ACIAD0226 / TrEMBL Alignments

BLASTP 2.2.28+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: d8cc7f655c800edb0f4d7222f804fe6d.TrEMBL.fasta
           21 sequences; 5,214 total letters



Query= ACIAD0226

Length=265
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  Q6FFG3 Putative lysozyme [Acinetobacter baylyi (strain ATCC 333...   555    0.0   
  A0A1H8S7D3 Lysozyme [Acinetobacter sp. yr461]                        382    2e-137
  K9A4F5 Glycosyl hydrolase family 25 [Acinetobacter sp. WC-141]       381    9e-137
  R8XZ41 Uncharacterized protein [Acinetobacter calcoaceticus ANC...   379    4e-136
  R8YES2 Uncharacterized protein [Acinetobacter pittii ANC 4050]       379    4e-136
  A0A009PF59 Glycosyl hydrolases 25 family protein [Acinetobacter...   379    4e-136
  A0A0J8T798 Lysozyme [Acinetobacter baumannii]                        379    4e-136
  A0A1P8ELW1 Lysozyme [Acinetobacter soli]                             379    5e-136
  N9HMM2 Uncharacterized protein [Acinetobacter baumannii NIPH 201]    379    5e-136
  A0A1S2GCI5 Lysozyme [Acinetobacter baumannii]                        379    5e-136
  A0A1E3M729 1,4-beta-N-acetylmuramidase [Acinetobacter baumannii]     379    5e-136
  A0A009HRK0 Glycosyl hydrolases 25 family protein [Acinetobacter...   379    5e-136
  N9QLY3 Uncharacterized protein [Acinetobacter sp. NIPH 542]          378    1e-135
  Q93T41 Uncharacterized protein [Bacillus anthracis]                  148    1e-46 
  O33985 Putative lysozyme [Saccharopolyspora erythraea]              95.9    1e-26 
  A4DA29 Glycosyl hydrolase, putative [Neosartorya fumigata (stra...  68.2    5e-17 
  Q5CCM2 Putative hydrolase [Streptomyces ambofaciens]                65.1    3e-16 
  A9YUX1 Lysozyme [Streptomyces griseus]                              65.5    8e-16 
  D9ZNF3 Endolysin [Clostridium phage phiCTP1]                        58.2    3e-13 
  O06496 Cortical-lytic enzyme [Clostridium perfringens]              52.8    2e-11 
  G5EAV9 Lysozyme [Emericella nidulans]                               50.8    6e-11 


> Q6FFG3 Putative lysozyme [Acinetobacter baylyi (strain ATCC 33305 
/ BD413 / ADP1)]
Length=264

 Score =  555 bits (1429),  Expect = 0.0
 Identities = 264/264 (100%), Positives = 264/264 (100%), Gaps = 0/264 (0%)

Query  1    MIRQIIHHKVGMKLPHQLRLLYSPKFLGIGFSLVMVILIYVGFFYNQMASAQDYTVRGFD  60
            MIRQIIHHKVGMKLPHQLRLLYSPKFLGIGFSLVMVILIYVGFFYNQMASAQDYTVRGFD
Sbjct  1    MIRQIIHHKVGMKLPHQLRLLYSPKFLGIGFSLVMVILIYVGFFYNQMASAQDYTVRGFD  60

Query  61   VSHHQGNIDWAKISPQKFQFVYLKATEGGDFQDPKFQENWLKAREYHFHVGAYHFYRLCR  120
            VSHHQGNIDWAKISPQKFQFVYLKATEGGDFQDPKFQENWLKAREYHFHVGAYHFYRLCR
Sbjct  61   VSHHQGNIDWAKISPQKFQFVYLKATEGGDFQDPKFQENWLKAREYHFHVGAYHFYRLCR  120

Query  121  DGKTQAENFIATVPKKIDALPPVIDLEYDANCINTYTKEQLLEQIKVTHDLLKAHYGKQP  180
            DGKTQAENFIATVPKKIDALPPVIDLEYDANCINTYTKEQLLEQIKVTHDLLKAHYGKQP
Sbjct  121  DGKTQAENFIATVPKKIDALPPVIDLEYDANCINTYTKEQLLEQIKVTHDLLKAHYGKQP  180

Query  181  IFYVSKNFYHIVLMGSFQNAPLWIRDYDGKPELKDDRQWLFWQYTSKSSIKGIEKPVDLN  240
            IFYVSKNFYHIVLMGSFQNAPLWIRDYDGKPELKDDRQWLFWQYTSKSSIKGIEKPVDLN
Sbjct  181  IFYVSKNFYHIVLMGSFQNAPLWIRDYDGKPELKDDRQWLFWQYTSKSSIKGIEKPVDLN  240

Query  241  VYAGSLQHWQQFVNQKSQITNTVK  264
            VYAGSLQHWQQFVNQKSQITNTVK
Sbjct  241  VYAGSLQHWQQFVNQKSQITNTVK  264


> A0A1H8S7D3 Lysozyme [Acinetobacter sp. yr461]
Length=253

 Score =  382 bits (982),  Expect = 2e-137
 Identities = 171/230 (74%), Positives = 201/230 (87%), Gaps = 0/230 (0%)

Query  27   LGIGFSLVMVILIYVGFFYNQMASAQDYTVRGFDVSHHQGNIDWAKISPQKFQFVYLKAT  86
            +GIG + VM +L Y G FY Q A AQDY V+GFDVSHHQG+IDW KISP+KFQFVYLKAT
Sbjct  18   IGIGLACVMGVLAYFGLFYQQKAVAQDYPVQGFDVSHHQGDIDWKKISPEKFQFVYLKAT  77

Query  87   EGGDFQDPKFQENWLKAREYHFHVGAYHFYRLCRDGKTQAENFIATVPKKIDALPPVIDL  146
            EGGD++D KFQENWLKARE+ FHVGAYHFYRLCRDGKTQA+NFIATVPKK DALPPVIDL
Sbjct  78   EGGDYKDSKFQENWLKAREHGFHVGAYHFYRLCRDGKTQADNFIATVPKKSDALPPVIDL  137

Query  147  EYDANCINTYTKEQLLEQIKVTHDLLKAHYGKQPIFYVSKNFYHIVLMGSFQNAPLWIRD  206
            EYD+NCINT+TKEQL+++I + HD LK HYGKQPIFY+SK FYHIVL+GSF N PLW+RD
Sbjct  138  EYDSNCINTHTKEQLIKEIGIMHDRLKQHYGKQPIFYISKTFYHIVLIGSFPNTPLWVRD  197

Query  207  YDGKPELKDDRQWLFWQYTSKSSIKGIEKPVDLNVYAGSLQHWQQFVNQK  256
            Y+GKPELKD R+WLFWQ++++  I+GI KPVDLNVY GS++ W QF+ Q+
Sbjct  198  YEGKPELKDKRKWLFWQHSNQGKIEGITKPVDLNVYEGSVKEWHQFLQQQ  247


> K9A4F5 Glycosyl hydrolase family 25 [Acinetobacter sp. WC-141]
Length=252

 Score =  381 bits (978),  Expect = 9e-137
 Identities = 170/230 (74%), Positives = 200/230 (87%), Gaps = 0/230 (0%)

Query  27   LGIGFSLVMVILIYVGFFYNQMASAQDYTVRGFDVSHHQGNIDWAKISPQKFQFVYLKAT  86
            +GIG + VM +L Y G FY Q A AQDY V+GFDVSHHQG+IDW KISP+KFQFVYLKAT
Sbjct  17   IGIGLACVMGVLAYFGLFYQQKAVAQDYPVQGFDVSHHQGDIDWKKISPEKFQFVYLKAT  76

Query  87   EGGDFQDPKFQENWLKAREYHFHVGAYHFYRLCRDGKTQAENFIATVPKKIDALPPVIDL  146
            EGGD+QD KFQENWLKARE+ FHVGAYHFYRLCRDGKTQA+NFIATVPKK+DALPPVIDL
Sbjct  77   EGGDYQDSKFQENWLKAREHGFHVGAYHFYRLCRDGKTQADNFIATVPKKLDALPPVIDL  136

Query  147  EYDANCINTYTKEQLLEQIKVTHDLLKAHYGKQPIFYVSKNFYHIVLMGSFQNAPLWIRD  206
            EYD NCIN++TKEQLL++I + HD LK HYGK PIFY+SK FYHIVL+GSF N PLW+RD
Sbjct  137  EYDGNCINSHTKEQLLKEIGIMHDRLKQHYGKPPIFYISKTFYHIVLIGSFPNTPLWVRD  196

Query  207  YDGKPELKDDRQWLFWQYTSKSSIKGIEKPVDLNVYAGSLQHWQQFVNQK  256
            Y+GKPELKD R+WLFWQ++++  I+G+ KPVDLNVY GS++ W QF+ Q+
Sbjct  197  YEGKPELKDKRKWLFWQHSNQGKIEGMTKPVDLNVYEGSVKEWHQFLQQQ  246


> R8XZ41 Uncharacterized protein [Acinetobacter calcoaceticus ANC 
3811]
Length=252

 Score =  379 bits (974),  Expect = 4e-136
 Identities = 170/232 (73%), Positives = 200/232 (86%), Gaps = 0/232 (0%)

Query  26   FLGIGFSLVMVILIYVGFFYNQMASAQDYTVRGFDVSHHQGNIDWAKISPQKFQFVYLKA  85
            F+GIG   V+ +L Y G FY Q A AQDY V+GFDVSHHQG+IDW KISP+KFQFVYLKA
Sbjct  16   FIGIGLGCVLGVLAYFGLFYQQKAVAQDYPVQGFDVSHHQGDIDWKKISPEKFQFVYLKA  75

Query  86   TEGGDFQDPKFQENWLKAREYHFHVGAYHFYRLCRDGKTQAENFIATVPKKIDALPPVID  145
            TEGGD++D KFQENWLKARE+  HVGAYHFYRLCRDGKTQA+NFIATVPKK DALPPVID
Sbjct  76   TEGGDYKDSKFQENWLKAREHGLHVGAYHFYRLCRDGKTQADNFIATVPKKSDALPPVID  135

Query  146  LEYDANCINTYTKEQLLEQIKVTHDLLKAHYGKQPIFYVSKNFYHIVLMGSFQNAPLWIR  205
            LEYD NCIN++TKEQLL++I + HD LK HYGKQPIFY+SK FYHIVL+GSF N PLW+R
Sbjct  136  LEYDGNCINSHTKEQLLKEIGIMHDRLKQHYGKQPIFYISKTFYHIVLIGSFPNTPLWVR  195

Query  206  DYDGKPELKDDRQWLFWQYTSKSSIKGIEKPVDLNVYAGSLQHWQQFVNQKS  257
            DY+GKPELKD R+WLFWQ++++  I+G+ KPVDLNVY GS++ W QF+ Q+S
Sbjct  196  DYEGKPELKDKRKWLFWQHSNQGKIEGMVKPVDLNVYDGSVKEWHQFLQQQS  247


> R8YES2 Uncharacterized protein [Acinetobacter pittii ANC 4050]
Length=252

 Score =  379 bits (974),  Expect = 4e-136
 Identities = 169/230 (73%), Positives = 199/230 (87%), Gaps = 0/230 (0%)

Query  27   LGIGFSLVMVILIYVGFFYNQMASAQDYTVRGFDVSHHQGNIDWAKISPQKFQFVYLKAT  86
            +GIG + VM +L Y G FY Q A AQDY V+GFDVSHHQG+I+W KISP+KFQFVYLKAT
Sbjct  17   IGIGLACVMGVLAYFGLFYQQKAVAQDYPVQGFDVSHHQGDINWKKISPEKFQFVYLKAT  76

Query  87   EGGDFQDPKFQENWLKAREYHFHVGAYHFYRLCRDGKTQAENFIATVPKKIDALPPVIDL  146
            EGGD++DPKFQENWLKARE+ FHVGAYHFYRLCRDGKTQAENFIATVP K DALPPVIDL
Sbjct  77   EGGDYKDPKFQENWLKAREHGFHVGAYHFYRLCRDGKTQAENFIATVPNKTDALPPVIDL  136

Query  147  EYDANCINTYTKEQLLEQIKVTHDLLKAHYGKQPIFYVSKNFYHIVLMGSFQNAPLWIRD  206
            EYD NCIN +TKEQLL++I + HD LK HYGKQPIFY+SK FYHIVL+G+F N PLW+RD
Sbjct  137  EYDGNCINAHTKEQLLKEIGIMHDRLKQHYGKQPIFYISKTFYHIVLIGNFPNTPLWVRD  196

Query  207  YDGKPELKDDRQWLFWQYTSKSSIKGIEKPVDLNVYAGSLQHWQQFVNQK  256
            Y+GKPELKD R+WLFWQ++++  I+G+ KPVDLNVY GS++ W QF+ Q+
Sbjct  197  YEGKPELKDKRKWLFWQHSNQGKIEGMTKPVDLNVYEGSVKEWHQFLQQQ  246


> A0A009PF59 Glycosyl hydrolases 25 family protein [Acinetobacter 
baumannii 625974]
Length=252

 Score =  379 bits (974),  Expect = 4e-136
 Identities = 170/230 (74%), Positives = 200/230 (87%), Gaps = 0/230 (0%)

Query  27   LGIGFSLVMVILIYVGFFYNQMASAQDYTVRGFDVSHHQGNIDWAKISPQKFQFVYLKAT  86
            +GI  + VM +L Y G FY Q A AQDY V+GFDVSHHQ NI+W KISPQKFQFVYLKAT
Sbjct  17   IGIVLACVMGVLTYFGLFYQQKAIAQDYPVQGFDVSHHQENINWKKISPQKFQFVYLKAT  76

Query  87   EGGDFQDPKFQENWLKAREYHFHVGAYHFYRLCRDGKTQAENFIATVPKKIDALPPVIDL  146
            EGGD++DPKFQENWLKARE+ FHVGAYHFYRLCRDGKTQAENFIATVP K+DALPPVIDL
Sbjct  77   EGGDYKDPKFQENWLKAREHGFHVGAYHFYRLCRDGKTQAENFIATVPNKVDALPPVIDL  136

Query  147  EYDANCINTYTKEQLLEQIKVTHDLLKAHYGKQPIFYVSKNFYHIVLMGSFQNAPLWIRD  206
            EYD+NCIN++TKEQLL++I + HD LK HYGKQPIFY+SK FYHIVL+GSF N PLW+RD
Sbjct  137  EYDSNCINSHTKEQLLKEIGIMHDSLKHHYGKQPIFYISKTFYHIVLIGSFSNTPLWVRD  196

Query  207  YDGKPELKDDRQWLFWQYTSKSSIKGIEKPVDLNVYAGSLQHWQQFVNQK  256
            Y+GKPELKD R+WLFWQ++++  I+G+ KPVDLNVY GS++ W QF+ Q+
Sbjct  197  YEGKPELKDKRKWLFWQHSNQGKIEGMTKPVDLNVYEGSVKEWHQFLQQQ  246


> A0A0J8T798 Lysozyme [Acinetobacter baumannii]
Length=252

 Score =  379 bits (974),  Expect = 4e-136
 Identities = 170/230 (74%), Positives = 200/230 (87%), Gaps = 0/230 (0%)

Query  27   LGIGFSLVMVILIYVGFFYNQMASAQDYTVRGFDVSHHQGNIDWAKISPQKFQFVYLKAT  86
            +GI  + VM +L Y G FY Q A AQDY V+GFDVSHHQ NI+W KISPQKFQFVYLKAT
Sbjct  17   IGIVLACVMGVLTYFGLFYQQKAIAQDYPVQGFDVSHHQENINWKKISPQKFQFVYLKAT  76

Query  87   EGGDFQDPKFQENWLKAREYHFHVGAYHFYRLCRDGKTQAENFIATVPKKIDALPPVIDL  146
            EGGD++DPKFQENWLKARE+ FHVGAYHFYRLCRDGKTQAENFIATVP K+DALPPVIDL
Sbjct  77   EGGDYKDPKFQENWLKAREHGFHVGAYHFYRLCRDGKTQAENFIATVPNKVDALPPVIDL  136

Query  147  EYDANCINTYTKEQLLEQIKVTHDLLKAHYGKQPIFYVSKNFYHIVLMGSFQNAPLWIRD  206
            EYD+NCIN++TKEQLL++I + HD LK HYGKQPIFY+SK FYHIVL+GSF N PLW+RD
Sbjct  137  EYDSNCINSHTKEQLLKEIGIMHDSLKHHYGKQPIFYISKTFYHIVLIGSFSNTPLWVRD  196

Query  207  YDGKPELKDDRQWLFWQYTSKSSIKGIEKPVDLNVYAGSLQHWQQFVNQK  256
            Y+GKPELKD R+WLFWQ++++  I+G+ KPVDLNVY GS++ W QF+ Q+
Sbjct  197  YEGKPELKDKRKWLFWQHSNQGKIEGMTKPVDLNVYEGSVKEWHQFLQQQ  246


> A0A1P8ELW1 Lysozyme [Acinetobacter soli]
Length=248

 Score =  379 bits (973),  Expect = 5e-136
 Identities = 173/242 (71%), Positives = 202/242 (83%), Gaps = 0/242 (0%)

Query  12   MKLPHQLRLLYSPKFLGIGFSLVMVILIYVGFFYNQMASAQDYTVRGFDVSHHQGNIDWA  71
            MK  H L+ +    +LG+GFS++++IL+Y GFFYNQ ASAQDY V+GFDVSHHQG I+W+
Sbjct  1    MKSRHILKSISPAHWLGLGFSVLLLILLYFGFFYNQKASAQDYPVKGFDVSHHQGEINWS  60

Query  72   KISPQKFQFVYLKATEGGDFQDPKFQENWLKAREYHFHVGAYHFYRLCRDGKTQAENFIA  131
            KI   +F+FVYLKATEGGD+QDPKFQ+ WLKARE   HVGAYHFYRLCRDG  QAENFI 
Sbjct  61   KIPADQFRFVYLKATEGGDYQDPKFQDYWLKAREQRLHVGAYHFYRLCRDGTVQAENFIK  120

Query  132  TVPKKIDALPPVIDLEYDANCINTYTKEQLLEQIKVTHDLLKAHYGKQPIFYVSKNFYHI  191
            TVP K DALPPVIDLEYD  CI+TYT+EQLL++I++ HD LKAHYGKQPIFYVS  FYHI
Sbjct  121  TVPTKADALPPVIDLEYDTACIDTYTQEQLLKEIQIMHDRLKAHYGKQPIFYVSTRFYHI  180

Query  192  VLMGSFQNAPLWIRDYDGKPELKDDRQWLFWQYTSKSSIKGIEKPVDLNVYAGSLQHWQQ  251
            VLMG F+  PLWIR+YD KPELKD R+W+FWQY+ K  IKGIEKPVDLNVYAGSL+ W+ 
Sbjct  181  VLMGHFKETPLWIREYDQKPELKDQREWVFWQYSRKGKIKGIEKPVDLNVYAGSLKEWRD  240

Query  252  FV  253
            FV
Sbjct  241  FV  242


> N9HMM2 Uncharacterized protein [Acinetobacter baumannii NIPH 
201]
Length=252

 Score =  379 bits (973),  Expect = 5e-136
 Identities = 170/230 (74%), Positives = 200/230 (87%), Gaps = 0/230 (0%)

Query  27   LGIGFSLVMVILIYVGFFYNQMASAQDYTVRGFDVSHHQGNIDWAKISPQKFQFVYLKAT  86
            +GI  + VM +L Y G FY Q A AQDY V+GFDVSHHQ NI+W KISPQKFQFVYLKAT
Sbjct  17   IGIVLACVMGVLTYFGLFYQQKAIAQDYPVQGFDVSHHQENINWKKISPQKFQFVYLKAT  76

Query  87   EGGDFQDPKFQENWLKAREYHFHVGAYHFYRLCRDGKTQAENFIATVPKKIDALPPVIDL  146
            EGGD++DPKFQENWLKARE+ FHVGAYHFYRLCRDGKTQAENFIATVP K+DALPPVIDL
Sbjct  77   EGGDYKDPKFQENWLKAREHGFHVGAYHFYRLCRDGKTQAENFIATVPNKVDALPPVIDL  136

Query  147  EYDANCINTYTKEQLLEQIKVTHDLLKAHYGKQPIFYVSKNFYHIVLMGSFQNAPLWIRD  206
            EYD+NCIN++TKEQLL++I + HD LK HYGKQPIFY+SK FYHIVL+GSF N PLW+RD
Sbjct  137  EYDSNCINSHTKEQLLKEIGIMHDSLKHHYGKQPIFYISKTFYHIVLIGSFPNTPLWVRD  196

Query  207  YDGKPELKDDRQWLFWQYTSKSSIKGIEKPVDLNVYAGSLQHWQQFVNQK  256
            Y+GKPELKD R+WLFWQ++++  I+G+ KPVDLNVY GS++ W QF+ Q+
Sbjct  197  YEGKPELKDKRKWLFWQHSNQGKIEGMTKPVDLNVYEGSVKEWHQFLQQQ  246


> A0A1S2GCI5 Lysozyme [Acinetobacter baumannii]
Length=252

 Score =  379 bits (973),  Expect = 5e-136
 Identities = 170/230 (74%), Positives = 200/230 (87%), Gaps = 0/230 (0%)

Query  27   LGIGFSLVMVILIYVGFFYNQMASAQDYTVRGFDVSHHQGNIDWAKISPQKFQFVYLKAT  86
            +GI  + VM +L Y G FY Q A AQDY V+GFDVSHHQ NI+W KISPQKFQFVYLKAT
Sbjct  17   IGIVLACVMGVLTYFGLFYQQKAIAQDYPVQGFDVSHHQENINWKKISPQKFQFVYLKAT  76

Query  87   EGGDFQDPKFQENWLKAREYHFHVGAYHFYRLCRDGKTQAENFIATVPKKIDALPPVIDL  146
            EGGD++DPKFQENWLKARE+ FHVGAYHFYRLCRDGKTQAENFIATVP K+DALPPVIDL
Sbjct  77   EGGDYKDPKFQENWLKAREHGFHVGAYHFYRLCRDGKTQAENFIATVPNKVDALPPVIDL  136

Query  147  EYDANCINTYTKEQLLEQIKVTHDLLKAHYGKQPIFYVSKNFYHIVLMGSFQNAPLWIRD  206
            EYD+NCIN++TKEQLL++I + HD LK HYGKQPIFY+SK FYHIVL+GSF N PLW+RD
Sbjct  137  EYDSNCINSHTKEQLLKEIGIMHDSLKHHYGKQPIFYISKTFYHIVLIGSFPNTPLWVRD  196

Query  207  YDGKPELKDDRQWLFWQYTSKSSIKGIEKPVDLNVYAGSLQHWQQFVNQK  256
            Y+GKPELKD R+WLFWQ++++  I+G+ KPVDLNVY GS++ W QF+ Q+
Sbjct  197  YEGKPELKDKRKWLFWQHSNQGKIEGMTKPVDLNVYEGSVKEWHQFLQQQ  246


> A0A1E3M729 1,4-beta-N-acetylmuramidase [Acinetobacter baumannii]
Length=252

 Score =  379 bits (973),  Expect = 5e-136
 Identities = 170/230 (74%), Positives = 200/230 (87%), Gaps = 0/230 (0%)

Query  27   LGIGFSLVMVILIYVGFFYNQMASAQDYTVRGFDVSHHQGNIDWAKISPQKFQFVYLKAT  86
            +GI  + VM +L Y G FY Q A AQDY V+GFDVSHHQ NI+W KISPQKFQFVYLKAT
Sbjct  17   IGIVLACVMGVLTYFGLFYQQKAIAQDYPVQGFDVSHHQENINWKKISPQKFQFVYLKAT  76

Query  87   EGGDFQDPKFQENWLKAREYHFHVGAYHFYRLCRDGKTQAENFIATVPKKIDALPPVIDL  146
            EGGD++DPKFQENWLKARE+ FHVGAYHFYRLCRDGKTQAENFIATVP K+DALPPVIDL
Sbjct  77   EGGDYKDPKFQENWLKAREHGFHVGAYHFYRLCRDGKTQAENFIATVPNKVDALPPVIDL  136

Query  147  EYDANCINTYTKEQLLEQIKVTHDLLKAHYGKQPIFYVSKNFYHIVLMGSFQNAPLWIRD  206
            EYD+NCIN++TKEQLL++I + HD LK HYGKQPIFY+SK FYHIVL+GSF N PLW+RD
Sbjct  137  EYDSNCINSHTKEQLLKEIGIMHDSLKHHYGKQPIFYISKTFYHIVLIGSFPNTPLWVRD  196

Query  207  YDGKPELKDDRQWLFWQYTSKSSIKGIEKPVDLNVYAGSLQHWQQFVNQK  256
            Y+GKPELKD R+WLFWQ++++  I+G+ KPVDLNVY GS++ W QF+ Q+
Sbjct  197  YEGKPELKDKRKWLFWQHSNQGKIEGMTKPVDLNVYEGSVKEWHQFLQQQ  246


> A0A009HRK0 Glycosyl hydrolases 25 family protein [Acinetobacter 
baumannii (strain 1295743)]
Length=252

 Score =  379 bits (973),  Expect = 5e-136
 Identities = 170/230 (74%), Positives = 200/230 (87%), Gaps = 0/230 (0%)

Query  27   LGIGFSLVMVILIYVGFFYNQMASAQDYTVRGFDVSHHQGNIDWAKISPQKFQFVYLKAT  86
            +GI  + VM +L Y G FY Q A AQDY V+GFDVSHHQ NI+W KISPQKFQFVYLKAT
Sbjct  17   IGIVLACVMGVLTYFGLFYQQKAIAQDYPVQGFDVSHHQENINWKKISPQKFQFVYLKAT  76

Query  87   EGGDFQDPKFQENWLKAREYHFHVGAYHFYRLCRDGKTQAENFIATVPKKIDALPPVIDL  146
            EGGD++DPKFQENWLKARE+ FHVGAYHFYRLCRDGKTQAENFIATVP K+DALPPVIDL
Sbjct  77   EGGDYKDPKFQENWLKAREHGFHVGAYHFYRLCRDGKTQAENFIATVPNKVDALPPVIDL  136

Query  147  EYDANCINTYTKEQLLEQIKVTHDLLKAHYGKQPIFYVSKNFYHIVLMGSFQNAPLWIRD  206
            EYD+NCIN++TKEQLL++I + HD LK HYGKQPIFY+SK FYHIVL+GSF N PLW+RD
Sbjct  137  EYDSNCINSHTKEQLLKEIGIMHDSLKHHYGKQPIFYISKTFYHIVLIGSFPNTPLWVRD  196

Query  207  YDGKPELKDDRQWLFWQYTSKSSIKGIEKPVDLNVYAGSLQHWQQFVNQK  256
            Y+GKPELKD R+WLFWQ++++  I+G+ KPVDLNVY GS++ W QF+ Q+
Sbjct  197  YEGKPELKDKRKWLFWQHSNQGKIEGMTKPVDLNVYEGSVKEWHQFLQQQ  246


> N9QLY3 Uncharacterized protein [Acinetobacter sp. NIPH 542]
Length=252

 Score =  378 bits (971),  Expect = 1e-135
 Identities = 170/231 (74%), Positives = 199/231 (86%), Gaps = 0/231 (0%)

Query  26   FLGIGFSLVMVILIYVGFFYNQMASAQDYTVRGFDVSHHQGNIDWAKISPQKFQFVYLKA  85
            F+GIG   VM +L Y G FY Q A AQDY V+GFDVSHHQG+I+W KISP+KFQFVYLKA
Sbjct  16   FIGIGLGCVMGVLAYFGLFYQQKAVAQDYPVQGFDVSHHQGDINWKKISPEKFQFVYLKA  75

Query  86   TEGGDFQDPKFQENWLKAREYHFHVGAYHFYRLCRDGKTQAENFIATVPKKIDALPPVID  145
            TEGGD++D KFQENWLKARE+  HVGAYHFYRLCRDGKTQA+NFIATVPKK DALPPVID
Sbjct  76   TEGGDYKDSKFQENWLKAREHGLHVGAYHFYRLCRDGKTQADNFIATVPKKSDALPPVID  135

Query  146  LEYDANCINTYTKEQLLEQIKVTHDLLKAHYGKQPIFYVSKNFYHIVLMGSFQNAPLWIR  205
            LEYD NCIN++TKEQLL++I + HD LK HYGKQPIFY+SK FYHIVL+GSF N PLW+R
Sbjct  136  LEYDGNCINSHTKEQLLKEIGIMHDRLKQHYGKQPIFYISKTFYHIVLIGSFPNTPLWVR  195

Query  206  DYDGKPELKDDRQWLFWQYTSKSSIKGIEKPVDLNVYAGSLQHWQQFVNQK  256
            DY+GKPELKD R+WLFWQ++++  I+GI KPVDLNVY GS++ W QF+ Q+
Sbjct  196  DYEGKPELKDKRKWLFWQHSNQGKIEGIIKPVDLNVYEGSVKEWHQFLQQQ  246


> Q93T41 Uncharacterized protein [Bacillus anthracis]
Length=183

 Score =  148 bits (373),  Expect = 1e-46
 Identities = 71/178 (40%), Positives = 108/178 (61%), Gaps = 4/178 (2%)

Query  79   QFVYLKATEGGDFQDPKFQENWLKAREYHFHVGAYHFYRLCRDGKTQAENFIATVPKKID  138
            +F ++KATEG  F D  F +NW  A +    VGAYHF+     G+TQAE FI  VPK   
Sbjct  2    KFAFIKATEGSAFVDKYFSKNWTNANKTSMRVGAYHFFSFDSKGETQAEQFIRNVPKYKQ  61

Query  139  ALPPVIDLEYDAN-CINTYTKEQLLEQIKVTHDLLKAHYGKQPIFYVSKNFYHIVLMGSF  197
            ALPPVID+E+ AN   N   +E + +++ V  ++L+ HYGK+ I Y ++  Y + +  ++
Sbjct  62   ALPPVIDVEFYANKKDNPPKREDVTKELSVMIEMLEKHYGKKVILYATQEAYDLYIKDAY  121

Query  198  QNAPLWIRDYDGKPELKDDRQWLFWQYTSKSSIKGI---EKPVDLNVYAGSLQHWQQF  252
                +WIR    KP L D+R+W FWQYT++  + G    EK +DLNV+ G+ + ++ +
Sbjct  122  PQCDIWIRSVLTKPSLSDERKWTFWQYTNRGKLSGYNGKEKYIDLNVFYGNEEEFENY  179


> O33985 Putative lysozyme [Saccharopolyspora erythraea]
Length=241

 Score = 95.9 bits (237),  Expect = 1e-26
 Identities = 62/204 (30%), Positives = 98/204 (48%), Gaps = 8/204 (4%)

Query  58   GFDVSHHQGNIDWAKISPQKFQFVYLKATEGGDFQDPKFQENWLKAREYHFHVGAYHFYR  117
            G DVS+H G +D+AK+      F ++ AT+G  F    F   +  A E   +   YHF R
Sbjct  36   GIDVSNHNGEVDFAKVGADGRDFAFVLATDGESFTSDLFDSQYSGAGEAGLYRAGYHFAR  95

Query  118  LCRDGKTQAENFIATVPKKID--ALPPVIDLEYDANCINTYTKE--QLLEQIKVTHDLLK  173
                   QA+ F+ TV    D   +PPV+D+E + N    Y  +  Q+ E IK     +K
Sbjct  96   PDGSATKQADRFLKTVGSTNDGRTMPPVLDMEANPNGATCYGLDDAQMEEWIKSFVGRVK  155

Query  174  AHYGKQPIFYVSKNFYHIVLMGS--FQNAPLWIRDYD-GKP-ELKDDRQWLFWQYTSKSS  229
               G++ + Y S +F+      S  F   PLW  ++D  KP ++       FWQY++   
Sbjct  156  EKTGREAVIYTSPSFWKECTGNSEAFTTNPLWTAEWDVDKPSKVGGWPAHTFWQYSNSGK  215

Query  230  IKGIEKPVDLNVYAGSLQHWQQFV  253
            + G++  VD+N + G     ++FV
Sbjct  216  VDGVDGAVDVNRFNGGTAELEKFV  239


> A4DA29 Glycosyl hydrolase, putative [Neosartorya fumigata (strain 
ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100)]
Length=235

 Score = 68.2 bits (165),  Expect = 5e-17
 Identities = 51/190 (27%), Positives = 87/190 (46%), Gaps = 14/190 (7%)

Query  51   AQDYTVRGFDVSHHQGNIDWAKISPQKFQFVYLKATEGGDFQDPKFQENWLKAREYHFHV  110
            A+  TV+GFD+S+HQ ++++        QFV +KATEG  ++D  F  ++  A +     
Sbjct  24   ARATTVQGFDISNHQKSVNFEAAKKDGAQFVMIKATEGTTYKDTVFNSHYTGATKAGLLR  83

Query  111  GAYHFYRLCRD-GKTQAENFIATVPKKID---ALPPVIDLEYDANCINTYTKEQLLEQIK  166
            G YHF R  +  G TQA+ F+       D    LP ++D+EY+      Y      + + 
Sbjct  84   GGYHFARPDKSTGSTQAKFFLKNGGGWSDDNRTLPGMLDIEYNPYGATCYGLSH-SQMVA  142

Query  167  VTHDLLKAHY---GKQPIFYVSKNFYHIV---LMGSFQNAPLWIRDYDGKPELK---DDR  217
              HD +  ++    + P+ Y + ++++       G     PL +  Y   P      D +
Sbjct  143  WIHDFVNEYHHATSRWPMIYTTADWWNRCTGNAKGFGDKCPLVLAAYSSSPPKTIPGDWK  202

Query  218  QWLFWQYTSK  227
             W  WQ + K
Sbjct  203  TWTIWQNSDK  212


> Q5CCM2 Putative hydrolase [Streptomyces ambofaciens]
Length=185

 Score = 65.1 bits (157),  Expect = 3e-16
 Identities = 59/207 (29%), Positives = 93/207 (45%), Gaps = 36/207 (17%)

Query  56   VRGFDVSHHQGNIDWAKISPQKFQFVYLKATEGGDFQDPKFQENWLKAREYHFHVGAYHF  115
            +RG DVS +Q +            FV++KATEG  + +PK      +AR+    VG YHF
Sbjct  2    LRGIDVSAYQSST----YDTDGLSFVFVKATEGRSYVNPKLAAQTKRARDAGLVVGFYHF  57

Query  116  YRLCRDGKT-QAENFIATVPKKIDALPPVIDLEYDANCINTYT----KEQLLEQIKVTHD  170
              L     T QAE F++  P   D    ++ ++++     T+     K+  + ++K    
Sbjct  58   --LWPGNLTAQAEYFVSKAP---DRPGDILAVDWETTGEGTHASNAEKDSFIRKVKALRP  112

Query  171  LLKAHYGKQPIFYVSKNFYHIVLMGSFQNAPLWIRDY--DGKPELKDDRQWLFWQYTSKS  228
                    + + Y ++NF+  V   S+    LWI DY   GKP ++   +W F QYT   
Sbjct  113  ------DNRVVLYCNRNFWLNVDTTSYAGDGLWIADYVSAGKPRIQ--AKWRFHQYT---  161

Query  229  SIKGIEKPVDLNV----YAGSLQHWQQ  251
                 + PVD NV       +L+ W Q
Sbjct  162  -----DDPVDTNVADFASKAALKTWAQ  183


> A9YUX1 Lysozyme [Streptomyces griseus]
Length=274

 Score = 65.5 bits (158),  Expect = 8e-16
 Identities = 56/209 (27%), Positives = 90/209 (43%), Gaps = 18/209 (9%)

Query  58   GFDVSHHQGNIDWAKISPQKFQFVYLKATEGGDFQDPKFQENWLKAREYHFHVGAYHFYR  117
            G DVS HQGN++W+ +     ++ Y+KATEG  +++P F + +  +       GAYHF  
Sbjct  71   GVDVSSHQGNVNWSALWNSGVKWSYVKATEGTYYKNPYFAQQYNGSYNVGMIRGAYHFAT  130

Query  118  -LCRDGKTQAENFI---ATVPKKIDALPPVIDLEYDANCINTY--TKEQLLEQIKVTHDL  171
                 G  QA  F+       +    LP V+D+E++      Y  ++  ++  I+   + 
Sbjct  131  PNTTSGAAQANYFVDNGGGWSRDGKTLPGVLDIEWNPYGDQCYGLSQSAMVNWIRDFTNT  190

Query  172  LKAHYGKQPIFYVSKNFYHIV---LMGSFQNAPLWIRDYDGKPELKDDRQWLF---WQYT  225
             KA  G+  + Y + +++        G     PLW+  Y           W F   WQYT
Sbjct  191  YKARTGRDAVIYTATSWWTSCTGNYAGFGATNPLWVARYASSVGTL-PAGWGFYTMWQYT  249

Query  226  SKSSIKGIEKPVDLNVYAGSLQHWQQFVN  254
            S   I G     D N + G+    Q   N
Sbjct  250  STGPIVG-----DHNRFDGAYDRLQALAN  273


> D9ZNF3 Endolysin [Clostridium phage phiCTP1]
Length=274

 Score = 58.2 bits (139),  Expect = 3e-13
 Identities = 47/206 (23%), Positives = 82/206 (40%), Gaps = 14/206 (7%)

Query  60   DVSHHQGNIDWAKISPQKFQFVYLKATEGGDFQDPKFQENWLKAREYHFHVGAYHFYRLC  119
            D+S+  GN+D   +    +  +  KA+EGG F D  +++N+   +      GAYHF    
Sbjct  6    DISNLNGNVDVKLLFNLGYIGIIAKASEGGTFVDKYYKQNYTNTKAQGKITGAYHFANFS  65

Query  120  RDGKTQAE-NFIATVPKKIDALPPVIDLEYDANCINTYTKEQLLEQIKVTHDLLKAHYGK  178
               K Q E NF           P  + L+ +  C    T +  L  + +     K     
Sbjct  66   TIAKAQQEANFFLNC--IAGTTPDFVVLDLEQQCTGDIT-DACLAFLNIVAKKFKC----  118

Query  179  QPIFYVSKNFYHIVLMGSFQNAPLWIRDYD-GKPELKDDRQWLFWQYTSKSSIKGIEKPV  237
              + Y + +F    L       PLWI +Y    P      ++  WQ+T K  + GI   +
Sbjct  119  --VVYCNSSFIKEHLNSKICAYPLWIANYGVATPAFTLWTKYAMWQFTEKGQVSGISGYI  176

Query  238  DLNVYAGSLQHWQQFVNQKSQITNTV  263
            D +        + +++  + ++ N V
Sbjct  177  DFSYIT---DEFIKYIKGEDEVENLV  199


> O06496 Cortical-lytic enzyme [Clostridium perfringens]
Length=321

 Score = 52.8 bits (125),  Expect = 2e-11
 Identities = 51/210 (24%), Positives = 89/210 (42%), Gaps = 32/210 (15%)

Query  58   GFDVSHHQGNIDWAKISPQKFQFVYLKATEGGDFQ---DPKFQENWLKAREYHFHVGAYH  114
            G D++    ++++  ++     F+YL+A+  G  +   D KF E   + R      GAYH
Sbjct  11   GPDLNEFSRDVNFLTLAKNS-DFIYLRASGSGTGKLRIDNKFLEFAKECRRLGIPCGAYH  69

Query  115  FYRLCRD---GKTQAENFIATVPKKIDA-----LPPVIDLEYDANCINTYTKEQLLEQIK  166
            F +  +D      QA+ FI  + +         L PV+D+E   +   + T  +L+  I 
Sbjct  70   FAKPSKDLDSAVIQADQFIDVLQQGFGDGDYGDLFPVLDVETPTD--KSLTTTELVNWID  127

Query  167  VTHDLLKAHYGKQPIFYVSKNFYHIVLMGSFQ---------NAPLWIRDYDG-------K  210
               D  +    ++ + Y     + I L   F+         + PLWI  Y          
Sbjct  128  RFRDRFEEKTRRRLMLYTG--LFFIGLYDDFKVPGKGYPLSDMPLWIAMYTRIPSNPRIP  185

Query  211  PELKDDRQWLFWQYTSKSSIKGIEKPVDLN  240
            P +   ++W  WQ+T +  + G+  PVDLN
Sbjct  186  PNVGGWKRWTMWQFTDEGKLDGVGSPVDLN  215


 Score = 17.3 bits (33),  Expect = 6.5
 Identities = 6/20 (30%), Positives = 12/20 (60%), Gaps = 0/20 (0%)

Query  136  KIDALPPVIDLEYDANCINT  155
            K+D +   +DL +  N I++
Sbjct  204  KLDGVGSPVDLNWGPNSIDS  223


> G5EAV9 Lysozyme [Emericella nidulans]
Length=216

 Score = 50.8 bits (120),  Expect = 6e-11
 Identities = 40/138 (29%), Positives = 65/138 (47%), Gaps = 7/138 (5%)

Query  56   VRGFDVSHHQGNIDWAKISPQKFQFVYLKATEGGDFQDPKFQENWLKAREYHFHVGAYHF  115
            V+GFD+S+ Q  +D+        +FV +KATEG  F DP F  ++  A       G YHF
Sbjct  17   VQGFDISNWQPTVDYKGAYASGARFVMIKATEGTSFIDPLFNTHYPGATSAGLIRGGYHF  76

Query  116  -YRLCRDGKTQAENFIATVPKKID---ALPPVIDLEYDANCINTYTKEQLLEQIKVTHDL  171
             +     G  QA+ F+A           LP ++DLE  A C    +   ++  I    + 
Sbjct  77   AHPDSSSGSAQAKYFLAHGGGWSGDGITLPGMLDLE--AGCYG-LSATAMVSWISDFGET  133

Query  172  LKAHYGKQPIFYVSKNFY  189
             K+  G+ P+ Y + +++
Sbjct  134  YKSATGRYPMIYTTTSWW  151



Lambda      K        H        a         alpha
   0.326    0.141    0.448    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 939180


  Database: d8cc7f655c800edb0f4d7222f804fe6d.TrEMBL.fasta
    Posted date:  Sep 28, 2020  1:42 PM
  Number of letters in database: 5,214
  Number of sequences in database:  21



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40