ACIAD0246 / SwissProt Alignments

BLASTP 2.2.28+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: cfe0e7877b7ba145b86d5ad6c18a49b4.SwissProt.fasta
           25 sequences; 4,977 total letters



Query= ACIAD0246

Length=160
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  Q6FFE5 Transcriptional repressor NrdR [Acinetobacter baylyi (st...   319    2e-115
  B7I302 Transcriptional repressor NrdR [Acinetobacter baumannii ...   294    9e-106
  B2I1T3 Transcriptional repressor NrdR [Acinetobacter baumannii ...   294    9e-106
  B0VMH0 Transcriptional repressor NrdR [Acinetobacter baumannii ...   294    9e-106
  A3M1A1 Transcriptional repressor NrdR [Acinetobacter baumannii ...   294    9e-106
  B0VDB2 Transcriptional repressor NrdR [Acinetobacter baumannii ...   294    9e-106
  Q4FPR9 Transcriptional repressor NrdR [Psychrobacter arcticus (...   201    4e-69 
  Q1Q7V5 Transcriptional repressor NrdR [Psychrobacter cryohalole...   199    2e-68 
  A5WI35 Transcriptional repressor NrdR [Psychrobacter sp. (strai...   198    5e-68 
  B7V7Q1 Transcriptional repressor NrdR [Pseudomonas aeruginosa (...   192    6e-66 
  Q02SM4 Transcriptional repressor NrdR [Pseudomonas aeruginosa (...   192    6e-66 
  Q9HWX1 Transcriptional repressor NrdR [Pseudomonas aeruginosa (...   192    6e-66 
  C1DLH3 Transcriptional repressor NrdR [Azotobacter vinelandii (...   192    6e-66 
  A1TYW9 Transcriptional repressor NrdR [Marinobacter hydrocarbon...   193    8e-66 
  Q4K592 Transcriptional repressor NrdR [Pseudomonas fluorescens ...   191    2e-65 
  Q2S9R5 Transcriptional repressor NrdR [Hahella chejuensis (stra...   192    2e-65 
  P0A8D0 Transcriptional repressor NrdR [Escherichia coli (strain...   178    3e-60 
  P33661 Transcriptional repressor NrdR [Clostridium acetobutylic...   137    4e-44 
  P46227 Transcriptional repressor NrdR [Synechococcus sp. (strai...   136    1e-43 
  Q45549 Transcriptional repressor NrdR [Bacillus subtilis (strai...   131    6e-42 
  C7P544 Transcriptional repressor NrdR [Halomicrobium mukohataei...   119    2e-37 
  O86848 Transcriptional repressor NrdR [Streptomyces clavuligerus]    117    3e-36 
  O69980 Transcriptional repressor NrdR [Streptomyces coelicolor ...   115    2e-35 
  Q47823 D-alanine--D-alanine ligase [Enterococcus gallinarum]        34.3    9e-06 
  Q8MQJ9 Brain tumor protein [Drosophila melanogaster]                33.5    2e-05 


> Q6FFE5 Transcriptional repressor NrdR [Acinetobacter baylyi (strain 
ATCC 33305 / BD413 / ADP1)]
Length=159

 Score =  319 bits (817),  Expect = 2e-115
 Identities = 159/159 (100%), Positives = 159/159 (100%), Gaps = 0/159 (0%)

Query  1    MHCPFCNAADSKVIDSRLAAEGCQIRRRRECISCGERFTTFESYEVVMPRVIKSNGKNEP  60
            MHCPFCNAADSKVIDSRLAAEGCQIRRRRECISCGERFTTFESYEVVMPRVIKSNGKNEP
Sbjct  1    MHCPFCNAADSKVIDSRLAAEGCQIRRRRECISCGERFTTFESYEVVMPRVIKSNGKNEP  60

Query  61   FDEAKLRRSLMHALQKRPVTQEQIEAVLSDIQLKIRRLGERDVKSRMIGEIVMQALFALD  120
            FDEAKLRRSLMHALQKRPVTQEQIEAVLSDIQLKIRRLGERDVKSRMIGEIVMQALFALD
Sbjct  61   FDEAKLRRSLMHALQKRPVTQEQIEAVLSDIQLKIRRLGERDVKSRMIGEIVMQALFALD  120

Query  121  HVAYVRFASVYQDFQDVEAFRRQIEQMQQREQECEKHDV  159
            HVAYVRFASVYQDFQDVEAFRRQIEQMQQREQECEKHDV
Sbjct  121  HVAYVRFASVYQDFQDVEAFRRQIEQMQQREQECEKHDV  159


> B7I302 Transcriptional repressor NrdR [Acinetobacter baumannii 
(strain AB0057)]
Length=152

 Score =  294 bits (752),  Expect = 9e-106
 Identities = 146/151 (97%), Positives = 149/151 (99%), Gaps = 0/151 (0%)

Query  1    MHCPFCNAADSKVIDSRLAAEGCQIRRRRECISCGERFTTFESYEVVMPRVIKSNGKNEP  60
            MHCPFCNAADSKVIDSRLAAEGCQIRRRREC+SCGERFTTFESYEVVMPRVIKSNGKNEP
Sbjct  1    MHCPFCNAADSKVIDSRLAAEGCQIRRRRECVSCGERFTTFESYEVVMPRVIKSNGKNEP  60

Query  61   FDEAKLRRSLMHALQKRPVTQEQIEAVLSDIQLKIRRLGERDVKSRMIGEIVMQALFALD  120
            FDEAKLRRSLMHALQKRPVTQEQIE VLSDIQL+IRRLGERDVKSR IGEIVMQ+LFALD
Sbjct  61   FDEAKLRRSLMHALQKRPVTQEQIETVLSDIQLQIRRLGERDVKSRTIGEIVMQSLFALD  120

Query  121  HVAYVRFASVYQDFQDVEAFRRQIEQMQQRE  151
            HVAYVRFASVYQDFQDVEAFRRQIEQMQQRE
Sbjct  121  HVAYVRFASVYQDFQDVEAFRRQIEQMQQRE  151


> B2I1T3 Transcriptional repressor NrdR [Acinetobacter baumannii 
(strain ACICU)]
Length=152

 Score =  294 bits (752),  Expect = 9e-106
 Identities = 146/151 (97%), Positives = 149/151 (99%), Gaps = 0/151 (0%)

Query  1    MHCPFCNAADSKVIDSRLAAEGCQIRRRRECISCGERFTTFESYEVVMPRVIKSNGKNEP  60
            MHCPFCNAADSKVIDSRLAAEGCQIRRRREC+SCGERFTTFESYEVVMPRVIKSNGKNEP
Sbjct  1    MHCPFCNAADSKVIDSRLAAEGCQIRRRRECVSCGERFTTFESYEVVMPRVIKSNGKNEP  60

Query  61   FDEAKLRRSLMHALQKRPVTQEQIEAVLSDIQLKIRRLGERDVKSRMIGEIVMQALFALD  120
            FDEAKLRRSLMHALQKRPVTQEQIE VLSDIQL+IRRLGERDVKSR IGEIVMQ+LFALD
Sbjct  61   FDEAKLRRSLMHALQKRPVTQEQIETVLSDIQLQIRRLGERDVKSRTIGEIVMQSLFALD  120

Query  121  HVAYVRFASVYQDFQDVEAFRRQIEQMQQRE  151
            HVAYVRFASVYQDFQDVEAFRRQIEQMQQRE
Sbjct  121  HVAYVRFASVYQDFQDVEAFRRQIEQMQQRE  151


> B0VMH0 Transcriptional repressor NrdR [Acinetobacter baumannii 
(strain SDF)]
Length=152

 Score =  294 bits (752),  Expect = 9e-106
 Identities = 146/151 (97%), Positives = 149/151 (99%), Gaps = 0/151 (0%)

Query  1    MHCPFCNAADSKVIDSRLAAEGCQIRRRRECISCGERFTTFESYEVVMPRVIKSNGKNEP  60
            MHCPFCNAADSKVIDSRLAAEGCQIRRRREC+SCGERFTTFESYEVVMPRVIKSNGKNEP
Sbjct  1    MHCPFCNAADSKVIDSRLAAEGCQIRRRRECVSCGERFTTFESYEVVMPRVIKSNGKNEP  60

Query  61   FDEAKLRRSLMHALQKRPVTQEQIEAVLSDIQLKIRRLGERDVKSRMIGEIVMQALFALD  120
            FDEAKLRRSLMHALQKRPVTQEQIE VLSDIQL+IRRLGERDVKSR IGEIVMQ+LFALD
Sbjct  61   FDEAKLRRSLMHALQKRPVTQEQIETVLSDIQLQIRRLGERDVKSRTIGEIVMQSLFALD  120

Query  121  HVAYVRFASVYQDFQDVEAFRRQIEQMQQRE  151
            HVAYVRFASVYQDFQDVEAFRRQIEQMQQRE
Sbjct  121  HVAYVRFASVYQDFQDVEAFRRQIEQMQQRE  151


> A3M1A1 Transcriptional repressor NrdR [Acinetobacter baumannii 
(strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)]
Length=152

 Score =  294 bits (752),  Expect = 9e-106
 Identities = 146/151 (97%), Positives = 149/151 (99%), Gaps = 0/151 (0%)

Query  1    MHCPFCNAADSKVIDSRLAAEGCQIRRRRECISCGERFTTFESYEVVMPRVIKSNGKNEP  60
            MHCPFCNAADSKVIDSRLAAEGCQIRRRREC+SCGERFTTFESYEVVMPRVIKSNGKNEP
Sbjct  1    MHCPFCNAADSKVIDSRLAAEGCQIRRRRECVSCGERFTTFESYEVVMPRVIKSNGKNEP  60

Query  61   FDEAKLRRSLMHALQKRPVTQEQIEAVLSDIQLKIRRLGERDVKSRMIGEIVMQALFALD  120
            FDEAKLRRSLMHALQKRPVTQEQIE VLSDIQL+IRRLGERDVKSR IGEIVMQ+LFALD
Sbjct  61   FDEAKLRRSLMHALQKRPVTQEQIETVLSDIQLQIRRLGERDVKSRTIGEIVMQSLFALD  120

Query  121  HVAYVRFASVYQDFQDVEAFRRQIEQMQQRE  151
            HVAYVRFASVYQDFQDVEAFRRQIEQMQQRE
Sbjct  121  HVAYVRFASVYQDFQDVEAFRRQIEQMQQRE  151


> B0VDB2 Transcriptional repressor NrdR [Acinetobacter baumannii 
(strain AYE)]
Length=152

 Score =  294 bits (752),  Expect = 9e-106
 Identities = 146/151 (97%), Positives = 149/151 (99%), Gaps = 0/151 (0%)

Query  1    MHCPFCNAADSKVIDSRLAAEGCQIRRRRECISCGERFTTFESYEVVMPRVIKSNGKNEP  60
            MHCPFCNAADSKVIDSRLAAEGCQIRRRREC+SCGERFTTFESYEVVMPRVIKSNGKNEP
Sbjct  1    MHCPFCNAADSKVIDSRLAAEGCQIRRRRECVSCGERFTTFESYEVVMPRVIKSNGKNEP  60

Query  61   FDEAKLRRSLMHALQKRPVTQEQIEAVLSDIQLKIRRLGERDVKSRMIGEIVMQALFALD  120
            FDEAKLRRSLMHALQKRPVTQEQIE VLSDIQL+IRRLGERDVKSR IGEIVMQ+LFALD
Sbjct  61   FDEAKLRRSLMHALQKRPVTQEQIETVLSDIQLQIRRLGERDVKSRTIGEIVMQSLFALD  120

Query  121  HVAYVRFASVYQDFQDVEAFRRQIEQMQQRE  151
            HVAYVRFASVYQDFQDVEAFRRQIEQMQQRE
Sbjct  121  HVAYVRFASVYQDFQDVEAFRRQIEQMQQRE  151


> Q4FPR9 Transcriptional repressor NrdR [Psychrobacter arcticus 
(strain DSM 17307 / 273-4)]
Length=152

 Score =  201 bits (510),  Expect = 4e-69
 Identities = 93/152 (61%), Positives = 126/152 (83%), Gaps = 0/152 (0%)

Query  1    MHCPFCNAADSKVIDSRLAAEGCQIRRRRECISCGERFTTFESYEVVMPRVIKSNGKNEP  60
            MHCP+CNA+D+KVIDSRLAAEG Q+RRRR C SC ERFTTFE  EVVMPR+IKS+GK EP
Sbjct  1    MHCPYCNASDTKVIDSRLAAEGAQVRRRRSCNSCQERFTTFEVVEVVMPRIIKSSGKIEP  60

Query  61   FDEAKLRRSLMHALQKRPVTQEQIEAVLSDIQLKIRRLGERDVKSRMIGEIVMQALFALD  120
            +D  KLRRS++  LQKRP+T ++ EA++S I+ ++R++GER+V S+++GEI+M  L  LD
Sbjct  61   YDNDKLRRSILLPLQKRPITIDEQEAMISRIEKRVRQMGEREVSSKVLGEIIMSELKTLD  120

Query  121  HVAYVRFASVYQDFQDVEAFRRQIEQMQQREQ  152
             VAYVRFASVY+DFQD++AF ++I  ++  ++
Sbjct  121  DVAYVRFASVYRDFQDIDAFHQEIANIRPNDK  152


> Q1Q7V5 Transcriptional repressor NrdR [Psychrobacter cryohalolentis 
(strain K5)]
Length=152

 Score =  199 bits (505),  Expect = 2e-68
 Identities = 92/152 (61%), Positives = 125/152 (82%), Gaps = 0/152 (0%)

Query  1    MHCPFCNAADSKVIDSRLAAEGCQIRRRRECISCGERFTTFESYEVVMPRVIKSNGKNEP  60
            MHCP+CNA+++KVIDSRLAAEG Q+RRRR C SC ERFTTFE  EVVMPR+IKS+GK EP
Sbjct  1    MHCPYCNASETKVIDSRLAAEGAQVRRRRSCNSCQERFTTFEVVEVVMPRIIKSSGKIEP  60

Query  61   FDEAKLRRSLMHALQKRPVTQEQIEAVLSDIQLKIRRLGERDVKSRMIGEIVMQALFALD  120
            +D  KLRRS++  LQKRP+T ++ E ++S I+ ++R++GER+V S+++GEI+M  L  LD
Sbjct  61   YDNDKLRRSILLPLQKRPITIDEQEGMISRIEKRVRQMGEREVSSKVLGEIIMSELKTLD  120

Query  121  HVAYVRFASVYQDFQDVEAFRRQIEQMQQREQ  152
             VAYVRFASVY+DFQD++AF ++I  ++  E+
Sbjct  121  DVAYVRFASVYRDFQDIDAFHQEIANIRPNEK  152


> A5WI35 Transcriptional repressor NrdR [Psychrobacter sp. (strain 
PRwf-1)]
Length=153

 Score =  198 bits (503),  Expect = 5e-68
 Identities = 93/153 (61%), Positives = 125/153 (82%), Gaps = 0/153 (0%)

Query  1    MHCPFCNAADSKVIDSRLAAEGCQIRRRRECISCGERFTTFESYEVVMPRVIKSNGKNEP  60
            M CP+CNA D+KVIDSRLAAEG Q+RRRR+C  C ERFTTFE  EVVMPR+IKSNG+ EP
Sbjct  1    MQCPYCNADDTKVIDSRLAAEGAQVRRRRQCNQCQERFTTFEVVEVVMPRIIKSNGRIEP  60

Query  61   FDEAKLRRSLMHALQKRPVTQEQIEAVLSDIQLKIRRLGERDVKSRMIGEIVMQALFALD  120
            +D  KL+RS+   LQKRPVT ++ EA++S I+ +IR+LGER++ S+ +GE+VM  L  LD
Sbjct  61   YDSQKLKRSIQLPLQKRPVTLDEQEAMISRIEKRIRQLGEREISSKGLGEVVMSELKELD  120

Query  121  HVAYVRFASVYQDFQDVEAFRRQIEQMQQREQE  153
             VAYVRFASVY+DFQD+EAFR++++ ++  +++
Sbjct  121  DVAYVRFASVYRDFQDIEAFRQELQNIRPVDEQ  153


> B7V7Q1 Transcriptional repressor NrdR [Pseudomonas aeruginosa 
(strain LESB58)]
Length=154

 Score =  192 bits (489),  Expect = 6e-66
 Identities = 89/147 (61%), Positives = 118/147 (80%), Gaps = 0/147 (0%)

Query  1    MHCPFCNAADSKVIDSRLAAEGCQIRRRRECISCGERFTTFESYEVVMPRVIKSNGKNEP  60
            MHCPFC A D+KVIDSRL AEG Q+RRRREC++CGERFTTFE+ E+VMPR+IK +G  +P
Sbjct  1    MHCPFCGAHDTKVIDSRLVAEGDQVRRRRECLACGERFTTFETAELVMPRLIKQDGSRQP  60

Query  61   FDEAKLRRSLMHALQKRPVTQEQIEAVLSDIQLKIRRLGERDVKSRMIGEIVMQALFALD  120
            FDE KLR  +  AL+KRPV+ E++EA +  I+ ++R  GER++KSR++GE+VM  L  LD
Sbjct  61   FDEDKLRAGMQRALEKRPVSVERLEAAIGHIKHQLRATGEREIKSRVLGELVMAELQKLD  120

Query  121  HVAYVRFASVYQDFQDVEAFRRQIEQM  147
             VAY+RFASVY+ FQD+  FR +IE++
Sbjct  121  EVAYIRFASVYRRFQDLNEFREEIERL  147


> Q02SM4 Transcriptional repressor NrdR [Pseudomonas aeruginosa 
(strain UCBPP-PA14)]
Length=154

 Score =  192 bits (489),  Expect = 6e-66
 Identities = 89/147 (61%), Positives = 118/147 (80%), Gaps = 0/147 (0%)

Query  1    MHCPFCNAADSKVIDSRLAAEGCQIRRRRECISCGERFTTFESYEVVMPRVIKSNGKNEP  60
            MHCPFC A D+KVIDSRL AEG Q+RRRREC++CGERFTTFE+ E+VMPR+IK +G  +P
Sbjct  1    MHCPFCGAHDTKVIDSRLVAEGDQVRRRRECLACGERFTTFETAELVMPRLIKQDGSRQP  60

Query  61   FDEAKLRRSLMHALQKRPVTQEQIEAVLSDIQLKIRRLGERDVKSRMIGEIVMQALFALD  120
            FDE KLR  +  AL+KRPV+ E++EA +  I+ ++R  GER++KSR++GE+VM  L  LD
Sbjct  61   FDEDKLRAGMQRALEKRPVSVERLEAAIGHIKHQLRATGEREIKSRVLGELVMAELQKLD  120

Query  121  HVAYVRFASVYQDFQDVEAFRRQIEQM  147
             VAY+RFASVY+ FQD+  FR +IE++
Sbjct  121  EVAYIRFASVYRRFQDLNEFREEIERL  147


> Q9HWX1 Transcriptional repressor NrdR [Pseudomonas aeruginosa 
(strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 
12228 / 1C / PRS 101 / PAO1)]
Length=154

 Score =  192 bits (489),  Expect = 6e-66
 Identities = 89/147 (61%), Positives = 118/147 (80%), Gaps = 0/147 (0%)

Query  1    MHCPFCNAADSKVIDSRLAAEGCQIRRRRECISCGERFTTFESYEVVMPRVIKSNGKNEP  60
            MHCPFC A D+KVIDSRL AEG Q+RRRREC++CGERFTTFE+ E+VMPR+IK +G  +P
Sbjct  1    MHCPFCGAHDTKVIDSRLVAEGDQVRRRRECLACGERFTTFETAELVMPRLIKQDGSRQP  60

Query  61   FDEAKLRRSLMHALQKRPVTQEQIEAVLSDIQLKIRRLGERDVKSRMIGEIVMQALFALD  120
            FDE KLR  +  AL+KRPV+ E++EA +  I+ ++R  GER++KSR++GE+VM  L  LD
Sbjct  61   FDEDKLRAGMQRALEKRPVSVERLEAAIGHIKHQLRATGEREIKSRVLGELVMAELQKLD  120

Query  121  HVAYVRFASVYQDFQDVEAFRRQIEQM  147
             VAY+RFASVY+ FQD+  FR +IE++
Sbjct  121  EVAYIRFASVYRRFQDLNEFREEIERL  147


> C1DLH3 Transcriptional repressor NrdR [Azotobacter vinelandii 
(strain DJ / ATCC BAA-1303)]
Length=154

 Score =  192 bits (489),  Expect = 6e-66
 Identities = 91/149 (61%), Positives = 119/149 (80%), Gaps = 0/149 (0%)

Query  1    MHCPFCNAADSKVIDSRLAAEGCQIRRRRECISCGERFTTFESYEVVMPRVIKSNGKNEP  60
            MHCPFC+A D+KVIDSRL AEG Q+RRRREC +CGERFTTFE+ E+VMPRVIK +G  +P
Sbjct  1    MHCPFCSAHDTKVIDSRLVAEGDQVRRRRECQACGERFTTFETAELVMPRVIKQDGSRQP  60

Query  61   FDEAKLRRSLMHALQKRPVTQEQIEAVLSDIQLKIRRLGERDVKSRMIGEIVMQALFALD  120
            FDE KLR  +  AL+KRPV+ E++EA +  I+ ++R  GER+VKSR++GE+VM  L  LD
Sbjct  61   FDEDKLRAGMQRALEKRPVSVERLEAAIGRIKHELRATGEREVKSRVLGELVMAELRKLD  120

Query  121  HVAYVRFASVYQDFQDVEAFRRQIEQMQQ  149
             VAY+RFASVY+ FQD+  FR +IE++ +
Sbjct  121  EVAYIRFASVYRRFQDLNEFREEIERLSR  149


> A1TYW9 Transcriptional repressor NrdR [Marinobacter hydrocarbonoclasticus 
(strain ATCC 700491 / DSM 11845 / VT8)]
Length=172

 Score =  193 bits (490),  Expect = 8e-66
 Identities = 92/149 (62%), Positives = 117/149 (79%), Gaps = 0/149 (0%)

Query  1    MHCPFCNAADSKVIDSRLAAEGCQIRRRRECISCGERFTTFESYEVVMPRVIKSNGKNEP  60
            MHCPFC  AD+KVIDSRL AEG Q+RRRREC+SC ERFTTFE+ E+VMPRV+K +G  +P
Sbjct  1    MHCPFCGEADTKVIDSRLVAEGDQVRRRRECLSCRERFTTFETAELVMPRVVKQDGTRQP  60

Query  61   FDEAKLRRSLMHALQKRPVTQEQIEAVLSDIQLKIRRLGERDVKSRMIGEIVMQALFALD  120
            FDE KLR  +M AL+KRPV+ E+I+A L+ I+ ++R  GER+VKS  +GE VM  L  LD
Sbjct  61   FDEEKLRAGIMKALEKRPVSIEEIDAALNRIKYRLRSTGEREVKSMQLGEEVMTELRQLD  120

Query  121  HVAYVRFASVYQDFQDVEAFRRQIEQMQQ  149
             VAYVRFASVY+ FQD+  F+ +IE++ Q
Sbjct  121  KVAYVRFASVYRSFQDINEFKEEIERLSQ  149


> Q4K592 Transcriptional repressor NrdR [Pseudomonas fluorescens 
(strain ATCC BAA-477 / NRRL B-23932 / Pf-5)]
Length=154

 Score =  191 bits (486),  Expect = 2e-65
 Identities = 90/147 (61%), Positives = 118/147 (80%), Gaps = 0/147 (0%)

Query  1    MHCPFCNAADSKVIDSRLAAEGCQIRRRRECISCGERFTTFESYEVVMPRVIKSNGKNEP  60
            MHCPFC A D+KVIDSRL AEG Q+RRRREC++CGERFTTFE+ E+VMPR+IK++G  +P
Sbjct  1    MHCPFCGANDTKVIDSRLVAEGEQVRRRRECLACGERFTTFETAELVMPRLIKTDGSRQP  60

Query  61   FDEAKLRRSLMHALQKRPVTQEQIEAVLSDIQLKIRRLGERDVKSRMIGEIVMQALFALD  120
            FDE KLR  +  AL+KRPV+ E++EA L  I+ K+R  GER+VKS ++GE+VM  L  LD
Sbjct  61   FDEEKLRAGMQRALEKRPVSVERLEAALVHIKHKLRATGEREVKSLVVGELVMTELQKLD  120

Query  121  HVAYVRFASVYQDFQDVEAFRRQIEQM  147
             VAY+RFASVY+ FQD+  FR +I+++
Sbjct  121  EVAYIRFASVYRRFQDLNEFREEIDRL  147


> Q2S9R5 Transcriptional repressor NrdR [Hahella chejuensis (strain 
KCTC 2396)]
Length=170

 Score =  192 bits (487),  Expect = 2e-65
 Identities = 89/149 (60%), Positives = 119/149 (80%), Gaps = 0/149 (0%)

Query  1    MHCPFCNAADSKVIDSRLAAEGCQIRRRRECISCGERFTTFESYEVVMPRVIKSNGKNEP  60
            MHCPFC+AAD+KVIDSRL A+G Q+RRRREC+SC ERFTT+E+ E+VMPRV+K +G  EP
Sbjct  1    MHCPFCSAADTKVIDSRLVADGSQVRRRRECVSCSERFTTYEAAELVMPRVVKQDGTREP  60

Query  61   FDEAKLRRSLMHALQKRPVTQEQIEAVLSDIQLKIRRLGERDVKSRMIGEIVMQALFALD  120
            FDE KLR   + AL+KRPV+ E+IEA +  I+ ++R  GER++ SR+IGE VM  L  LD
Sbjct  61   FDEDKLRAGFLKALEKRPVSMEEIEAAVDRIKFRLRATGERELNSRVIGEEVMSELRELD  120

Query  121  HVAYVRFASVYQDFQDVEAFRRQIEQMQQ  149
             VA+VRFASVY+ FQD++ FR +I+++ +
Sbjct  121  QVAFVRFASVYRRFQDLDEFRAEIDKLSR  149


> P0A8D0 Transcriptional repressor NrdR [Escherichia coli (strain 
K12)]
Length=149

 Score =  178 bits (451),  Expect = 3e-60
 Identities = 81/148 (55%), Positives = 112/148 (76%), Gaps = 0/148 (0%)

Query  1    MHCPFCNAADSKVIDSRLAAEGCQIRRRRECISCGERFTTFESYEVVMPRVIKSNGKNEP  60
            MHCPFC A D+KVIDSRL  EG  +RRRR+C+ C ERFTTFE  E+VMPRV+KSN   EP
Sbjct  1    MHCPFCFAVDTKVIDSRLVGEGSSVRRRRQCLVCNERFTTFEVAELVMPRVVKSNDVREP  60

Query  61   FDEAKLRRSLMHALQKRPVTQEQIEAVLSDIQLKIRRLGERDVKSRMIGEIVMQALFALD  120
            F+E KLR  ++ AL+KRPV+ + +E  ++ I+ ++R  GER+V S+MIG +VM+ L  LD
Sbjct  61   FNEEKLRSGMLRALEKRPVSSDDVEMAINHIKSQLRATGEREVPSKMIGNLVMEQLKKLD  120

Query  121  HVAYVRFASVYQDFQDVEAFRRQIEQMQ  148
             VAY+RFASVY+ F+D++ F  +I +++
Sbjct  121  KVAYIRFASVYRSFEDIKEFGEEIARLE  148


> P33661 Transcriptional repressor NrdR [Clostridium acetobutylicum 
(strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM 
B-1787)]
Length=151

 Score =  137 bits (344),  Expect = 4e-44
 Identities = 65/144 (45%), Positives = 96/144 (67%), Gaps = 0/144 (0%)

Query  1    MHCPFCNAADSKVIDSRLAAEGCQIRRRRECISCGERFTTFESYEVVMPRVIKSNGKNEP  60
            M CPFC  ++SKV+DSR   +   IRRRREC+ C +R+TT+E  E +   VIK +   E 
Sbjct  1    MKCPFCGYSESKVVDSRSTEDNMAIRRRRECLECSKRYTTYEKVEDIPILVIKKDSSREF  60

Query  61   FDEAKLRRSLMHALQKRPVTQEQIEAVLSDIQLKIRRLGERDVKSRMIGEIVMQALFALD  120
            FD++K+   L+ + +KRPV+++QIE + SD++  I      +VKS  IGE+VM+ L  +D
Sbjct  61   FDKSKVINGLIKSCEKRPVSRQQIEDIASDVEKSISNQMVTEVKSDAIGEMVMEKLKEID  120

Query  121  HVAYVRFASVYQDFQDVEAFRRQI  144
             +AYVRFASVY+ F+D+  F  +I
Sbjct  121  EIAYVRFASVYRQFKDINTFMEEI  144


> P46227 Transcriptional repressor NrdR [Synechococcus sp. (strain 
ATCC 27144 / PCC 6301 / SAUG 1402/1)]
Length=168

 Score =  136 bits (342),  Expect = 1e-43
 Identities = 65/153 (42%), Positives = 100/153 (65%), Gaps = 0/153 (0%)

Query  1    MHCPFCNAADSKVIDSRLAAEGCQIRRRRECISCGERFTTFESYEVVMPRVIKSNGKNEP  60
            M CP C   DS+V++SR +  G  +RRRREC+SCG RFTT+E  E V   VIK NG  E 
Sbjct  1    MQCPACRHTDSRVLESRSSESGRSVRRRRECLSCGHRFTTYERVEFVPISVIKRNGDRES  60

Query  61   FDEAKLRRSLMHALQKRPVTQEQIEAVLSDIQLKIRRLGERDVKSRMIGEIVMQALFALD  120
            FD +KL R ++ A +K  V+ +Q++ ++ +I+  +++   RDV+S  IGE+V+Q +  L 
Sbjct  61   FDRSKLLRGIVRACEKTGVSAQQMDLLVDEIEGTLQQRSSRDVQSSEIGEMVLQQIGRLS  120

Query  121  HVAYVRFASVYQDFQDVEAFRRQIEQMQQREQE  153
             VAY+RFASVY+ F+ V  F   ++++Q   ++
Sbjct  121  EVAYIRFASVYRQFRGVRDFVETLDRLQDLSRD  153


> Q45549 Transcriptional repressor NrdR [Bacillus subtilis (strain 
168)]
Length=152

 Score =  131 bits (329),  Expect = 6e-42
 Identities = 66/152 (43%), Positives = 96/152 (63%), Gaps = 0/152 (0%)

Query  1    MHCPFCNAADSKVIDSRLAAEGCQIRRRRECISCGERFTTFESYEVVMPRVIKSNGKNEP  60
            M CP C    ++V+DSR   +G  IRRRREC SC  RFTTFE  E     V+K  G  E 
Sbjct  1    MKCPSCQHNGTRVLDSRPVDDGKSIRRRRECESCHYRFTTFEKVEETPLIVVKKEGVREE  60

Query  61   FDEAKLRRSLMHALQKRPVTQEQIEAVLSDIQLKIRRLGERDVKSRMIGEIVMQALFALD  120
            F   K+ R L+ A +KRPV+ + +E +  DI+ ++R  G  +VKS ++GE+VM  L  +D
Sbjct  61   FSREKMLRGLIKACEKRPVSLKTLEDMCFDIEKELRNQGCSEVKSELVGEMVMDRLAKID  120

Query  121  HVAYVRFASVYQDFQDVEAFRRQIEQMQQREQ  152
             VAYVRFASVY+ F+D+  F  +++ + ++E+
Sbjct  121  EVAYVRFASVYRQFKDINVFIDELKDLIKKER  152


> C7P544 Transcriptional repressor NrdR [Halomicrobium mukohataei 
(strain ATCC 700874 / DSM 12286 / JCM 9738 / NCIMB 13541)]
Length=162

 Score =  119 bits (299),  Expect = 2e-37
 Identities = 60/151 (40%), Positives = 94/151 (62%), Gaps = 0/151 (0%)

Query  1    MHCPFCNAADSKVIDSRLAAEGCQIRRRRECISCGERFTTFESYEVVMPRVIKSNGKNEP  60
            M+CP C    ++VID+  +A+G  +RRRREC  C  RFTT+E  E    +V K +G  E 
Sbjct  1    MNCPDCGNERTRVIDTETSADGTSVRRRRECQRCSFRFTTYERPEWESLQVKKRDGTIES  60

Query  61   FDEAKLRRSLMHALQKRPVTQEQIEAVLSDIQLKIRRLGERDVKSRMIGEIVMQALFALD  120
            FD  KLR  +  A++KR VT+  + A++ D++ +++    R V S +IGE+V ++L  LD
Sbjct  61   FDRQKLRAGIERAVEKRDVTETTVTALVDDVESELQGREARIVSSSLIGELVSESLRTLD  120

Query  121  HVAYVRFASVYQDFQDVEAFRRQIEQMQQRE  151
             VAY+RF SVY+ F + + F R+++ +   E
Sbjct  121  KVAYIRFVSVYKAFSEPQEFLRELDAVLDAE  151


> O86848 Transcriptional repressor NrdR [Streptomyces clavuligerus]
Length=172

 Score =  117 bits (292),  Expect = 3e-36
 Identities = 59/156 (38%), Positives = 90/156 (58%), Gaps = 3/156 (2%)

Query  1    MHCPFCNAADSKVIDSRLAAEGCQIRRRRECISCGERFTTFESYEVVMPRVIKSNGKNEP  60
            MHCPFC   DS+V+DSR   +G  IRRRR+C  C  RFTT E+  ++   VIK +G  EP
Sbjct  1    MHCPFCRHPDSRVVDSRTTDDGTSIRRRRQCPDCSRRFTTVETASLM---VIKRSGVTEP  57

Query  61   FDEAKLRRSLMHALQKRPVTQEQIEAVLSDIQLKIRRLGERDVKSRMIGEIVMQALFALD  120
            F   K+   +  A Q RPVT++ +  +   ++  +R  G  ++ +  +G  ++  L  LD
Sbjct  58   FSRTKVISGVRKACQGRPVTEDALAQLGQRVEEAVRATGSAELTTHDVGLAILGPLQELD  117

Query  121  HVAYVRFASVYQDFQDVEAFRRQIEQMQQREQECEK  156
             VAY+RFASVY+ F  +E F   I ++++     E+
Sbjct  118  LVAYLRFASVYRAFDSLEDFEAAIAELREHRLPAER  153


> O69980 Transcriptional repressor NrdR [Streptomyces coelicolor 
(strain ATCC BAA-471 / A3(2) / M145)]
Length=182

 Score =  115 bits (288),  Expect = 2e-35
 Identities = 57/149 (38%), Positives = 88/149 (59%), Gaps = 3/149 (2%)

Query  1    MHCPFCNAADSKVIDSRLAAEGCQIRRRRECISCGERFTTFESYEVVMPRVIKSNGKNEP  60
            MHCPFC   DS+V+DSR   +G  IRRRR+C  C  RFTT E+  ++   V+K +G  EP
Sbjct  1    MHCPFCRHPDSRVVDSRTTDDGTSIRRRRQCPDCSRRFTTVETCSLM---VVKRSGVTEP  57

Query  61   FDEAKLRRSLMHALQKRPVTQEQIEAVLSDIQLKIRRLGERDVKSRMIGEIVMQALFALD  120
            F   K+   +  A Q RPVT++ +  +   ++  +R  G  ++ +  +G  ++  L  LD
Sbjct  58   FSRTKVINGVRKACQGRPVTEDALAQLGQRVEEAVRATGSAELTTHDVGLAILGPLQELD  117

Query  121  HVAYVRFASVYQDFQDVEAFRRQIEQMQQ  149
             VAY+RFASVY+ F  +E F   I ++++
Sbjct  118  LVAYLRFASVYRAFDSLEDFEAAIAELRE  146


> Q47823 D-alanine--D-alanine ligase [Enterococcus gallinarum]
Length=316

 Score = 34.3 bits (77),  Expect = 9e-06
 Identities = 37/123 (30%), Positives = 59/123 (48%), Gaps = 14/123 (11%)

Query  41   FESYE--VVMPRVIK--SNGKNEPFDEAKLRRSLMHALQK--RPVTQEQIEAVLSDIQLK  94
            FE  E  ++ P  IK  + G +    +A+ R  L +ALQ+  R  T+  +E  +   +++
Sbjct  158  FEQCEGSLLYPMFIKPANMGSSVGITKAENREELQNALQEAYRYDTRAIVEQGIEAREIE  217

Query  95   IRRLGERDVKSRMIGEIVMQALFALDHVAYVRFASVYQDFQDVEAFRRQI-EQMQQREQE  153
            +  LG  DV++ M GEIV         VA+  + S Y D +       QI E+ Q + QE
Sbjct  218  VAVLGNEDVRTTMPGEIVKD-------VAFYDYNSKYLDNKIEMQIPAQIPEETQAKAQE  270

Query  154  CEK  156
              K
Sbjct  271  FAK  273


> Q8MQJ9 Brain tumor protein [Drosophila melanogaster]
Length=1037

 Score = 33.5 bits (75),  Expect = 2e-05
 Identities = 40/165 (24%), Positives = 66/165 (40%), Gaps = 21/165 (13%)

Query  4    PFCNAADSKVIDSRLAAEGCQIRRRRECISCGERFTTFESYEVVM-----------PRVI  52
            P C A  SK  D+      CQ      C++  E    F  + V +           P  +
Sbjct  177  PRCTACKSKCSDAVAKCFECQSYLCANCVTAHEFMHCFNGHNVCLIKGFEASTTGTPLSV  236

Query  53   KSNGKNEPFDEAKLRRSLMHALQKRPVTQEQIEAVLSDIQLKIRRLGERDVKSRMIGEIV  112
             S   N   +E K   SL   LQ+    Q+Q++   S  Q + ++L      S+ + +IV
Sbjct  237  GSPSNNPASNEFKYASSLTMMLQQ----QQQLD---SQQQQQQQQLLPAQPMSQ-LSKIV  288

Query  113  MQALFALDHVAYVRFASVYQDFQDVEAFRRQIEQMQQREQECEKH  157
            + A    +     R  S+Y      +  ++Q +Q QQR+  C +H
Sbjct  289  LAAAAQANSQEQQREDSIYGSLHPQQ--QQQQQQQQQRQLFCPRH  331



Lambda      K        H        a         alpha
   0.328    0.138    0.404    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 477240


  Database: cfe0e7877b7ba145b86d5ad6c18a49b4.SwissProt.fasta
    Posted date:  Sep 21, 2020  5:02 AM
  Number of letters in database: 4,977
  Number of sequences in database:  25



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40