGEVVMQSLFALD  120

Query  121  HVAYVRFASVYQDFQDVEAFRRQIEQMQQREQ  152
            HVAYVRFASVYQDFQDVEAFRRQIEQMQQREQ
Sbjct  121  HVAYVRFASVYQDFQDVEAFRRQIEQMQQREQ  152


> A0A0B2UGF1 Transcriptional repressor NrdR [Acinetobacter oleivorans]
Length=152

 Score =  295 bits (756),  Expect = 2e-106
 Identities = 146/152 (96%), Positives = 150/152 (99%), Gaps = 0/152 (0%)

Query  1    MHCPFCNAADSKVIDSRLAAEGCQIRRRRECISCGERFTTFESYEVVMPRVIKSNGKNEP  60
            MHCPFCNAADSKVIDSRLAAEGCQIRRRREC+SCGERFTTFESYEVVMPRVIKSNGKNEP
Sbjct  1    MHCPFCNAADSKVIDSRLAAEGCQIRRRRECVSCGERFTTFESYEVVMPRVIKSNGKNEP  60

Query  61   FDEAKLRRSLMHALQKRPVTQEQIEAVLSDIQLKIRRLGERDVKSRMIGEIVMQALFALD  120
            FDEAKLRRSLMHALQKRPVTQEQIE VLSDIQL+IRRLGERDVKSR IGE+VMQ+LFALD
Sbjct  61   FDEAKLRRSLMHALQKRPVTQEQIETVLSDIQLQIRRLGERDVKSRTIGEVVMQSLFALD  120

Query  121  HVAYVRFASVYQDFQDVEAFRRQIEQMQQREQ  152
            HVAYVRFASVYQDFQDVEAFRRQIEQMQQREQ
Sbjct  121  HVAYVRFASVYQDFQDVEAFRRQIEQMQQREQ  152


> A0A0A8XK27 Transcriptional repressor NrdR [Acinetobacter calcoaceticus]
Length=152

 Score =  295 bits (756),  Expect = 2e-106
 Identities = 146/152 (96%), Positives = 150/152 (99%), Gaps = 0/152 (0%)

Query  1    MHCPFCNAADSKVIDSRLAAEGCQIRRRRECISCGERFTTFESYEVVMPRVIKSNGKNEP  60
            MHCPFCNAADSKVIDSRLAAEGCQIRRRREC+SCGERFTTFESYEVVMPRVIKSNGKNEP
Sbjct  1    MHCPFCNAADSKVIDSRLAAEGCQIRRRRECVSCGERFTTFESYEVVMPRVIKSNGKNEP  60

Query  61   FDEAKLRRSLMHALQKRPVTQEQIEAVLSDIQLKIRRLGERDVKSRMIGEIVMQALFALD  120
            FDEAKLRRSLMHALQKRPVTQEQIE VLSDIQL+IRRLGERDVKSR IGE+VMQ+LFALD
Sbjct  61   FDEAKLRRSLMHALQKRPVTQEQIETVLSDIQLQIRRLGERDVKSRTIGEVVMQSLFALD  120

Query  121  HVAYVRFASVYQDFQDVEAFRRQIEQMQQREQ  152
            HVAYVRFASVYQDFQDVEAFRRQIEQMQQREQ
Sbjct  121  HVAYVRFASVYQDFQDVEAFRRQIEQMQQREQ  152


> A0A2L0HZU8 Transcriptional repressor NrdR [Acinetobacter sp. 
ACNIH2]
Length=153

 Score =  295 bits (754),  Expect = 4e-106
 Identities = 148/153 (97%), Positives = 150/153 (98%), Gaps = 0/153 (0%)

Query  1    MHCPFCNAADSKVIDSRLAAEGCQIRRRRECISCGERFTTFESYEVVMPRVIKSNGKNEP  60
            MHCPFCNAADSKVIDSRLAAEGCQIRRRRECISCGERFTTFES+EVVMPRVIKS+GKNEP
Sbjct  1    MHCPFCNAADSKVIDSRLAAEGCQIRRRRECISCGERFTTFESFEVVMPRVIKSDGKNEP  60

Query  61   FDEAKLRRSLMHALQKRPVTQEQIEAVLSDIQLKIRRLGERDVKSRMIGEIVMQALFALD  120
            FDEAKLRRSLMHALQKRPVTQEQIEAVLSDIQL IRRLGERDVKSR IGEIVMQALFALD
Sbjct  61   FDEAKLRRSLMHALQKRPVTQEQIEAVLSDIQLHIRRLGERDVKSRTIGEIVMQALFALD  120

Query  121  HVAYVRFASVYQDFQDVEAFRRQIEQMQQREQE  153
            HVAYVRFASVYQDFQDVEAFRRQIEQMQQRE E
Sbjct  121  HVAYVRFASVYQDFQDVEAFRRQIEQMQQREHE  153


> R9AQA3 Transcriptional repressor NrdR [Acinetobacter tandoii 
DSM 14970 = CIP 107469]
Length=159

 Score =  295 bits (754),  Expect = 5e-106
 Identities = 148/153 (97%), Positives = 150/153 (98%), Gaps = 0/153 (0%)

Query  1    MHCPFCNAADSKVIDSRLAAEGCQIRRRRECISCGERFTTFESYEVVMPRVIKSNGKNEP  60
            MHCPFCNAADSKVIDSRLAAEGCQIRRRRECISCGERFTTFES+EVVMPRVIKS+GKNEP
Sbjct  7    MHCPFCNAADSKVIDSRLAAEGCQIRRRRECISCGERFTTFESFEVVMPRVIKSDGKNEP  66

Query  61   FDEAKLRRSLMHALQKRPVTQEQIEAVLSDIQLKIRRLGERDVKSRMIGEIVMQALFALD  120
            FDEAKLRRSLMHALQKRPVTQEQIEAVLSDIQL IRRLGERDVKSR IGEIVMQALFALD
Sbjct  67   FDEAKLRRSLMHALQKRPVTQEQIEAVLSDIQLHIRRLGERDVKSRTIGEIVMQALFALD  126

Query  121  HVAYVRFASVYQDFQDVEAFRRQIEQMQQREQE  153
            HVAYVRFASVYQDFQDVEAFRRQIEQMQQRE E
Sbjct  127  HVAYVRFASVYQDFQDVEAFRRQIEQMQQREHE  159


> A0A2N6VEW5 Transcriptional repressor NrdR [Acinetobacter ursingii]
Length=155

 Score =  294 bits (753),  Expect = 6e-106
 Identities = 146/153 (95%), Positives = 149/153 (97%), Gaps = 0/153 (0%)

Query  1    MHCPFCNAADSKVIDSRLAAEGCQIRRRRECISCGERFTTFESYEVVMPRVIKSNGKNEP  60
            MHCPFCNAADSKVIDSRLAAEGCQIRRRREC+ CGERFTTFESYEVVMPRVIKSNGKNEP
Sbjct  1    MHCPFCNAADSKVIDSRLAAEGCQIRRRRECLHCGERFTTFESYEVVMPRVIKSNGKNEP  60

Query  61   FDEAKLRRSLMHALQKRPVTQEQIEAVLSDIQLKIRRLGERDVKSRMIGEIVMQALFALD  120
            FDEAKLRRSLMHALQKRPVTQEQIE VLSDIQL+IRRLGERDVKSR IGE+VMQALFALD
Sbjct  61   FDEAKLRRSLMHALQKRPVTQEQIETVLSDIQLQIRRLGERDVKSRKIGEVVMQALFALD  120

Query  121  HVAYVRFASVYQDFQDVEAFRRQIEQMQQREQE  153
            HVAYVRFASVYQDFQDVEAFRRQIEQMQQRE E
Sbjct  121  HVAYVRFASVYQDFQDVEAFRRQIEQMQQREHE  153


> N9C3Q2 Transcriptional repressor NrdR [Acinetobacter ursingii 
ANC 3649]
Length=155

 Score =  294 bits (753),  Expect = 6e-106
 Identities = 146/153 (95%), Positives = 149/153 (97%), Gaps = 0/153 (0%)

Query  1    MHCPFCNAADSKVIDSRLAAEGCQIRRRRECISCGERFTTFESYEVVMPRVIKSNGKNEP  60
            MHCPFCNAADSKVIDSRLAAEGCQIRRRREC+ CGERFTTFESYEVVMPRVIKSNGKNEP
Sbjct  1    MHCPFCNAADSKVIDSRLAAEGCQIRRRRECLHCGERFTTFESYEVVMPRVIKSNGKNEP  60

Query  61   FDEAKLRRSLMHALQKRPVTQEQIEAVLSDIQLKIRRLGERDVKSRMIGEIVMQALFALD  120
            FDEAKLRRSLMHALQKRPVTQEQIE VLSDIQL+IRRLGERDVKSR IGE+VMQALFALD
Sbjct  61   FDEAKLRRSLMHALQKRPVTQEQIETVLSDIQLQIRRLGERDVKSRKIGEVVMQALFALD  120

Query  121  HVAYVRFASVYQDFQDVEAFRRQIEQMQQREQE  153
            HVAYVRFASVYQDFQDVEAFRRQIEQMQQRE E
Sbjct  121  HVAYVRFASVYQDFQDVEAFRRQIEQMQQREHE  153


> A0A0M3BXB1 Transcriptional repressor NrdR [Acinetobacter pittii]
Length=152

 Score =  294 bits (752),  Expect = 8e-106
 Identities = 146/151 (97%), Positives = 149/151 (99%), Gaps = 0/151 (0%)

Query  1    MHCPFCNAADSKVIDSRLAAEGCQIRRRRECISCGERFTTFESYEVVMPRVIKSNGKNEP  60
            MHCPFCNAADSKVIDSRLAAEGCQIRRRREC+SCGERFTTFESYEVVMPRVIKSNGKNEP
Sbjct  1    MHCPFCNAADSKVIDSRLAAEGCQIRRRRECVSCGERFTTFESYEVVMPRVIKSNGKNEP  60

Query  61   FDEAKLRRSLMHALQKRPVTQEQIEAVLSDIQLKIRRLGERDVKSRMIGEIVMQALFALD  120
            FDEAKLRRSLMHALQKRPVTQEQIE VLSDIQL+IRRLGERDVKSR IGEIVMQ+LFALD
Sbjct  61   FDEAKLRRSLMHALQKRPVTQEQIETVLSDIQLQIRRLGERDVKSRTIGEIVMQSLFALD  120

Query  121  HVAYVRFASVYQDFQDVEAFRRQIEQMQQRE  151
            HVAYVRFASVYQDFQDVEAFRRQIEQMQQRE
Sbjct  121  HVAYVRFASVYQDFQDVEAFRRQIEQMQQRE  151


> A0A009K219 Transcriptional repressor NrdR [Acinetobacter baumannii 
1419130]
Length=152

 Score =  294 bits (752),  Expect = 8e-106
 Identities = 146/151 (97%), Positives = 149/151 (99%), Gaps = 0/151 (0%)

Query  1    MHCPFCNAADSKVIDSRLAAEGCQIRRRRECISCGERFTTFESYEVVMPRVIKSNGKNEP  60
            MHCPFCNAADSKVIDSRLAAEGCQIRRRREC+SCGERFTTFESYEVVMPRVIKSNGKNEP
Sbjct  1    MHCPFCNAADSKVIDSRLAAEGCQIRRRRECVSCGERFTTFESYEVVMPRVIKSNGKNEP  60

Query  61   FDEAKLRRSLMHALQKRPVTQEQIEAVLSDIQLKIRRLGERDVKSRMIGEIVMQALFALD  120
            FDEAKLRRSLMHALQKRPVTQEQIE VLSDIQL+IRRLGERDVKSR IGEIVMQ+LFALD
Sbjct  61   FDEAKLRRSLMHALQKRPVTQEQIETVLSDIQLQIRRLGERDVKSRTIGEIVMQSLFALD  120

Query  121  HVAYVRFASVYQDFQDVEAFRRQIEQMQQRE  151
            HVAYVRFASVYQDFQDVEAFRRQIEQMQQRE
Sbjct  121  HVAYVRFASVYQDFQDVEAFRRQIEQMQQRE  151


> A0A255UJK7 Transcriptional repressor NrdR [Acinetobacter sp. 
BS1]
Length=152

 Score =  294 bits (752),  Expect = 8e-106
 Identities = 146/151 (97%), Positives = 149/151 (99%), Gaps = 0/151 (0%)

Query  1    MHCPFCNAADSKVIDSRLAAEGCQIRRRRECISCGERFTTFESYEVVMPRVIKSNGKNEP  60
            MHCPFCNAADSKVIDSRLAAEGCQIRRRREC+SCGERFTTFESYEVVMPRVIKSNGKNEP
Sbjct  1    MHCPFCNAADSKVIDSRLAAEGCQIRRRRECVSCGERFTTFESYEVVMPRVIKSNGKNEP  60

Query  61   FDEAKLRRSLMHALQKRPVTQEQIEAVLSDIQLKIRRLGERDVKSRMIGEIVMQALFALD  120
            FDEAKLRRSLMHALQKRPVTQEQIE VLSDIQL+IRRLGERDVKSR IGEIVMQ+LFALD
Sbjct  61   FDEAKLRRSLMHALQKRPVTQEQIETVLSDIQLQIRRLGERDVKSRTIGEIVMQSLFALD  120

Query  121  HVAYVRFASVYQDFQDVEAFRRQIEQMQQRE  151
            HVAYVRFASVYQDFQDVEAFRRQIEQMQQRE
Sbjct  121  HVAYVRFASVYQDFQDVEAFRRQIEQMQQRE  151


> A0A009SHV7 Transcriptional repressor NrdR [Acinetobacter baumannii 
99063]
Length=152

 Score =  294 bits (752),  Expect = 8e-106
 Identities = 146/151 (97%), Positives = 149/151 (99%), Gaps = 0/151 (0%)

Query  1    MHCPFCNAADSKVIDSRLAAEGCQIRRRRECISCGERFTTFESYEVVMPRVIKSNGKNEP  60
            MHCPFCNAADSKVIDSRLAAEGCQIRRRREC+SCGERFTTFESYEVVMPRVIKSNGKNEP
Sbjct  1    MHCPFCNAADSKVIDSRLAAEGCQIRRRRECVSCGERFTTFESYEVVMPRVIKSNGKNEP  60

Query  61   FDEAKLRRSLMHALQKRPVTQEQIEAVLSDIQLKIRRLGERDVKSRMIGEIVMQALFALD  120
            FDEAKLRRSLMHALQKRPVTQEQIE VLSDIQL+IRRLGERDVKSR IGEIVMQ+LFALD
Sbjct  61   FDEAKLRRSLMHALQKRPVTQEQIETVLSDIQLQIRRLGERDVKSRTIGEIVMQSLFALD  120

Query  121  HVAYVRFASVYQDFQDVEAFRRQIEQMQQRE  151
            HVAYVRFASVYQDFQDVEAFRRQIEQMQQRE
Sbjct  121  HVAYVRFASVYQDFQDVEAFRRQIEQMQQRE  151


> A0A1V2V6G8 Transcriptional repressor NrdR [Acinetobacter genomosp. 
33YU]
Length=152

 Score =  293 bits (751),  Expect = 1e-105
 Identities = 146/152 (96%), Positives = 149/152 (98%), Gaps = 0/152 (0%)

Query  1    MHCPFCNAADSKVIDSRLAAEGCQIRRRRECISCGERFTTFESYEVVMPRVIKSNGKNEP  60
            MHCPFCNAADSKVIDSRLAAEGCQIRRRREC+ CGERFTTFESYEVVMPRVIKSNGKNEP
Sbjct  1    MHCPFCNAADSKVIDSRLAAEGCQIRRRRECVVCGERFTTFESYEVVMPRVIKSNGKNEP  60

Query  61   FDEAKLRRSLMHALQKRPVTQEQIEAVLSDIQLKIRRLGERDVKSRMIGEIVMQALFALD  120
            FDEAKLRRSLMHALQKRPVTQEQIE VLSDIQL+IRRLGERDVKSR IGEIVMQ+LFALD
Sbjct  61   FDEAKLRRSLMHALQKRPVTQEQIETVLSDIQLQIRRLGERDVKSRTIGEIVMQSLFALD  120

Query  121  HVAYVRFASVYQDFQDVEAFRRQIEQMQQREQ  152
            HVAYVRFASVYQDFQDVEAFRRQIEQMQQREQ
Sbjct  121  HVAYVRFASVYQDFQDVEAFRRQIEQMQQREQ  152


> N8SC69 Transcriptional repressor NrdR [Acinetobacter seifertii]
Length=152

 Score =  293 bits (751),  Expect = 1e-105
 Identities = 146/152 (96%), Positives = 149/152 (98%), Gaps = 0/152 (0%)

Query  1    MHCPFCNAADSKVIDSRLAAEGCQIRRRRECISCGERFTTFESYEVVMPRVIKSNGKNEP  60
            MHCPFCNAADSKVIDSRLAAEGCQIRRRREC+ CGERFTTFESYEVVMPRVIKSNGKNEP
Sbjct  1    MHCPFCNAADSKVIDSRLAAEGCQIRRRRECVVCGERFTTFESYEVVMPRVIKSNGKNEP  60

Query  61   FDEAKLRRSLMHALQKRPVTQEQIEAVLSDIQLKIRRLGERDVKSRMIGEIVMQALFALD  120
            FDEAKLRRSLMHALQKRPVTQEQIE VLSDIQL+IRRLGERDVKSR IGEIVMQ+LFALD
Sbjct  61   FDEAKLRRSLMHALQKRPVTQEQIETVLSDIQLQIRRLGERDVKSRTIGEIVMQSLFALD  120

Query  121  HVAYVRFASVYQDFQDVEAFRRQIEQMQQREQ  152
            HVAYVRFASVYQDFQDVEAFRRQIEQMQQREQ
Sbjct  121  HVAYVRFASVYQDFQDVEAFRRQIEQMQQREQ  152


> A0A0B2XSU9 Transcriptional repressor NrdR [Acinetobacter baumannii]
Length=152

 Score =  293 bits (751),  Expect = 1e-105
 Identities = 146/152 (96%), Positives = 149/152 (98%), Gaps = 0/152 (0%)

Query  1    MHCPFCNAADSKVIDSRLAAEGCQIRRRRECISCGERFTTFESYEVVMPRVIKSNGKNEP  60
            MHCPFCNAADSKVIDSRLAAEGCQIRRRREC+ CGERFTTFESYEVVMPRVIKSNGKNEP
Sbjct  1    MHCPFCNAADSKVIDSRLAAEGCQIRRRRECVVCGERFTTFESYEVVMPRVIKSNGKNEP  60

Query  61   FDEAKLRRSLMHALQKRPVTQEQIEAVLSDIQLKIRRLGERDVKSRMIGEIVMQALFALD  120
            FDEAKLRRSLMHALQKRPVTQEQIE VLSDIQL+IRRLGERDVKSR IGEIVMQ+LFALD
Sbjct  61   FDEAKLRRSLMHALQKRPVTQEQIETVLSDIQLQIRRLGERDVKSRTIGEIVMQSLFALD  120

Query  121  HVAYVRFASVYQDFQDVEAFRRQIEQMQQREQ  152
            HVAYVRFASVYQDFQDVEAFRRQIEQMQQREQ
Sbjct  121  HVAYVRFASVYQDFQDVEAFRRQIEQMQQREQ  152


> Q8G9G8 Transcriptional repressor NrdR [Aliivibrio fischeri]
Length=149

 Score =  181 bits (459),  Expect = 2e-61
 Identities = 84/149 (56%), Positives = 115/149 (77%), Gaps = 0/149 (0%)

Query  1    MHCPFCNAADSKVIDSRLAAEGCQIRRRRECISCGERFTTFESYEVVMPRVIKSNGKNEP  60
            MHCPFC+A D+KVIDSRL ++G Q+RRRR+C++C ERFTTFES E+VMP+VIKSNG  EP
Sbjct  1    MHCPFCSATDTKVIDSRLVSDGHQVRRRRQCLACSERFTTFESAELVMPKVIKSNGNREP  60

Query  61   FDEAKLRRSLMHALQKRPVTQEQIEAVLSDIQLKIRRLGERDVKSRMIGEIVMQALFALD  120
            FDE KL   L  +L+KRPV+ + +E  L+ I+ ++R  GER+V S MIG +VM  L  LD
Sbjct  61   FDEDKLSGGLYRSLEKRPVSADLVELALNTIKSQLRATGEREVPSDMIGNLVMDQLKELD  120

Query  121  HVAYVRFASVYQDFQDVEAFRRQIEQMQQ  149
             VAY+RFASVY+ F+D++ F  +I ++++
Sbjct  121  KVAYIRFASVYRSFEDIKEFGEEIAKLEK  149


> Q8G9I0 Transcriptional repressor NrdR [Photobacterium phosphoreum]
Length=149

 Score =  181 bits (458),  Expect = 2e-61
 Identities = 82/149 (55%), Positives = 115/149 (77%), Gaps = 0/149 (0%)

Query  1    MHCPFCNAADSKVIDSRLAAEGCQIRRRRECISCGERFTTFESYEVVMPRVIKSNGKNEP  60
            MHCPFC A D+KVIDSRL A+G Q+RRRR+C++C ER+TTFE+ E+VMPRV+K+NG  +P
Sbjct  1    MHCPFCGANDTKVIDSRLVADGHQVRRRRQCLACNERYTTFETAELVMPRVVKTNGNRDP  60

Query  61   FDEAKLRRSLMHALQKRPVTQEQIEAVLSDIQLKIRRLGERDVKSRMIGEIVMQALFALD  120
            F+E KLR  +  AL+KRPV+ + IE  ++ I+  +R  GER+V S MIG +VM+AL  LD
Sbjct  61   FNEDKLRGGIQRALEKRPVSTDDIERAINSIKSCLRATGEREVPSEMIGNLVMEALKELD  120

Query  121  HVAYVRFASVYQDFQDVEAFRRQIEQMQQ  149
             VAY+RFASVY+ F+D+  F  +I ++++
Sbjct  121  KVAYIRFASVYRSFEDIREFGEEIAKLER  149


> Q7BD53 Transcriptional repressor NrdR [Rhizobium meliloti]
Length=157

 Score =  132 bits (333),  Expect = 2e-42
 Identities = 69/150 (46%), Positives = 96/150 (64%), Gaps = 0/150 (0%)

Query  1    MHCPFCNAADSKVIDSRLAAEGCQIRRRRECISCGERFTTFESYEVVMPRVIKSNGKNEP  60
            M CP+C + DS+V DSR A +G  IRRRR C  CG RFTTFE  ++    +IK  G+  P
Sbjct  1    MRCPYCGSEDSQVKDSRPAEDGNAIRRRRICPDCGGRFTTFERVQLRELMIIKKTGRKVP  60

Query  61   FDEAKLRRSLMHALQKRPVTQEQIEAVLSDIQLKIRRLGERDVKSRMIGEIVMQALFALD  120
            FD  KL RS   AL+KRPV +++IE  +S I  ++   GE ++ S  IG  V++AL +LD
Sbjct  61   FDRDKLLRSFEIALRKRPVDRDRIERAVSGIVRRLESSGETEIPSEEIGLQVLEALKSLD  120

Query  121  HVAYVRFASVYQDFQDVEAFRRQIEQMQQR  150
             VA+VR+ASVY+DF   E F + I ++  +
Sbjct  121  DVAFVRYASVYRDFSHAEDFEKVIAEISAK  150


> O50470 Uncharacterized protein orf4 [Neisseria gonorrhoeae]
Length=109

 Score = 89.0 bits (219),  Expect = 4e-26
 Identities = 44/105 (42%), Positives = 63/105 (60%), Gaps = 0/105 (0%)

Query  1    MHCPFCNAADSKVIDSRLAAEGCQIRRRRECISCGERFTTFESYEVVMPRVIKSNGKNEP  60
            M CPFC+  D++V DSRL  E   +RRRR C  CG+RF T E+ E+ MP VI  + K  P
Sbjct  1    MKCPFCSHPDTRVADSRLMEERNTVRRRRHCPGCGKRFGTLETVELKMPAVIGPDKKRSP  60

Query  61   FDEAKLRRSLMHALQKRPVTQEQIEAVLSDIQLKIRRLGERDVKS  105
            F+  +LR  L  A +K  +T EQI+  +   + ++   G+RD+ S
Sbjct  61   FNAQRLRNDLTAAARKSALTPEQIDETVRLTEHRLYTSGQRDISS  105



Lambda      K        H        a         alpha
   0.328    0.138    0.404    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 401136


  Database: 5e9053e14b4980993ff276d7cf0cb768.TrEMBL.fasta
    Posted date:  Sep 24, 2020  3:33 AM
  Number of letters in database: 4,390
  Number of sequences in database:  29



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40